HHsearch alignment for GI: 254780684 and conserved domain: PRK11000

>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional.
Probab=95.20  E-value=0.014  Score=37.91  Aligned_cols=33  Identities=39%  Similarity=0.474  Sum_probs=26.0

Q ss_pred             HHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHC
Q ss_conf             520022358503752667889999999987407
Q gi|254780684|r  153 DIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSD  185 (438)
Q Consensus       153 D~l~pig~GQR~gIfg~~GvGKt~Ll~~i~~~~  185 (438)
T Consensus        21 ~vsl~i~~Ge~~~llGpsG~GKSTllr~i~Gl~   53 (369)
T PRK11000         21 DINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLE   53 (369)
T ss_pred             CCEEEECCCCEEEEECCCCCHHHHHHHHHHCCC
T ss_conf             438898799899999999736999999997799