HHsearch alignment for GI: 254780684 and conserved domain: PRK11288

>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional.
Probab=94.72  E-value=0.35  Score=27.60  Aligned_cols=55  Identities=27%  Similarity=0.292  Sum_probs=22.3

Q ss_pred             CEEEEEECHHHHHHHHHHH--HHHCCCCCCCCCCCHHHHHHCCHHHHHHHCCCCCCCCEE
Q ss_conf             8899970989999998766--540477843236632455420044444311367885235
Q gi|254780684|r  251 NVLLILDSITRFAHSIREI--ATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNIT  308 (438)
Q Consensus       251 ~Vll~~Ds~tr~a~A~rei--s~~~ge~P~~~gyp~~~~~~~~~l~ERag~~~~~~GSiT  308 (438)
T Consensus       255 ~~~l~~~~l~~~~-~~~~vsl~v~~GEivgivG~nGsGKSTL~k~L--~Gl~~p~~G~I~  311 (501)
T PRK11288        255 DVRLRLKGLKGPG-LREPISFAVRRGEIVGFFGLVGAGRSELMKLL--YGATRRTAGQVY  311 (501)
T ss_pred             CEEEEEEECCCCC-CCCCEEEEEECCEEEEEECCCCCCHHHHHHHH--CCCCCCCCCEEE
T ss_conf             4379998503787-45663478708839997568886487999984--387488766599