BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780684|ref|YP_003065097.1| flagellum-specific ATP
synthase [Candidatus Liberibacter asiaticus str. psy62]
         (438 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780684|ref|YP_003065097.1| flagellum-specific ATP synthase [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040361|gb|ACT57157.1| flagellum-specific ATP synthase [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 438

 Score =  892 bits (2304), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/438 (100%), Positives = 438/438 (100%)

Query: 1   MQKNLETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLG 60
           MQKNLETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLG
Sbjct: 1   MQKNLETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLG 60

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLG 120
           QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLG
Sbjct: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLG 120

Query: 121 KGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSM 180
           KGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSM
Sbjct: 121 KGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSM 180

Query: 181 FARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVT 240
           FARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVT
Sbjct: 181 FARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVT 240

Query: 241 IAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPS 300
           IAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPS
Sbjct: 241 IAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPS 300

Query: 301 EKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRL 360
           EKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRL
Sbjct: 301 EKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRL 360

Query: 361 ADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQS 420
           ADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQS
Sbjct: 361 ADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQS 420

Query: 421 PSDLSSEDVFQEITKKLQ 438
           PSDLSSEDVFQEITKKLQ
Sbjct: 421 PSDLSSEDVFQEITKKLQ 438


>gi|315121851|ref|YP_004062340.1| flagellum-specific ATP synthase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495253|gb|ADR51852.1| flagellum-specific ATP synthase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 449

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/438 (84%), Positives = 400/438 (91%)

Query: 1   MQKNLETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLG 60
           MQ  L  LAQLAE+YSK++VVQGGYI+SI  VYYTVT LS+YVCLGDFVVH+GK SDNLG
Sbjct: 1   MQNKLARLAQLAENYSKSIVVQGGYINSIMPVYYTVTGLSKYVCLGDFVVHRGKYSDNLG 60

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLG 120
           QVIRI+ D++Y+CPVGI + I+LGDLVF  G FRISPS CWCGRV+NALGKPIDGD SL 
Sbjct: 61  QVIRIDHDVLYVCPVGIDKTITLGDLVFRQGPFRISPSECWCGRVLNALGKPIDGDFSLK 120

Query: 121 KGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSM 180
            G  SM+I+ K+P  MNRQRVEKGFKTGIRVIDIFTPLC+GQRIG+FAGSGIGKSTLLSM
Sbjct: 121 TGHFSMDIIGKIPSVMNRQRVEKGFKTGIRVIDIFTPLCYGQRIGIFAGSGIGKSTLLSM 180

Query: 181 FARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVT 240
           FA+SDCFDKV+ISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTA T
Sbjct: 181 FAKSDCFDKVVISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAFT 240

Query: 241 IAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPS 300
           IAEYF SKGDNVLLILDSITRFAH+IREI+ NSGELPV RGYP SVFSELPRLLER GP 
Sbjct: 241 IAEYFCSKGDNVLLILDSITRFAHAIREISMNSGELPVTRGYPASVFSELPRLLERAGPR 300

Query: 301 EKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRL 360
           EKEKG+ITA+ISVLVDGDNHNDPIADSVRSILDGH+VL RSLAEEGRYPPVDPLASVSRL
Sbjct: 301 EKEKGSITAIISVLVDGDNHNDPIADSVRSILDGHVVLKRSLAEEGRYPPVDPLASVSRL 360

Query: 361 ADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQS 420
           A KAWS+DE+KLV+SL +LIH+FEETRDIRLIGGYRPGVD+ LDKAV QVPIIYDFLKQS
Sbjct: 361 AYKAWSSDEEKLVASLKNLIHQFEETRDIRLIGGYRPGVDINLDKAVRQVPIIYDFLKQS 420

Query: 421 PSDLSSEDVFQEITKKLQ 438
           PSDL  +DVF EITKKLQ
Sbjct: 421 PSDLLLKDVFLEITKKLQ 438


>gi|222084860|ref|YP_002543389.1| H(+)-transporting ATP synthase [Agrobacterium radiobacter K84]
 gi|221722308|gb|ACM25464.1| H(+)-transporting ATP synthase [Agrobacterium radiobacter K84]
          Length = 462

 Score =  588 bits (1517), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 277/440 (62%), Positives = 343/440 (77%), Gaps = 2/440 (0%)

