HHsearch alignment for GI: 254780684 and conserved domain: cd03226

>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=95.05  E-value=0.017  Score=37.11  Aligned_cols=32  Identities=31%  Similarity=0.439  Sum_probs=28.3

Q ss_pred             HHHHHHCCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             52002235850375266788999999998740
Q gi|254780684|r  153 DIFTPLCHGQRIGVFAGSGIGKSTLLSMFARS  184 (438)
Q Consensus       153 D~l~pig~GQR~gIfg~~GvGKt~Ll~~i~~~  184 (438)
T Consensus        18 ~vsl~i~~Gei~~iiG~nGaGKSTLl~~i~Gl   49 (205)
T cd03226          18 DLSLDLYAGEIIALTGKNGAGKTTLAKILAGL   49 (205)
T ss_pred             EEEEEECCCCEEEEECCCCCCHHHHHHHHHCC
T ss_conf             03788869989999889999899999999568