HHsearch alignment for GI: 254780684 and conserved domain: TIGR01041

>TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit; InterPro: IPR005724 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (F-, V- and A-ATPases contain rotary motors) and in the type of ions they transport , . F-ATPases (F1F0-ATPases) in mitochondria, chloroplasts and bacterial plasma membranes are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases) are primarily found in eukaryotic vacuoles, catalysing ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases) are found in Archaea and function like F-ATPases. P-ATPases (E1E2-ATPases) are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP. A-ATPases (or A1A0-ATPase) (3.6.3.14 from EC) are found exclusively in Archaea and display a close resemblance in structure and subunit composition with V-ATPases, although their function in both ATP synthesis and ATP hydrolysis is closer to that of F-ATPases . A-ATPases are composed of two linked complexes: the A1 complex consisting of seven subunits contains the catalytic core that synthesizes/hydrolyses ATP, while the A0 complex consisting of at least two subunits forms the membrane-spanning pore . The rotary motor in A-ATPases is composed of only two subunits, the stator subunit I and the rotor subunit C . A-ATPases may have arisen as an adaptation to the different cellular needs and the more extreme environmental conditions faced by Archaeal species. This entry represents the beta subunit from the A1 complex of A-ATPases. The A1 complex contains three copies each of subunits alpha (or A) (IPR005726 from INTERPRO), and beta (or B), both of which form the headpiece that participates in nucleotide binding. However, only the alpha subunit is catalytic, the beta subunit being regulatory in function . More information about this protein can be found at Protein of the Month: ATP Synthases .; GO: 0046933 hydrogen ion transporting ATP synthase activity rotational mechanism, 0046961 hydrogen ion transporting ATPase activity rotational mechanism, 0015986 ATP synthesis coupled proton transport, 0016021 integral to membrane, 0016469 proton-transporting two-sector ATPase complex.
Probab=100.00  E-value=0  Score=525.34  Aligned_cols=403  Identities=27%  Similarity=0.400  Sum_probs=372.6

Q ss_pred             EEEEEEEECCEEEEECCCCCCCCCCEEEEECC-CCCEEEEEEEECCCEEEEEECCCCCCCCCCC-EEEECCC-CEEECCH
Q ss_conf             12899995258999826888873518999569-9607999997419979999804855746788-8997288-5552466
Q gi|254780684|r   23 GGYISSITSVYYTVTCLSQYVCLGDFVVHQGK-NSDNLGQVIRINLDIVYICPVGIGEEISLGD-LVFHWGR-FRISPSA   99 (438)
Q Consensus        23 ~G~V~~V~G~ii~v~Gl~~~v~iGelv~i~~~-~~~v~geVi~~~~~~~~l~~~~~~~gI~~G~-~V~~~g~-~~i~vG~   99 (438)
T Consensus         2 y~~~~~~~GPl~~v~~~~-~~~y~e~v~~~~~~G~~~~G~vl~~~~~~~~~~~~~g~~~~~~~~~~v~~~G~~~~~~~~~   80 (458)
T TIGR01041         2 YKTITEIKGPLVIVEGVE-PVAYDEIVEIETPDGEKRRGQVLDSSEGLAVVQVFEGTTGLDKEATKVRFLGETLKLPVSE   80 (458)
T ss_pred             CCCCCCCCCCEEEEECCC-CCCCEEEEEEECCCCCCCCCCEEECCCCEEEEEEECCHHCCCCCCCEEEEECCEEEEHHHH
T ss_conf             654101037568984243-2121001566405787423403530376579885211101122341789841302420107


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHH
Q ss_conf             68865430776304788777555301211254333000133110011124587520022358503752667889999999
Q gi|254780684|r  100 CWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS  179 (438)
Q Consensus       100 ~lLGRViD~lG~PlDg~~~l~~~~~~~~i~~~~p~p~~R~~i~e~L~TGIr~ID~l~pig~GQR~gIfg~~GvGKt~Ll~  179 (438)
T Consensus        81 ~~lGr~~~g~G~~~d~GP~~~~~-~~~~~~G~~~nP~~r~~P~~fiqtG~s~idG~n~l~rG~kl~~fs~sGlP~~~la~  159 (458)
T TIGR01041        81 DLLGRILNGSGEPIDGGPEIVPD-ERRDINGAALNPAAREYPEEFIQTGISAIDGMNTLVRGQKLPIFSGSGLPHNELAA  159 (458)
T ss_pred             HHHHHHHHCCCCCCCCCCCCCCC-CHHCCCCCCCCCHHHCCCHHHHHHCHHHHHHHHHHHCCCCCCEECCCCCCHHHHHH
T ss_conf             88888850267755677652432-00023565458432204157875110243212454325421100036887778999