Query: 1   MQKNLETLAQLAEDY--SKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDN 58
           +   L  +A LAE Y  ++N V  GG++ +I + +YTV  LS++V LG+FV H+     +
Sbjct: 11  LSPRLPHMAALAEHYAMTENAVAHGGHVRTIAAGHYTVAGLSRHVRLGEFVAHRSATGVH 70

Query: 59  LGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDS 118
           LG+V+R+  ++ Y+CP+  GE I + D V   G FRI+PS  WCGR IN+LG+PIDG   
Sbjct: 71  LGEVVRVEPELTYVCPIEPGEPIGIHDTVIRKGAFRIAPSESWCGRTINSLGEPIDGLGP 130

Query: 119 LGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLL 178
           L  G     I +  PP+M R+RVE GFKTG+R IDIF+PLC GQR+G+FAGSG+GKSTLL
Sbjct: 131 LTAGTQPRSISNTAPPSMTRKRVETGFKTGVRAIDIFSPLCLGQRLGIFAGSGVGKSTLL 190

Query: 179 SMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTA 238
           SM AR+D FDKV+I+LVGERGREVREFIED LG +++KSV VVATSDESP+LRKMAPL+A
Sbjct: 191 SMLARADAFDKVVIALVGERGREVREFIEDTLGTHMQKSVAVVATSDESPMLRKMAPLSA 250

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
           +TIAE+F  +GDNVLLI+DS+TRFAH+IRE+AT SGE P+ARGYP SVF+ELPRLLER G
Sbjct: 251 ITIAEHFRDQGDNVLLIVDSVTRFAHAIREVATASGEPPIARGYPASVFTELPRLLERAG 310

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
           P  +  G ITA+IS+LVDGDNHNDPIADS R ILDGHIVL RSLAEEGRYPP+DPLASVS
Sbjct: 311 PGPEGTGTITAIISILVDGDNHNDPIADSTRGILDGHIVLQRSLAEEGRYPPIDPLASVS 370

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           RLA KAW+ D++KLVS L  L+HR+EETRD+RLIGGYR G D  LD AV QVPIIY+ LK
Sbjct: 371 RLARKAWTPDQEKLVSRLKALVHRYEETRDLRLIGGYRQGADADLDIAVRQVPIIYEILK 430

Query: 419 QSPSDLSSEDVFQEITKKLQ 438
           Q+P +  S D F ++   L+
Sbjct: 431 QTPGERPSADAFTDLATALK 450


>gi|227820853|ref|YP_002824823.1| flagellum-specific ATP synthase [Sinorhizobium fredii NGR234]
 gi|227339852|gb|ACP24070.1| flagellum-specific ATP synthase [Sinorhizobium fredii NGR234]
          Length = 466

 Score =  587 bits (1512), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 278/437 (63%), Positives = 344/437 (78%), Gaps = 2/437 (0%)

Query: 4   NLETLAQLAEDYSKNLV--VQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQ 61
           +L  LA L E Y+   V    GG++ +I+  +YTV+ LS++V LGDFV H+     +LG+
Sbjct: 14  SLAALAGLVERYANPDVSIAPGGHVQTISPGHYTVSGLSRHVRLGDFVAHKSATGTHLGE 73

Query: 62  VIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGK 121
           V+R+  D V +CP+  G+ I + D V   G FRI+P+  WCGR INAL +PIDG   L +
Sbjct: 74  VVRVEPDRVVVCPIEPGDPIGIHDTVIRKGAFRIAPTDNWCGRTINALAEPIDGRGPLMQ 133

Query: 122 GDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMF 181
           GD+   I +  PP+M R+RVE+GFKTG+R +DIF+PLC GQR+G+FAGSG+GKSTLLSM 
Sbjct: 134 GDMRRSISNTAPPSMTRRRVEQGFKTGVRAVDIFSPLCLGQRLGIFAGSGVGKSTLLSML 193

Query: 182 ARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTI 241
           AR+D FDKV+I+LVGERGREVREFIED LGDNL KSV VVATSDESP+LRKMAPLTAVTI
Sbjct: 194 ARADAFDKVVIALVGERGREVREFIEDTLGDNLAKSVAVVATSDESPMLRKMAPLTAVTI 253

Query: 242 AEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSE 301
           AE++  KGDNVLLI+DS+TRFAH+IRE+AT +GE P+ARGYP SVF+ELPRLLER GP  
Sbjct: 254 AEHYRDKGDNVLLIVDSVTRFAHAIREVATAAGEPPIARGYPASVFTELPRLLERAGPGA 313

