HHsearch alignment for GI: 254780684 and conserved domain: PRK11247

>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional.
Probab=94.80  E-value=0.02  Score=36.72  Aligned_cols=33  Identities=36%  Similarity=0.458  Sum_probs=28.7

Q ss_pred             HHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHC
Q ss_conf             520022358503752667889999999987407
Q gi|254780684|r  153 DIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSD  185 (438)
Q Consensus       153 D~l~pig~GQR~gIfg~~GvGKt~Ll~~i~~~~  185 (438)
T Consensus        30 dIs~~I~~GEiv~LiG~nGaGKSTLlr~i~Gl~   62 (257)
T PRK11247         30 QLDLHIPAGQFVAVVGRSGCGKSTLLRLLAGLE   62 (257)
T ss_pred             CEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC
T ss_conf             407588799899999899888999999996589