HHsearch alignment for GI: 254780684 and conserved domain: cd03229

>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.61  E-value=0.0089  Score=39.22  Aligned_cols=36  Identities=33%  Similarity=0.402  Sum_probs=29.9

Q ss_pred             HHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHCCCC
Q ss_conf             520022358503752667889999999987407898
Q gi|254780684|r  153 DIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFD  188 (438)
Q Consensus       153 D~l~pig~GQR~gIfg~~GvGKt~Ll~~i~~~~~~d  188 (438)
T Consensus        18 ~vs~~i~~Ge~~~ivGpSG~GKSTllr~i~Gl~~p~   53 (178)
T cd03229          18 DVSLNIEAGEIVALLGPSGSGKSTLLRCIAGLEEPD   53 (178)
T ss_pred             CCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCC
T ss_conf             707698899899999999983999999998599999