HHsearch alignment for GI: 254780684 and conserved domain: PRK12289

>PRK12289 ribosome-associated GTPase; Reviewed.
Probab=92.63  E-value=0.12  Score=31.10  Aligned_cols=158  Identities=16%  Similarity=0.097  Sum_probs=72.5

Q ss_pred             EEEEEEEEEECCEEEEECC---------------------CCCCCCCCEEEEECC-CCCEEEEEEEECCCEEEEEECCCC
Q ss_conf             2012899995258999826---------------------888873518999569-960799999741997999980485
Q gi|254780684|r   21 VQGGYISSITSVYYTVTCL---------------------SQYVCLGDFVVHQGK-NSDNLGQVIRINLDIVYICPVGIG   78 (438)
Q Consensus        21 ~~~G~V~~V~G~ii~v~Gl---------------------~~~v~iGelv~i~~~-~~~v~geVi~~~~~~~~l~~~~~~   78 (438)
T Consensus         8 ~l~G~Vi~~~~~fY~V~~d~~~~~~~~~llC~~Rg~lrk~~~~v~VGD~V~ve~~d~~~~~G~I~~IlpRkn~L~RP-~V   86 (351)
T PRK12289          8 QLLGTVVAVQANFYQVRLDQPPLNPPSLLLCTRRTRLKKIGQQVMVGDRVVVEEPDWQGQRGAIAEVLPRRTELDRP-PI   86 (351)
T ss_pred             CEEEEEEEEECCEEEEEECCCCCCCCCEEEEEEEEEECCCCCCCCCCCEEEEEECCCCCCEEEEEEEECCCCCEECC-CC
T ss_conf             43899997778679999546766777346678756642689987657779996417889818896870644515177-75


Q ss_pred             CCCCCCCEEEECCCCEEECCHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCC--------CCCCCCCCCCCCHHHHHH
Q ss_conf             574678889972885552466688654307763047887775553012112543--------330001331100111245
Q gi|254780684|r   79 EEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKV--------PPAMNRQRVEKGFKTGIR  150 (438)
Q Consensus        79 ~gI~~G~~V~~~g~~~i~vG~~lLGRViD~lG~PlDg~~~l~~~~~~~~i~~~~--------p~p~~R~~i~e~L~TGIr  150 (438)
T Consensus        87 ANvDq~liV~s~~~P--~~~~~~LDRfLv-~ae~~~-i~~vivln-K~DL~~~~e~~~~~~~~~~~GY~~i~iS~~~~~-  160 (351)
T PRK12289         87 ANVDQILLVFALAEP--PLDPWQLSRFLV-KAESTG-LEIQLCLN-KADLVSPTQQQQWQDRLAQWGYQPLFISVEQGI-  160 (351)
T ss_pred             CCCCEEEEEEECCCC--CCCHHHHHHHHH-HHHHCC-CCEEEEEE-HHHCCCHHHHHHHHHHHHHCCCCEEEEECCCCC-
T ss_conf             670359999965789--988779999999-999879-97899986-577499899999999999779828999678996-


Q ss_pred             HHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHC
Q ss_conf             87520022358503752667889999999987407
Q gi|254780684|r  151 VIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSD  185 (438)
Q Consensus       151 ~ID~l~pig~GQR~gIfg~~GvGKt~Ll~~i~~~~  185 (438)
T Consensus       161 gl~~L~~~L~~k~tv~~G~SGVGKSSLIN~L~p~~  195 (351)
T PRK12289        161 GLEALLKQLRNKITVVAGPSGVGKSSLINRLIPDV  195 (351)
T ss_pred             CHHHHHHHHCCCEEEEECCCCCCHHHHHHHHCCCH
T ss_conf             89999998759869998179887889887637412