Query: 302 KEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLA 361
           +  G ITA+IS+LVDGDNHNDP+ADS R ILDGHIVL+RSLAEEGRYPP+DPLAS+SRLA
Sbjct: 314 EGTGTITAIISILVDGDNHNDPVADSARGILDGHIVLDRSLAEEGRYPPIDPLASISRLA 373

Query: 362 DKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSP 421
            KAW+ D++KLV+ L  LIHRFEETRD+RLIGGYR G D  LD A+ QVP+IYD LKQ+P
Sbjct: 374 RKAWTPDQEKLVARLKSLIHRFEETRDLRLIGGYRAGGDPDLDMAIKQVPVIYDVLKQTP 433

Query: 422 SDLSSEDVFQEITKKLQ 438
            + S  D F ++   L+
Sbjct: 434 GERSVADAFTDLANALK 450


>gi|15887903|ref|NP_353584.1| flagellum-specific ATP synthase [Agrobacterium tumefaciens str.
           C58]
 gi|6225361|sp|O34171|FLII_AGRT5 RecName: Full=Flagellum-specific ATP synthase
 gi|2459709|gb|AAB71785.1| FliI [Agrobacterium tumefaciens]
 gi|15155495|gb|AAK86369.1| flagellum-specific ATP synthase [Agrobacterium tumefaciens str.
           C58]
          Length = 473

 Score =  583 bits (1502), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 275/440 (62%), Positives = 343/440 (77%), Gaps = 2/440 (0%)

Query: 1   MQKNLETLAQLAEDYS--KNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDN 58
           +   L  LA LA  Y+  +  V  GG++ +I + +YTV+ LS++V LG+FV H+     +
Sbjct: 18  ISPKLAQLASLAGHYADPEFSVAHGGHVRTIAAGHYTVSGLSRHVRLGEFVAHRSATGIH 77

Query: 59  LGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDS 118
           LG+V+R+  DI Y+CP+  GE I + D V   G FR+SP   WCGR INALG+PIDG   
Sbjct: 78  LGEVVRVEPDICYVCPIEPGEPIGIHDTVIRKGAFRVSPDESWCGRTINALGEPIDGQGP 137

Query: 119 LGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLL 178
           L  G +   I +  PP+M R+RVE  FKTG+R IDIF+PLC GQR+G+FAGSG+GKSTLL
Sbjct: 138 LASGIVRRSISNNAPPSMTRKRVETPFKTGVRAIDIFSPLCLGQRLGIFAGSGVGKSTLL 197

Query: 179 SMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTA 238
           SM A++D FDKV+I+LVGERGREVREFIED +GDN+ KSV VVATSDESP+LRKMAPL+A
Sbjct: 198 SMLAKADAFDKVVIALVGERGREVREFIEDTMGDNMSKSVAVVATSDESPMLRKMAPLSA 257

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
           VTIAE+F  +GDNVLLI+DS+TRFAH+IRE+A  SGE PVARGYP SVF+ELPRLLER G
Sbjct: 258 VTIAEHFRDQGDNVLLIIDSVTRFAHAIREVAVASGEPPVARGYPASVFTELPRLLERAG 317

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
           P  +  G ITA++S+LVDGDNHNDPIADS R ILDGHIVL+RSLAEEGRYPP++PLAS+S
Sbjct: 318 PGAEGTGTITAIVSILVDGDNHNDPIADSTRGILDGHIVLDRSLAEEGRYPPINPLASIS 377

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           RLA KAW+ D++KLVS L  L+HRFEETRD+RLIGGYRPG D  LD AV QVPIIY+ LK
Sbjct: 378 RLAKKAWTPDQEKLVSRLKALVHRFEETRDLRLIGGYRPGTDPDLDMAVKQVPIIYETLK 437

Query: 419 QSPSDLSSEDVFQEITKKLQ 438
           Q P + +++D + ++   L+
Sbjct: 438 QLPDEPAAQDAYADLATALR 457


>gi|325291944|ref|YP_004277808.1| flagellum-specific ATP synthase [Agrobacterium sp. H13-3]
 gi|325059797|gb|ADY63488.1| flagellum-specific ATP synthase [Agrobacterium sp. H13-3]
          Length = 468

 Score =  582 bits (1499), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 275/440 (62%), Positives = 342/440 (77%), Gaps = 2/440 (0%)

