HHsearch alignment for GI: 254780684 and conserved domain: cd03255

>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.
Probab=95.39  E-value=0.011  Score=38.64  Aligned_cols=36  Identities=28%  Similarity=0.387  Sum_probs=30.1

Q ss_pred             HHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHCCCC
Q ss_conf             520022358503752667889999999987407898
Q gi|254780684|r  153 DIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFD  188 (438)
Q Consensus       153 D~l~pig~GQR~gIfg~~GvGKt~Ll~~i~~~~~~d  188 (438)
T Consensus        22 ~isl~i~~Ge~~~iiG~sGsGKTTll~~i~Gl~~p~   57 (218)
T cd03255          22 GVSLSIEKGEFVAIVGPSGSGKSTLLNILGGLDRPT   57 (218)
T ss_pred             CEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCC
T ss_conf             628998699899999999986999999996699999