HHsearch alignment for GI: 254780684 and conserved domain: cd03237

>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor. The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI's are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity of more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=95.00  E-value=0.021  Score=36.51  Aligned_cols=185  Identities=16%  Similarity=0.151  Sum_probs=80.0

Q ss_pred             HHCCCCEEEEECCCCCCHHHHHHHHHHHC---CCCCEEEE-ECCCCCH--------HHHHHHHHHHC-CCCC--------
Q ss_conf             22358503752667889999999987407---89838993-1246522--------38899998642-7755--------
Q gi|254780684|r  157 PLCHGQRIGVFAGSGIGKSTLLSMFARSD---CFDKVIIS-LVGERGR--------EVREFIEDYLG-DNLK--------  215 (438)
Q Consensus       157 pig~GQR~gIfg~~GvGKt~Ll~~i~~~~---~~dv~V~a-lIGeR~r--------ev~efi~~~~~-~~l~--------  215 (438)
T Consensus        21 ti~~GEiv~liGpNGaGKSTLlk~l~Gll~p~~G~I~~~g~~i~~~pq~~~~~~~~tv~~~l~~~~~~~~~~~~~~~e~~  100 (246)
T cd03237          21 SISESEVIGILGPNGIGKTTFIKMLAGVLKPDEGDIEIELDTVSYKPQYIKADYEGTVRDLLSSITKDFYTHPYFKTEIA  100 (246)
T ss_pred             CCCCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCHHHCCCCCCCHHHHHHHHHHHCCCCHHHHHHHH
T ss_conf             46579899999799976999999997787888607998982057687433257772799999988643121279999999


Q ss_pred             CEEEEEEC-----CCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHHHHH--HHHHHHHCCCCCCCCCCCHHH--
Q ss_conf             32898415-----778803444444567778888642679889997098999999--876654047784323663245--
Q gi|254780684|r  216 KSVVVVAT-----SDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHS--IREIATNSGELPVARGYPTSV--  286 (438)
Q Consensus       216 ~tvvv~~t-----~d~~~~~r~~a~~~a~~iAEyfr~~G~~Vll~~Ds~tr~a~A--~reis~~~ge~P~~~gyp~~~--  286 (438)
T Consensus       101 ~~l~l~~~~~r~~~~LSGGqkQRv-~iA~aL~-----~~p~-ilLLDEPts~LD~~~~~~i~~~i~~l~~~~~~T-vi~V  172 (246)
T cd03237         101 KPLQIEQILDREVPELSGGELQRV-AIAACLS-----KDAD-IYLLDEPSAYLDVEQRLMASKVIRRFAENNEKT-AFVV  172 (246)
T ss_pred             HHCCCHHHHCCCHHHCCHHHHHHH-HHHHHHH-----CCCC-EEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCE-EEEE
T ss_conf             884995676487002898599999-9999984-----1999-999848987689999999999999999867989-9998


Q ss_pred             ---HHHCCHHHHHHHCCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHCCCEEEEEHHHHHCCCCCCCCCCCCCC
Q ss_conf             ---542004444431136788523554333421676420278999861260898704277589713114456400
Q gi|254780684|r  287 ---FSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS  358 (438)
Q Consensus       287 ---~~~~~~l~ERag~~~~~~GSiT~~~~v~~~~dd~~~pi~~~~~~i~DG~i~L~r~la~~g~~Paid~~~S~S  358 (438)
T Consensus       173 tHDl~~a~~~aDrIivl-~G~g~i~~~g---~p~ev~~~~~~~~v-~~~~~~v~~~p~----~g~P~i~~~~s~~  238 (246)
T cd03237         173 EHDIIMIDYLADRLIVF-EGEPSVNGVA---NPPQSLRSGMNRFL-KNLDITFRRDPE----TGRPRINKLGSVK  238 (246)
T ss_pred             CCCHHHHHHHCCEEEEE-CCCCEEEEEE---CCHHHHCHHHHHHH-HCCCCEEEECCC----CCCCCCCCCCCCC
T ss_conf             37899999869999998-1886499998---97687262888998-739768984899----9997588887512