Query: 1   MQKNLETLAQLAEDYS--KNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDN 58
           +   L  LA LA  Y+  +  V  GG++ +I + +YTV+ LS++V LG+FV H+     +
Sbjct: 13  ISPKLAQLASLAGHYADPEFSVAPGGHVRTIAAGHYTVSGLSRHVRLGEFVAHRSATGIH 72

Query: 59  LGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDS 118
           LG+V+R+  DI Y+CP+  GE I + D V   G FR++P   WCGR INALG+PIDG   
Sbjct: 73  LGEVVRVEPDICYVCPIEPGEPIGIHDTVIRKGAFRVAPDDSWCGRTINALGEPIDGKGP 132

Query: 119 LGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLL 178
           L  G     I S  PP+M R+RVE  FKTG+R IDIF+PLC GQR+G+FAGSG+GKSTLL
Sbjct: 133 LASGTERRPISSNAPPSMTRKRVETPFKTGVRAIDIFSPLCLGQRLGIFAGSGVGKSTLL 192

Query: 179 SMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTA 238
           SM A++D FDKV+I LVGERGREVREFIED +G+N+ KSV VVATSDESP+LRKMAPL+A
Sbjct: 193 SMLAKADAFDKVVIGLVGERGREVREFIEDTMGENMGKSVAVVATSDESPMLRKMAPLSA 252

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
           VTIAEYF  +GDNVLLI+DS+TRFAH+IRE+A  SGE PVARGYP SVF+ELPRLLER G
Sbjct: 253 VTIAEYFRDRGDNVLLIIDSVTRFAHAIREVAVASGEPPVARGYPASVFTELPRLLERAG 312

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
           P  +  G ITA++S+LVDGDNHNDPIADS R ILDGHIVL+RSLAEEGRYPP++PLAS+S
Sbjct: 313 PGAEGSGTITAIVSILVDGDNHNDPIADSTRGILDGHIVLDRSLAEEGRYPPINPLASIS 372

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           RLA KAW+ D++KLVS L  L+HRFEETRD+RLIGGYRPG D  LD AV QVPIIY+ LK
Sbjct: 373 RLAKKAWTPDQEKLVSRLKALVHRFEETRDLRLIGGYRPGTDPDLDMAVKQVPIIYETLK 432

Query: 419 QSPSDLSSEDVFQEITKKLQ 438
           Q P++ +++D + ++   L+
Sbjct: 433 QLPNEPAAQDAYADLATALR 452


>gi|209547923|ref|YP_002279840.1| flagellum-specific ATP synthase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533679|gb|ACI53614.1| flagellar protein export ATPase FliI [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 465

 Score =  578 bits (1491), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 279/432 (64%), Positives = 335/432 (77%), Gaps = 2/432 (0%)

Query: 1   MQKNLETLAQLAEDYSKN--LVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDN 58
           +   L  LA L E Y+     V  GG + +I + +YTV  LS++V LG+FV H+     +
Sbjct: 11  LSPKLAHLAGLVERYASPEFSVAHGGRVQTIAAGHYTVRGLSRHVRLGEFVAHKSATGIH 70

Query: 59  LGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDS 118
           LG+V+R+  D++Y+CP+  GE I + D V   G FRISPS  WCGR +N+L +PIDG   
Sbjct: 71  LGEVVRVEPDLIYVCPIEPGEPIGIHDTVIRKGAFRISPSDSWCGRTVNSLCEPIDGLGP 130

Query: 119 LGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLL 178
           + +G     I +  PP+M R+RVE GFKTG+R IDIF+PLC GQR+G+FAGSG+GKSTLL
Sbjct: 131 IAEGLDRRSISNTAPPSMTRKRVEAGFKTGVRAIDIFSPLCLGQRLGIFAGSGVGKSTLL 190

Query: 179 SMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTA 238
           SM AR+D FDKV+I+LVGERGREVREFIED LG N+KK++ VVATSDESP+LRKMAPLTA
Sbjct: 191 SMLARADAFDKVVIALVGERGREVREFIEDTLGSNMKKAIAVVATSDESPMLRKMAPLTA 250

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
           VTIAE+F  KG+NVL I+DS+TRFAH+IRE+AT SGE P+ARGYP SVF+ELPRLLER G
Sbjct: 251 VTIAEHFRDKGENVLFIVDSVTRFAHAIREVATASGEPPIARGYPASVFTELPRLLERAG 310