Q ss_pred             HHHHHCC------CCCEEEEECCCCCHHHHHHHHHHHC-CCCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHHH-HCCCC
Q ss_conf             9874078------9838993124652238899998642-77553289841577880344444456777888864-26798
Q gi|254780684|r  180 MFARSDC------FDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFS-SKGDN  251 (438)
Q Consensus       180 ~i~~~~~------~dv~V~alIGeR~rev~efi~~~~~-~~l~~tvvv~~t~d~~~~~r~~a~~~a~~iAEyfr-~~G~~  251 (438)
T Consensus       160 qia~qa~v~~~~~~favvf~a~G~~~~~~~~f~~~f~~tGal~r~~~~~~la~~P~~~~~~tP~~alt~aeyla~~~d~h  239 (458)
T TIGR01041       160 QIARQAKVRGEESEFAVVFAAMGITYEEANFFMKDFERTGALERAVVFLNLADDPAVERIVTPRMALTLAEYLAFEKDMH  239 (458)
T ss_pred             HHHHHHCCCCCCCCEEEEEHHHCCCHHHHHHHHHHHHHCCCHHHHEEEEEECCCCCHHHHHHHHHHHHHHHHHHHCCCCE
T ss_conf             98863101235532143301022436889999998864043211002332026731123310367888999876306764


Q ss_pred             EEEEEECHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHCCHHHHHHHCCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHH
Q ss_conf             89997098999999876654047784323663245542004444431136788523554333421676420278999861
Q gi|254780684|r  252 VLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSI  331 (438)
Q Consensus       252 Vll~~Ds~tr~a~A~reis~~~ge~P~~~gyp~~~~~~~~~l~ERag~~~~~~GSiT~~~~v~~~~dd~~~pi~~~~~~i  331 (438)
T Consensus       240 vl~il~d~tny~ealr~~~aar~evPGr~GyPGy~y~dla~~yeraG~~~G~~G~~tq~Pil~mP~dd~thPiPdl~Gyi  319 (458)
T TIGR01041       240 VLVILTDMTNYCEALREISAAREEVPGRRGYPGYMYTDLATLYERAGRVKGKKGSITQIPILTMPGDDITHPIPDLTGYI  319 (458)
T ss_pred             EEEEHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHCEEECCCCCEEEEEEEECCCCCCCCCCCCCCCEE
T ss_conf             66405557789999987643444078888987237888999987506021476534530034258877657776433301


Q ss_pred             CCCEEEEEHHHHHCCCCCCCCCCCCCCCCCHHCCC-----HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHH
Q ss_conf             26089870427758971311445640002212089-----9999999999999999999999998523446999899999
Q gi|254780684|r  332 LDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWS-----ADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKA  406 (438)
Q Consensus       332 ~DG~i~L~r~la~~g~~Paid~~~S~SR~~~~~~~-----~~~~~~~~~~~~~l~~y~~~~~l~~~g~y~~g~d~~~d~~  406 (438)
T Consensus       320 teGqi~~~r~l~~~Gi~PP~~~l~slsrl~~~G~G~G~tr~dh~~~~~q~ya~ya~~~~~r~l~~~vG~-~~l~~~d~~~  398 (458)
T TIGR01041       320 TEGQIVLSRELHRKGIYPPINVLPSLSRLMKDGIGEGKTREDHKDVSDQLYAAYAEGRDLRDLVAIVGE-EALSERDRKY  398 (458)
T ss_pred             ECCEEEEEEHHHHCCCCCCHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHH
T ss_conf             135346730265178988167888999997436788874245899998888767524568889998602-4555778999


Q ss_pred             HHHHHHHHH-HHCCCCCCCCCHH
Q ss_conf             999999999-8359988899976
Q gi|254780684|r  407 VHQVPIIYD-FLKQSPSDLSSED  428 (438)
Q Consensus       407 i~~~~~i~~-fl~Q~~~e~~~~~  428 (438)
T Consensus       399 l~fa~~fe~~f~~qg~~~~r~i~  421 (458)
T TIGR01041       399 LKFADEFERKFVKQGRKEDRSIE  421 (458)
T ss_pred             HHHHHHHHHHHHHHHHHHCHHHH
T ss_conf             99999999999863332010178