HHsearch alignment for GI: 254780684 and conserved domain: pfam00154

>pfam00154 RecA recA bacterial DNA recombination protein. RecA is a DNA-dependent ATPase and functions in DNA repair systems. RecA protein catalyses an ATP-dependent DNA strand-exchange reaction that is the central step in the repair of dsDNA breaks by homologous recombination.
Probab=97.39  E-value=0.0012  Score=45.48  Aligned_cols=109  Identities=19%  Similarity=0.228  Sum_probs=68.4

Q ss_pred             CCCHHHHHHHHHHHHH---HCCCCEEEEECCCCCCHHHHHHHHHHHCC--CCCEEEEECCCCCHHHHHHHHHHHCCCCCC
Q ss_conf             1001112458752002---23585037526678899999999874078--983899312465223889999864277553
Q gi|254780684|r  142 EKGFKTGIRVIDIFTP---LCHGQRIGVFAGSGIGKSTLLSMFARSDC--FDKVIISLVGERGREVREFIEDYLGDNLKK  216 (438)
Q Consensus       142 ~e~L~TGIr~ID~l~p---ig~GQR~gIfg~~GvGKt~Ll~~i~~~~~--~dv~V~alIGeR~rev~efi~~~~~~~l~~  216 (438)
T Consensus        30 ~~~i~tgs~~lD~aLg~GGlP~GRi~ei~G~essGKTtlal~~ia~aQk~gg~~~~iD-~E~a~d-~~~a~~l---GVD~  104 (322)
T pfam00154        30 VEVISTGSLGLDIALGIGGLPKGRIIEIYGPESSGKTTLALHAIAEAQKAGGTAAFID-AEHALD-PVYAKKL---GVDI  104 (322)
T ss_pred             CCEEECCHHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEE-HHHHCC-HHHHHHC---CCCH
T ss_conf             5446158089999875899778708999889877789999999999973499389985-366059-8899980---9880


Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHHH
Q ss_conf             28984157788034444445677788886426798899970989999
Q gi|254780684|r  217 SVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFA  263 (438)
Q Consensus       217 tvvv~~t~d~~~~~r~~a~~~a~~iAEyfr~~G~~Vll~~Ds~tr~a  263 (438)
T Consensus       105 ~~l~~~qpd--------~~Eqal~i~~~li~~~~~~liViDSvaal~  143 (322)
T pfam00154       105 DNLLVSQPD--------TGEQALEIADMLVRSGAVDLIVVDSVAALV  143 (322)
T ss_pred             HHEEEECCC--------HHHHHHHHHHHHHCCCCCCEEEEECCCCCC
T ss_conf             253897788--------399999999998537997659982534567