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
           P  +  G ITA+IS+LVDGDNHNDPIADS R ILDGHIVL RSLAEEGRYPP+DPLAS+S
Sbjct: 311 PGPEGAGTITAIISILVDGDNHNDPIADSTRGILDGHIVLQRSLAEEGRYPPIDPLASIS 370

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           RLA KAW+ D++KLVS L  LIHRFEETRD+RLIGGYR G D  LD AV QVPIIYD LK
Sbjct: 371 RLARKAWTPDQEKLVSRLKVLIHRFEETRDLRLIGGYRQGADPDLDMAVKQVPIIYDVLK 430

Query: 419 QSPSDLSSEDVF 430
           QSP D  S D F
Sbjct: 431 QSPGDRDSPDAF 442


>gi|15964410|ref|NP_384763.1| flagellum-specific ATP synthase [Sinorhizobium meliloti 1021]
 gi|307311552|ref|ZP_07591193.1| ATPase, FliI/YscN family [Sinorhizobium meliloti BL225C]
 gi|17380374|sp|O54249|FLII_RHIME RecName: Full=Flagellum-specific ATP synthase
 gi|15073587|emb|CAC45229.1| Flagellum-specific ATP synthase [Sinorhizobium meliloti 1021]
 gi|306899569|gb|EFN30198.1| ATPase, FliI/YscN family [Sinorhizobium meliloti BL225C]
          Length = 467

 Score =  575 bits (1481), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 276/437 (63%), Positives = 346/437 (79%), Gaps = 2/437 (0%)

Query: 4   NLETLAQLAEDYSKN--LVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQ 61
           +L  LA L E Y+     +  GG++ +I+  +YTV+ LS++V LGDFV H+     +LG+
Sbjct: 14  SLAALAGLVERYANPDFAIAPGGHVQTISPGHYTVSGLSRHVRLGDFVAHKSTTGTHLGE 73

Query: 62  VIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGK 121
           V+R+  + V +CP+  G+ I + D+V   G FRI+P+  WCGR INAL +PIDG  +L +
Sbjct: 74  VVRVEPERVVVCPIEPGDPIGIHDVVIRKGAFRIAPTDNWCGRTINALAEPIDGLGALLQ 133

Query: 122 GDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMF 181
           GD+   I +  PP+M R+RVE+GF+TG+R IDIF+PLC GQR+G+FAGSG+GKSTLLSM 
Sbjct: 134 GDIRRSIANTAPPSMTRKRVEQGFRTGVRAIDIFSPLCLGQRLGIFAGSGVGKSTLLSML 193

Query: 182 ARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTI 241
           AR+D FDKV+I+LVGERGREVREFIED LGDNL KSV VVATSDESP+LRKMAPLTAVTI
Sbjct: 194 ARADAFDKVVIALVGERGREVREFIEDTLGDNLSKSVAVVATSDESPMLRKMAPLTAVTI 253

Query: 242 AEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSE 301
           AE++  KGDNVLLI+DS+TRFAH+IRE+AT +GE P+ARGYP SVF+ELPRLLER GP  
Sbjct: 254 AEHYRDKGDNVLLIVDSVTRFAHAIREVATAAGEPPIARGYPASVFTELPRLLERAGPGA 313

Query: 302 KEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLA 361
           +  G ITA+IS+LVDGDNHNDP+ADS R ILDGHIVL+RSLAEEGRYPPV+PLAS+SRLA
Sbjct: 314 EGAGTITAIISILVDGDNHNDPVADSARGILDGHIVLDRSLAEEGRYPPVNPLASISRLA 373

Query: 362 DKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSP 421
            KAW+ D++KLV+ L  LIHRFEETRD+RLIGGYRPG D  LD A+ QVP+IYD LKQ P
Sbjct: 374 RKAWTPDQEKLVARLKSLIHRFEETRDLRLIGGYRPGGDADLDMAIKQVPVIYDVLKQMP 433

Query: 422 SDLSSEDVFQEITKKLQ 438
            +  + D F ++   L+
Sbjct: 434 GERPAFDAFTDLANALK 450


>gi|2916791|emb|CAA11957.1| flagellar export apparatus protein [Sinorhizobium meliloti]
          Length = 467

 Score =  575 bits (1481), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 276/437 (63%), Positives = 346/437 (79%), Gaps = 2/437 (0%)

