HHsearch alignment for GI: 254780684 and conserved domain: cd00983

>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response. RecA couples ATP hydrolysis to DNA strand exchange.
Probab=97.28  E-value=0.0019  Score=44.06  Aligned_cols=109  Identities=20%  Similarity=0.260  Sum_probs=68.5

Q ss_pred             CCCHHHHHHHHHHHHH---HCCCCEEEEECCCCCCHHHHHHHHHHHC-CC-CCEEEEECCCCCHHHHHHHHHHHCCCCCC
Q ss_conf             1001112458752002---2358503752667889999999987407-89-83899312465223889999864277553
Q gi|254780684|r  142 EKGFKTGIRVIDIFTP---LCHGQRIGVFAGSGIGKSTLLSMFARSD-CF-DKVIISLVGERGREVREFIEDYLGDNLKK  216 (438)
Q Consensus       142 ~e~L~TGIr~ID~l~p---ig~GQR~gIfg~~GvGKt~Ll~~i~~~~-~~-dv~V~alIGeR~rev~efi~~~~~~~l~~  216 (438)
T Consensus        33 ~~~i~TGs~~lD~alg~GGiP~GRivei~G~essGKTtlal~~ia~aQk~gg~~~~iDa-E~-a~d~~~a~~l-GVD~~~  109 (325)
T cd00983          33 VEVIPTGSLSLDIALGIGGYPKGRIIEIYGPESSGKTTLALHAIAEAQKLGGTVAFIDA-EH-ALDPVYAKKL-GVDLDN  109 (325)
T ss_pred             CCEECCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEH-HH-CCCHHHHHHC-CCCHHH
T ss_conf             53462681999999758996688089998898777999999999998735983999962-54-2598999980-998467


Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHHH
Q ss_conf             28984157788034444445677788886426798899970989999
Q gi|254780684|r  217 SVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFA  263 (438)
Q Consensus       217 tvvv~~t~d~~~~~r~~a~~~a~~iAEyfr~~G~~Vll~~Ds~tr~a  263 (438)
T Consensus       110 --l~~~qp~--------~~Eq~l~i~~~li~s~~~dliViDSvaal~  146 (325)
T cd00983         110 --LLISQPD--------TGEQALEIADSLVRSGAVDLIVVDSVAALV  146 (325)
T ss_pred             --EEEECCC--------HHHHHHHHHHHHHCCCCCCEEEECCCCCCC
T ss_conf             --5896663--------899999999997515887679981511236