HHsearch alignment for GI: 254780684 and conserved domain: PRK11300

>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional.
Probab=94.26  E-value=0.035  Score=34.88  Aligned_cols=39  Identities=13%  Similarity=0.227  Sum_probs=31.0

Q ss_pred             HHHHHHH-HHHHCCCCEEEEECCCCCCHHHHHHHHHHHCC
Q ss_conf             2458752-00223585037526678899999999874078
Q gi|254780684|r  148 GIRVIDI-FTPLCHGQRIGVFAGSGIGKSTLLSMFARSDC  186 (438)
Q Consensus       148 GIr~ID~-l~pig~GQR~gIfg~~GvGKt~Ll~~i~~~~~  186 (438)
T Consensus        17 ~~~al~~vs~~v~~Gei~~liGpnGaGKSTL~~~i~Gl~~   56 (255)
T PRK11300         17 GLLAVNNVNLEVREQEVVSLIGPNGAGKTTVFNCLTGFYK   56 (255)
T ss_pred             CEEEECCEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCC
T ss_conf             9998804088989997999998999649999999967988