>TIGR01039 atpD ATP synthase F1, beta subunit; InterPro: IPR005722 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (F-, V- and A-ATPases contain rotary motors) and in the type of ions they transport , . F-ATPases (F1F0-ATPases) in mitochondria, chloroplasts and bacterial plasma membranes are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases) are primarily found in eukaryotic vacuoles, catalysing ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases) are found in Archaea and function like F-ATPases. P-ATPases (E1E2-ATPases) are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP. F-ATPases (also known as F1F0-ATPase, or H(+)-transporting two-sector ATPase) (3.6.3.14 from EC) are composed of two linked complexes: the F1 ATPase complex is the catalytic core and is composed of 5 subunits (alpha, beta, gamma, delta, epsilon), while the F0 ATPase complex is the membrane-embedded proton channel that is composed of at least 3 subunits (A-C), nine in mitochondria (A-G, F6, F8). Both the F1 and F0 complexes are rotary motors that are coupled back-to-back. In the F1 complex, the central gamma subunit forms the rotor inside the cylinder made of the alpha(3)beta(3) subunits, while in the F0 complex, the ring-shaped C subunits forms the rotor. The two rotors rotate in opposite directions, but the F0 rotor is usually stronger, using the force from the proton gradient to push the F1 rotor in reverse in order to drive ATP synthesis . These ATPases can also work in reverse to hydrolyse ATP to create a proton gradient. This entry represents the beta subunit found in the F1 complex of F-ATPases. In F-ATPases, there are three copies each of the alpha and beta subunits that form the catalytic core of the F1 complex, while the remaining F1 subunits (gamma, delta, epsilon) form part of the stalks. There is a substrate-binding site on each of the alpha and beta subunits, those on the beta subunits being catalytic, while those on the alpha subunits are regulatory. The alpha and beta subunits form a cylinder that is attached to the central stalk. The alpha/beta subunits undergo a sequence of conformational changes leading to the formation of ATP from ADP, which are induced by the rotation of the gamma subunit, itself is driven by the movement of protons through the F0 complex C subunit , . More information about this protein can be found at Protein of the Month: ATP Synthases .; GO: 0008553 hydrogen-exporting ATPase activity phosphorylative mechanism, 0046933 hydrogen ion transporting ATP synthase activity rotational mechanism, 0006754 ATP biosynthetic process, 0015986 ATP synthesis coupled proton transport, 0016021 integral to membrane.

Probab=100.00 E-value=0 Score=486.25 Aligned_cols=394 Identities=29% Similarity=0.433 Sum_probs=353.6 Q ss_pred EEEEEEEECCEEEEECCCCC-CCCCCEEEEECCCCCEEEEEEE-ECCCEEEEEECCCCCCCCCCCEEEECCC-CEEECCH Q ss_conf 12899995258999826888-8735189995699607999997-4199799998048557467888997288-5552466 Q gi|254780684|r 23 GGYISSITSVYYTVTCLSQY-VCLGDFVVHQGKNSDNLGQVIR-INLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSA 99 (438) Q Consensus 23 ~G~V~~V~G~ii~v~Gl~~~-v~iGelv~i~~~~~~v~geVi~-~~~~~~~l~~~~~~~gI~~G~~V~~~g~-~~i~vG~ 99 (438) T Consensus 2 ~G~~~~v~g~vvdv~f~~~~~P~~~~~l~~~~~~~-l~~e~~~~~G~~~vr~ia~~~~~Gl~r~~~~~~~~~~i~vPvG~ 80 (460) T TIGR01039 2 KGKVVQVIGPVVDVEFEESKLPEIYDALKVELEKE-LVLEVAQHLGDDTVRAIALDSTDGLVRGLEVVDTGKPIEVPVGK 80 (460) T ss_pred CCEEEEEEHHHEEEEECHHHHHHHHHHHHHHHHHH-HHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCEEEECCCC T ss_conf 