Query: 4   NLETLAQLAEDYSKN--LVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQ 61
           +L  LA L E Y+     +  GG++ +I+  +YTV+ LS++V LGDFV H+     +LG+
Sbjct: 14  SLAALAGLVERYANPDFAIAPGGHVQTISPGHYTVSGLSRHVRLGDFVAHKSATGTHLGE 73

Query: 62  VIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGK 121
           V+R+  + V +CP+  G+ I + D+V   G FRI+P+  WCGR INAL +PIDG  +L +
Sbjct: 74  VVRVEPERVVVCPIEPGDPIGIHDVVIRKGAFRIAPTDNWCGRTINALAEPIDGLGALLQ 133

Query: 122 GDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMF 181
           GD+   I +  PP+M R+RVE+GF+TG+R IDIF+PLC GQR+G+FAGSG+GKSTLLSM 
Sbjct: 134 GDIRRSIANTAPPSMTRKRVEQGFRTGVRAIDIFSPLCLGQRLGIFAGSGVGKSTLLSML 193

Query: 182 ARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTI 241
           AR+D FDKV+I+LVGERGREVREFIED LGDNL KSV VVATSDESP+LRKMAPLTAVTI
Sbjct: 194 ARADAFDKVVIALVGERGREVREFIEDTLGDNLSKSVAVVATSDESPMLRKMAPLTAVTI 253

Query: 242 AEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSE 301
           AE++  KGDNVLLI+DS+TRFAH+IRE+AT +GE P+ARGYP SVF+ELPRLLER GP  
Sbjct: 254 AEHYRDKGDNVLLIVDSVTRFAHAIREVATAAGEPPIARGYPASVFTELPRLLERAGPGA 313

Query: 302 KEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLA 361
           +  G ITA+IS+LVDGDNHNDP+ADS R ILDGHIVL+RSLAEEGRYPPV+PLAS+SRLA
Sbjct: 314 EGAGTITAIISILVDGDNHNDPVADSARGILDGHIVLDRSLAEEGRYPPVNPLASISRLA 373

Query: 362 DKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSP 421
            KAW+ D++KLV+ L  LIHRFEETRD+RLIGGYRPG D  LD A+ QVP+IYD LKQ P
Sbjct: 374 RKAWTPDQEKLVARLKSLIHRFEETRDLRLIGGYRPGGDADLDMAIKQVPVIYDVLKQMP 433

Query: 422 SDLSSEDVFQEITKKLQ 438
            +  + D F ++   L+
Sbjct: 434 GERPAFDAFTDLANALK 450


>gi|327193032|gb|EGE59944.1| H(+)-transporting ATP synthase, flagellum-specific protein
           [Rhizobium etli CNPAF512]
          Length = 464

 Score =  573 bits (1478), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 276/432 (63%), Positives = 335/432 (77%), Gaps = 2/432 (0%)

Query: 1   MQKNLETLAQLAEDYSKN--LVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDN 58
           +   L  LA L + Y+     V  GG + +I + +YTV  LS++V LG+FV H+  +  +
Sbjct: 10  LSPTLAHLAGLVDQYASPDFAVAHGGRVQTIAAGHYTVRGLSRHVRLGEFVAHKSASGVH 69

Query: 59  LGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDS 118
           LG+V+R+  +++Y+CP+  GE I + D V   G FRISPS  WCGR IN+L +PIDG   
Sbjct: 70  LGEVVRVEPELIYVCPIEPGEPIGIHDTVIRKGAFRISPSDSWCGRTINSLCEPIDGQGP 129

Query: 119 LGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLL 178
           + +G     I +  PP+M RQRV  GFKTG+R IDIF+PLC GQR+G+FAGSG+GKSTLL
Sbjct: 130 IVEGLDRRSISNTAPPSMTRQRVGTGFKTGVRAIDIFSPLCLGQRLGIFAGSGVGKSTLL 189

Query: 179 SMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTA 238
           SM AR+D FDKV+I+LVGERGREVREFIED LG N+KK++ VVATSDESP+LRKMAPLTA
Sbjct: 190 SMLARADAFDKVVIALVGERGREVREFIEDTLGSNMKKAIAVVATSDESPMLRKMAPLTA 249

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
           +TIAE+F  KG+NVL I+DS+TRFAH+IRE+AT SGE P+ARGYP SVF+ELPRLLER G
Sbjct: 250 ITIAEHFRDKGENVLFIVDSVTRFAHAIREVATASGEPPIARGYPASVFTELPRLLERAG 309

