HHsearch alignment for GI: 254780684 and conserved domain: TIGR01026

>TIGR01026 fliI_yscN ATPase FliI/YscN family; InterPro: IPR005714 Proteins in this entry show extensive homology to the ATP synthase F1 beta subunit, and are involved in type III protein secretion. They fall into the two separate functional groups outlined below. The first group, exemplified by the Salmonella typhimurium FliI protein (P26465 from SWISSPROT), is needed for flagellar assembly. Most structural components of the bacterial flagellum are translocated through the central channel of the growing flagellar structure by the type III flagellar protein-export apparatus in an ATPase-driven manner, to be assembled at the growing end. FliI is the ATPase that couples ATP hydrolysis to the translocation reaction , . The second group couples ATP hydrolysis to protein translocation in non-flagellar type III secretion systems. Often these systems are involved in virulence and pathogenicity. YscN (P40290 from SWISSPROT) from pathogenic Yersinia species, for example, energises the injection of antihost factors directly into eukaryotic cells, thus overcoming host defences .; GO: 0016887 ATPase activity, 0009058 biosynthetic process, 0015031 protein transport, 0005737 cytoplasm.
Probab=100.00  E-value=0  Score=1133.63  Aligned_cols=432  Identities=42%  Similarity=0.646  Sum_probs=405.7

Q ss_pred             CCHHHHHHHHHH-HHHCCCCEEEEEEEEEEECCEEEEECCCCCCCCCCEEEEECC---CCCEEEEEEEECCCEEEEEECC
Q ss_conf             923699999999-741334212012899995258999826888873518999569---9607999997419979999804
Q gi|254780684|r    1 MQKNLETLAQLA-EDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGK---NSDNLGQVIRINLDIVYICPVG   76 (438)
Q Consensus         1 m~~~l~~l~~~~-~~~~~~l~~~~G~V~~V~G~ii~v~Gl~~~v~iGelv~i~~~---~~~v~geVi~~~~~~~~l~~~~   76 (438)
T Consensus         1 m~~~~~~~~~~~~~~~d~~~~~~~G~v~~v~Gl~~ea~gp--~~~vG~~c~I~~~g~~~~~~~~EVVGf~~~~v~LmPy~   78 (455)
T TIGR01026         1 MERNLTTLYNRLAQEADLEAVKRVGRVTKVKGLLIEAVGP--QASVGDLCLIERKGSEGKEVVAEVVGFNGEKVLLMPYE   78 (455)
T ss_pred             CCCCHHHHHHHHHHHHHCCCEEEEEEEEEEEEEEEEEECC--CCCCCCEEEEEEECCCCCEEEEEEEEEECCEEEECCCC
T ss_conf             9610134888887532116302578999985268985247--76677778999737898779999885206756752365


Q ss_pred             CCCCCCCCCEEEECC----C-CEEE---CCHHHHHHHHHHHHHHCCCCC--CCCCCCEEEEECCCCCCCCCCCCCCCCHH
Q ss_conf             855746788899728----8-5552---466688654307763047887--77555301211254333000133110011
Q gi|254780684|r   77 IGEEISLGDLVFHWG----R-FRIS---PSACWCGRVINALGKPIDGDD--SLGKGDLSMEIMSKVPPAMNRQRVEKGFK  146 (438)
Q Consensus        77 ~~~gI~~G~~V~~~g----~-~~i~---vG~~lLGRViD~lG~PlDg~~--~l~~~~~~~~i~~~~p~p~~R~~i~e~L~  146 (438)
T Consensus        79 ~~~G~~~G~~V~~~~isae~~L~~~qlP~G~~LLGRVld~~G~PiD~~~~~~~~~~~~~~~l~~~~~nPl~R~~i~~~~~  158 (455)
T TIGR01026        79 EVEGVEPGSKVLAKNISAEEGLSIKQLPVGDGLLGRVLDGLGKPIDGKGKGFLDNVETEPALITAPINPLKREPIREILS  158 (455)
T ss_pred             CCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHEE
T ss_conf             44433534523320433002545574336876402448546871137777666543012552468988667630002100


Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHH-HCCCCCEEEEECCCCCHHHHHHHHHHHC-CCCCCEEEEEECC
Q ss_conf             1245875200223585037526678899999999874-0789838993124652238899998642-7755328984157
Q gi|254780684|r  147 TGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFAR-SDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATS  224 (438)
Q Consensus       147 TGIr~ID~l~pig~GQR~gIfg~~GvGKt~Ll~~i~~-~~~~dv~V~alIGeR~rev~efi~~~~~-~~l~~tvvv~~t~  224 (438)
T Consensus       159 tGVR~iD~LLTvGkGQR~GIFAGSGVGKStLlGMIARn~~~ADv~ViALIGERGREV~EFIE~~LG~EGLkrSV~VVaTS  238 (455)
T TIGR01026       159 TGVRSIDGLLTVGKGQRIGIFAGSGVGKSTLLGMIARNNTEADVNVIALIGERGREVKEFIEKDLGEEGLKRSVVVVATS  238 (455)
T ss_pred             CCCEEECCCCCCCCCCCEEEEECCCCCHHHHHHHHHHCCCCCCEEEEEEECCCCCCHHHHHHHHCCCCCCCEEEEEEECC
T ss_conf             36453101035556650135503760034456676300678982799864377774157886313656660117998368


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHCCHHHHHHHCCCCCC
Q ss_conf             78803444444567778888642679889997098999999876654047784323663245542004444431136788
Q gi|254780684|r  225 DESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEK  304 (438)
Q Consensus       225 d~~~~~r~~a~~~a~~iAEyfr~~G~~Vll~~Ds~tr~a~A~reis~~~ge~P~~~gyp~~~~~~~~~l~ERag~~~~~~  304 (438)
T Consensus       239 D~SPl~R~~GAy~At~iAEYFrdqGk~VlLlmDSvTRfA~AqREiGLA~GEPP~~kGYtPSVF~~LP~LlERaG~G~~~~  318 (455)
T TIGR01026       239 DQSPLLRLKGAYVATAIAEYFRDQGKDVLLLMDSVTRFAMAQREIGLAAGEPPATKGYTPSVFSLLPRLLERAGKGASGK  318 (455)
T ss_pred             CCCHHHHHHHHHEEHHHHHHHHHCCCEEEEEHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCC
T ss_conf             86388887326400254354652187056202027899889889987437777777778548899899997606873577


Q ss_pred             C-CEEEEEEEEECCCCC-CCHHHHHHHHHCCCEEEEEHHHHHCCCCCCCCCCCCCCCCCHHCCCHHHHHHHHHHHHHHHH
Q ss_conf             5-235543334216764-20278999861260898704277589713114456400022120899999999999999999
Q gi|254780684|r  305 G-NITAVISVLVDGDNH-NDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHR  382 (438)
Q Consensus       305 G-SiT~~~~v~~~~dd~-~~pi~~~~~~i~DG~i~L~r~la~~g~~Paid~~~S~SR~~~~~~~~~~~~~~~~~~~~l~~  382 (438)
T Consensus       319 GGSITAFYTVLVeGDD~s~ePiAD~~r~ILDGHIVLSR~LA~~g~YPAIdvl~S~SR~~~~i~s~~~~~~~~~fR~lLs~  398 (455)
T TIGR01026       319 GGSITAFYTVLVEGDDLSNEPIADSVRGILDGHIVLSRALADRGHYPAIDVLASISRLMTAIVSEEHKKAARKFRELLSK  398 (455)
T ss_pred             CCEEEEEEEEEECCCCCCCCCCCCCCCEEECCCEEECHHHHHCCCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHHHHHHH
T ss_conf             95798888886415678877724310225515355245886178978637555688988740748899999999999998


Q ss_pred             HHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHH
Q ss_conf             9999999985234469998999999999999998359988899976899999
Q gi|254780684|r  383 FEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEIT  434 (438)
Q Consensus       383 y~~~~~l~~~g~y~~g~d~~~d~~i~~~~~i~~fl~Q~~~e~~~~~~~~~~~  434 (438)
T Consensus       399 y~~~EdLiriG~Y~~GSd~e~D~AI~~~~~le~FL~Qg~~E~~~fE~s~~~L  450 (455)
T TIGR01026       399 YKENEDLIRIGAYKKGSDKELDKAIAKYPKLERFLKQGINEKVNFEESLQQL  450 (455)
T ss_pred             HHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHH
T ss_conf             8761323122025587886689998579998887547943463089999999