HHsearch alignment for GI: 254780684 and conserved domain: cd01132

>cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain. The F-ATPase is found in bacterial plasma membranes, mitochondrial inner membranes and in chloroplast thylakoid membranes. It has also been found in the archaea Methanosarcina barkeri. It uses a proton gradient to drive ATP synthesis and hydrolyzes ATP to build the proton gradient. The extrinisic membrane domain, F1, is composed of alpha, beta, gamma, delta and epsilon subunits with a stoichiometry of 3:3:1:1:1. The alpha subunit of the F1 ATP synthase can bind nucleotides, but is non-catalytic.
Probab=100.00  E-value=0  Score=701.46  Aligned_cols=268  Identities=28%  Similarity=0.439  Sum_probs=254.0

Q ss_pred             CEEECCHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             55524666886543077630478877755530121125433300013311001112458752002235850375266788
Q gi|254780684|r   93 FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGI  172 (438)
Q Consensus        93 ~~i~vG~~lLGRViD~lG~PlDg~~~l~~~~~~~~i~~~~p~p~~R~~i~e~L~TGIr~ID~l~pig~GQR~gIfg~~Gv  172 (438)
T Consensus         2 ~~VpVg~~lLGRVid~~G~PiDg~~~~~~~-~~~pi~~~~p~p~~R~~i~e~l~TGI~aID~l~pig~GQr~~If~~~g~   80 (274)
T cd01132           2 ADVPVGEALLGRVVDALGNPIDGKGPIETK-ERRPIESKAPGIIPRKSVNEPLQTGIKAIDAMIPIGRGQRELIIGDRQT   80 (274)
T ss_pred             EEEECCCCCCCCEECCCCCCCCCCCCCCCC-CCCCCCCCCCCCHHCCCCCCCCCCCCEEEECCCCCCCCCEEECCCCCCC
T ss_conf             686747463673756883302799999998-5020258895852126878611038345413466247867515588875


Q ss_pred             CHHHHH-HHHH-HHCCCCCEEEEECCCCCHHHHHHHHHHHC-CCCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             999999-9987-40789838993124652238899998642-77553289841577880344444456777888864267
Q gi|254780684|r  173 GKSTLL-SMFA-RSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKG  249 (438)
Q Consensus       173 GKt~Ll-~~i~-~~~~~dv~V~alIGeR~rev~efi~~~~~-~~l~~tvvv~~t~d~~~~~r~~a~~~a~~iAEyfr~~G  249 (438)
T Consensus        81 GKt~l~~~~i~~~~~~~~~~V~~~IGer~rEv~ef~~~~~~~~~l~~tv~v~~t~~~p~~~r~~a~~~a~~iAEyfrd~G  160 (274)
T cd01132          81 GKTAIAIDTIINQKGKKVYCIYVAIGQKASTVAQVVKTLEEHGAMEYTIVVAATASDPAPLQYLAPYTGCAMGEYFMDNG  160 (274)
T ss_pred             CHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCCHHHHHHHHHHCCCHHHHHHHCC
T ss_conf             57889999999741369659999732452269999998760576201147740477875877765441222678998779


Q ss_pred             CCEEEEEECHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHCCHHHHHHHCCCC--CCCCEEEEEEEEECCCCCCCHHHHH
Q ss_conf             98899970989999998766540477843236632455420044444311367--8852355433342167642027899
Q gi|254780684|r  250 DNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEK--EKGNITAVISVLVDGDNHNDPIADS  327 (438)
Q Consensus       250 ~~Vll~~Ds~tr~a~A~reis~~~ge~P~~~gyp~~~~~~~~~l~ERag~~~~--~~GSiT~~~~v~~~~dd~~~pi~~~  327 (438)
T Consensus       161 k~VLll~DslTr~A~A~rEisl~~ge~P~~~gyp~~vf~~~~~l~ERag~~~~~~~~GSiT~~~~v~~~~dD~t~pi~d~  240 (274)
T cd01132         161 KHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDELGGGSLTALPIIETQAGDVSAYIPTN  240 (274)
T ss_pred             CCEEEEEECHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEEEEEECCCCCCCCCHHHH
T ss_conf             94799997889999999999997279997777796278776899986321569998814217789973587778851666


Q ss_pred             HHHHCCCEEEEEHHHHHCCCCCCCCCCCCCCCCC
Q ss_conf             9861260898704277589713114456400022
Q gi|254780684|r  328 VRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLA  361 (438)
Q Consensus       328 ~~~i~DG~i~L~r~la~~g~~Paid~~~S~SR~~  361 (438)
T Consensus       241 ~~~i~dg~ivLsr~la~~g~yPAIdvl~S~SRvg  274 (274)
T cd01132         241 VISITDGQIFLETDLFNKGIRPAINVGLSVSRVG  274 (274)
T ss_pred             HHHHCCEEEEECHHHHHCCCCCCCCCCCCCCCCC
T ss_conf             7222045999979999679999808775767789