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
           P  +  G ITA+IS+LVDGDNHNDPIADS R ILDGHIVL RSLAEEGRYPP+DPLAS+S
Sbjct: 310 PGPEGAGTITAIISILVDGDNHNDPIADSTRGILDGHIVLQRSLAEEGRYPPIDPLASIS 369

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           RLA KAW+ D++KLVS L  LIHRFEETRD+RLIGGYR G D  LD AV QVPIIYD LK
Sbjct: 370 RLARKAWTPDQEKLVSRLKVLIHRFEETRDLRLIGGYRQGADPDLDMAVKQVPIIYDVLK 429

Query: 419 QSPSDLSSEDVF 430
           Q+P D  S D F
Sbjct: 430 QAPGDRESVDAF 441


>gi|190890358|ref|YP_001976900.1| H(+)-transporting ATP synthase, flagellum-specific protein
           [Rhizobium etli CIAT 652]
 gi|190695637|gb|ACE89722.1| H(+)-transporting ATP synthase, flagellum-specific protein
           [Rhizobium etli CIAT 652]
          Length = 464

 Score =  573 bits (1476), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 275/432 (63%), Positives = 335/432 (77%), Gaps = 2/432 (0%)

Query: 1   MQKNLETLAQLAEDYSKN--LVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDN 58
           +   L  LA L + Y+     V  GG + +I + +YTV  LS++V LG+FV H+  +  +
Sbjct: 10  LSPTLAHLAGLVDQYASPDFAVAHGGRVQTIAAGHYTVRGLSRHVRLGEFVAHKSASGVH 69

Query: 59  LGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDS 118
           LG+V+R+  +++Y+CP+  GE I + D V   G FRISPS  WCGR +N+L +PIDG   
Sbjct: 70  LGEVVRVEPELIYVCPIEPGEPIGIHDTVIRKGAFRISPSDSWCGRTVNSLCEPIDGQGP 129

Query: 119 LGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLL 178
           + +G     I +  PP+M RQRV  GFKTG+R IDIF+PLC GQR+G+FAGSG+GKSTLL
Sbjct: 130 IVEGLDRRSISNTAPPSMTRQRVGTGFKTGVRAIDIFSPLCLGQRLGIFAGSGVGKSTLL 189

Query: 179 SMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTA 238
           SM AR+D FDKV+I+LVGERGREVREFIED LG N+KK++ VVATSDESP+LRKMAPLTA
Sbjct: 190 SMLARADAFDKVVIALVGERGREVREFIEDTLGSNMKKAIAVVATSDESPMLRKMAPLTA 249

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
           +TIAE+F  KG+NVL I+DS+TRFAH+IRE+AT SGE P+ARGYP SVF+ELPRLLER G
Sbjct: 250 ITIAEHFRDKGENVLFIVDSVTRFAHAIREVATASGEPPIARGYPASVFTELPRLLERAG 309

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
           P  +  G ITA+IS+LVDGDNHNDPIADS R ILDGHIVL RSLAEEGRYPP+DPLAS+S
Sbjct: 310 PGPEGAGTITAIISILVDGDNHNDPIADSTRGILDGHIVLQRSLAEEGRYPPIDPLASIS 369

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           RLA KAW+ D++KLVS L  LIHRFEETRD+RLIGGYR G D  LD AV QVPIIYD LK
Sbjct: 370 RLARKAWTPDQEKLVSRLKVLIHRFEETRDLRLIGGYRQGADPDLDMAVKQVPIIYDVLK 429

Query: 419 QSPSDLSSEDVF 430
           Q+P D  S D F
Sbjct: 430 QAPGDRESVDAF 441


>gi|307318907|ref|ZP_07598338.1| ATPase, FliI/YscN family [Sinorhizobium meliloti AK83]
 gi|306895321|gb|EFN26076.1| ATPase, FliI/YscN family [Sinorhizobium meliloti AK83]
          Length = 467

 Score =  572 bits (1475), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 275/437 (62%), Positives = 345/437 (78%), Gaps = 2/437 (0%)

Query: 4   NLETLAQLAEDYSKN--LVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQ 61
           +L  LA L E Y+     +  GG++ +I+  +YTV+ LS++V LGDFV H+     +LG+
Sbjct: 14  SLAALAGLVERYANPDFAIAPGGHVQTISPGHYTVSGLSRHVRLGDFVAHKSTTGTHLGE 73

