HHsearch alignment for GI: 254780684 and conserved domain: PRK11823

>PRK11823 DNA repair protein RadA; Provisional.
Probab=96.44  E-value=0.031  Score=35.28  Aligned_cols=104  Identities=23%  Similarity=0.250  Sum_probs=64.9

Q ss_pred             CCCHHHHHHHHHHHHH--HCCCCEEEEECCCCCCHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHCCC-CCCEE
Q ss_conf             1001112458752002--23585037526678899999999874078983899312465223889999864277-55328
Q gi|254780684|r  142 EKGFKTGIRVIDIFTP--LCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSV  218 (438)
Q Consensus       142 ~e~L~TGIr~ID~l~p--ig~GQR~gIfg~~GvGKt~Ll~~i~~~~~~dv~V~alIGeR~rev~efi~~~~~~~-l~~tv  218 (438)
T Consensus        69 ~~R~~Tgi~ElDRVLGGGlV~GS~iLlgGePGIGKSTLlLQ~a~~la~~~~vLYvSGEES~~--Qik~RA~RLg~~~~~l  146 (454)
T PRK11823         69 EPRISTGIGELDRVLGGGLVPGSVVLIGGDPGIGKSTLLLQVAAALAAGGKVLYVSGEESLQ--QIKLRAERLGLPSDNL  146 (454)
T ss_pred             CCCCCCCCHHHHHCCCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEECCCHHHH--HHHHHHHHHCCCCCCC
T ss_conf             55323785566522158720664899507998889999999999985599579981501578--9999999758888873


Q ss_pred             EEEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHH
Q ss_conf             984157788034444445677788886426798899970989
Q gi|254780684|r  219 VVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSIT  260 (438)
Q Consensus       219 vv~~t~d~~~~~r~~a~~~a~~iAEyfr~~G~~Vll~~Ds~t  260 (438)
T Consensus       147 ~l~~et~l~~------------Il~~i~~~-~P~~lIIDSIQ  175 (454)
T PRK11823        147 YLLAETNLED------------ILATIEEE-KPDLVVIDSIQ  175 (454)
T ss_pred             EEEECCCHHH------------HHHHHHHH-CCCEEEEECHH
T ss_conf             7885368999------------99999860-99889994311