HHsearch alignment for GI: 254780684 and conserved domain: cd03297

>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.21  E-value=0.015  Score=37.52  Aligned_cols=35  Identities=40%  Similarity=0.466  Sum_probs=27.9

Q ss_pred             HHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHCCCC
Q ss_conf             520022358503752667889999999987407898
Q gi|254780684|r  153 DIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFD  188 (438)
Q Consensus       153 D~l~pig~GQR~gIfg~~GvGKt~Ll~~i~~~~~~d  188 (438)
T Consensus        16 ~i~f~i-~ge~~~iiGpSGsGKSTll~~i~GL~~p~   50 (214)
T cd03297          16 KIDFDL-NEEVTGIFGASGAGKSTLLRCIAGLEKPD   50 (214)
T ss_pred             EEEEEC-CCCEEEEECCCCCHHHHHHHHHHCCCCCC
T ss_conf             999862-99799999999735999999998499999