86044401002011114000267998875541025-56344765067605678731433302213555438725511474 Q ss_pred HHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHH Q ss_conf 68865430776304788777555301211254333000133110011124587520022358503752667889999999 Q gi|254780684|r 100 CWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179 (438) Q Consensus 100 ~lLGRViD~lG~PlDg~~~l~~~~~~~~i~~~~p~p~~R~~i~e~L~TGIr~ID~l~pig~GQR~gIfg~~GvGKt~Ll~ 179 (438) T Consensus 81 ~~~G~~~nv~G~~~d~~~~~~~~~-~~~~~~~~P~~~~~~~~~~~l~tG~kv~dll~P~~~GGk~glfGGaGvGktv~~~ 159 (460) T TIGR01039 81 EVLGRIFNVLGEPIDEKGEVKKKE-KLPIHRKAPSFEEQSTKVEILETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIQ 159 (460) T ss_pred CHHHHHHHHHCHHCCCCCCCHHHH-HHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHH T ss_conf 045578766210003411100234-2012206851344334678987336888775154328806773176622456689 Q ss_pred HHHHH---CCCCCEEEEECCCCCHHHHHHHHHHHCCC-CC-CEEEEEECCCCCHHHHHHHHHHHHHHHHHHHH-CCCCEE Q ss_conf 98740---78983899312465223889999864277-55-32898415778803444444567778888642-679889 Q gi|254780684|r 180 MFARS---DCFDKVIISLVGERGREVREFIEDYLGDN-LK-KSVVVVATSDESPILRKMAPLTAVTIAEYFSS-KGDNVL 253 (438) Q Consensus 180 ~i~~~---~~~dv~V~alIGeR~rev~efi~~~~~~~-l~-~tvvv~~t~d~~~~~r~~a~~~a~~iAEyfr~-~G~~Vl 253 (438) T Consensus 160 eli~~~a~~~~G~sv~~GvGertreGndly~e~~~~~v~~~~~~lv~Gqm~ePPG~r~rva~~~lt~ae~frd~~~~dvl 239 (460) T TIGR01039 160 ELINNIAKEHGGLSVFAGVGERTREGNDLYLEMKESGVINSKVALVYGQMNEPPGARLRVALTGLTMAEYFRDEEGQDVL 239 (460) T ss_pred HHHHHHHHHHCCEEEEEECCCCCCCHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEE T ss_conf 99999998628807985066533325689999873241012326887213689874110345677888875112466378 Q ss_pred EEEECHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHCCHHHHHHHCCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHCC Q ss_conf 99709899999987665404778432366324554200444443113678852355433342167642027899986126 Q gi|254780684|r 254 LILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILD 333 (438) Q Consensus 254 l~~Ds~tr~a~A~reis~~~ge~P~~~gyp~~~~~~~~~l~ERag~~~~~~GSiT~~~~v~~~~dd~~~pi~~~~~~i~D 333 (438) T Consensus 240 ~f~dnifrf~~aG~e~s~llGr~PsavGyqPtl~~~~G~lqeri~--st~~~s~ts~qa~yvPadd~tdPaP~~~fahld 317 (460) T TIGR01039 240 LFIDNIFRFTQAGSEVSALLGRLPSAVGYQPTLATEMGELQERIT--STKKGSITSVQAVYVPADDLTDPAPATTFAHLD 317 (460) T ss_pred EEEHHHHHHHHHHHHHHHHHHCCCHHCCCCCCHHHHHHHHHHHHH--HCCCCCEEEEEEEEECCCCCCCCCCHHHHHHHH T ss_conf 851446777631047898861011000566303566767877765--213553256767863320257886303444400 Q ss_pred CEEEEEHHHHHCCCCCCCCCCCCCCCCC-HHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHH Q ss_conf 0898704277589713114456400022-120899999999999999999999999998523446999899999999999 Q gi|254780684|r 334 GHIVLNRSLAEEGRYPPVDPLASVSRLA-DKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPI 412 (438) Q Consensus 334 G~i~L~r~la~~g~~Paid~~~S~SR~~-~~~~~~~~~~~~~~~~~~l~~y~~~~~l~~~g~y~~g~d~~~d~~i~~~~~ 412 (438) T Consensus 318 a~~~l~r~~~~~GiyPav~Pl~s~s~~l~~~~vG~~hy~~a~~v~~~lq~y~~l~diiailG~de-l~~~d~~~v~rar~ 396 (460) T TIGR01039 318 ATTVLSRKIAELGIYPAVDPLDSTSRLLDPEVVGEEHYEVAREVQSILQRYKELQDIIAILGLDE-LSEEDKLVVERARK 396 (460) T ss_pred HHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHH-HHHHHHHHHHHHHH T ss_conf 02454566875177655465101344430565216789999999999998887888988843144-11446899999999 Q ss_pred HHHHHCCCC Q ss_conf 999835998 Q gi|254780684|r 413 IYDFLKQSP 421 (438) Q Consensus 413 i~~fl~Q~~ 421 (438) T Consensus 397 i~~flsq~~ 405 (460) T TIGR01039 397 IERFLSQPF 405 (460) T ss_pred HHHHHCCCH T ss_conf 998731320

HHsearch alignment for GI: 254780684 and conserved domain: TIGR01039