HHsearch alignment for GI: 254780684 and conserved domain: cd03224

>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids. The E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.
Probab=94.84  E-value=0.041  Score=34.42  Aligned_cols=36  Identities=19%  Similarity=0.234  Sum_probs=30.1

Q ss_pred             HHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHCCCC
Q ss_conf             520022358503752667889999999987407898
Q gi|254780684|r  153 DIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFD  188 (438)
Q Consensus       153 D~l~pig~GQR~gIfg~~GvGKt~Ll~~i~~~~~~d  188 (438)
T Consensus        18 ~vs~~v~~Gei~~liG~nGaGKSTLl~~i~Gl~~p~   53 (222)
T cd03224          18 GVSLTVPEGEIVALLGRNGAGKTTLLKTIMGLLPPR   53 (222)
T ss_pred             CEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCC
T ss_conf             408998899899999999985999999997798899