Query: 62  VIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGK 121
           V+R+  + V +CP+  G+ I + D+V   G FRI+P+  WCGR INAL +PIDG  +L +
Sbjct: 74  VVRVEPERVVVCPIEPGDPIGIHDVVIRKGAFRIAPTDNWCGRTINALAEPIDGLGALLQ 133

Query: 122 GDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMF 181
           GD+   I +  PP+M R+RVE+GF+TG+R IDIF+PLC GQR+G+FAGSG+GKSTLLSM 
Sbjct: 134 GDIRRSIANTAPPSMTRKRVEQGFRTGVRAIDIFSPLCLGQRLGIFAGSGVGKSTLLSML 193

Query: 182 ARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTI 241
           AR+D FDKV+I+LVGERGREVREFIED LG NL KSV VVATSDESP+LRKMAPLTAVTI
Sbjct: 194 ARADAFDKVVIALVGERGREVREFIEDTLGANLSKSVAVVATSDESPMLRKMAPLTAVTI 253

Query: 242 AEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSE 301
           AE++  KGDNVLLI+DS+TRFAH+IRE+AT +GE P+ARGYP SVF+ELPRLLER GP  
Sbjct: 254 AEHYRDKGDNVLLIVDSVTRFAHAIREVATAAGEPPIARGYPASVFTELPRLLERAGPGA 313

Query: 302 KEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLA 361
           +  G ITA+IS+LVDGDNHNDP+ADS R ILDGHIVL+RSLAEEGRYPPV+PLAS+SRLA
Sbjct: 314 EGAGTITAIISILVDGDNHNDPVADSARGILDGHIVLDRSLAEEGRYPPVNPLASISRLA 373

Query: 362 DKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSP 421
            KAW+ D++KLV+ L  LIHRFEETRD+RLIGGYRPG D  LD A+ QVP+IYD LKQ P
Sbjct: 374 RKAWTPDQEKLVARLKSLIHRFEETRDLRLIGGYRPGGDADLDMAIKQVPVIYDVLKQMP 433

Query: 422 SDLSSEDVFQEITKKLQ 438
            +  + D F ++   L+
Sbjct: 434 GERPAFDAFTDLANALK 450


>gi|241203101|ref|YP_002974197.1| flagellum-specific ATP synthase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240856991|gb|ACS54658.1| ATPase, FliI/YscN family [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 466

 Score =  572 bits (1475), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 273/432 (63%), Positives = 335/432 (77%), Gaps = 2/432 (0%)

Query: 1   MQKNLETLAQLAEDYSKN--LVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDN 58
           +   L  LA L + Y+     V  GG + +I + +YTV  LS++V LG+FV H+     +
Sbjct: 11  LSPKLAHLAGLVDRYASPEFAVAHGGRVQTIAAGHYTVHGLSRHVRLGEFVAHKSATGIH 70

Query: 59  LGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDS 118
           LG+V+R+  +++Y+CP+  GE I + D V   G FRI+P+  WCGR +N+L +PIDG   
Sbjct: 71  LGEVVRVEPELIYVCPIEPGEPIGIHDTVIRKGAFRIAPTDSWCGRTVNSLCEPIDGLGP 130

Query: 119 LGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLL 178
           + +G     I +  PP+M R+RVE GFKTG+R IDIF+PLC GQR+G+FAGSG+GKSTLL
Sbjct: 131 IAEGLDRRSISNTAPPSMTRKRVETGFKTGVRAIDIFSPLCLGQRLGIFAGSGVGKSTLL 190

Query: 179 SMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTA 238
           SM AR+D FDKV+I+LVGERGREVREFIED LG N+KK++ VVATSDESP+LRKMAPLTA
Sbjct: 191 SMLARADAFDKVVIALVGERGREVREFIEDTLGSNMKKAIAVVATSDESPMLRKMAPLTA 250

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
           VTIAE+F  KG+NVL I+DS+TRFAH+IRE+AT SGE P+ARGYP SVF+ELPRLLER G
Sbjct: 251 VTIAEHFRDKGENVLFIIDSVTRFAHAIREVATASGEPPIARGYPASVFTELPRLLERAG 310

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
           P  +  G ITA+IS+LVDGDNHNDPIADS R ILDGHIVL RSLAEEGRYPP+DPLAS+S
Sbjct: 311 PGPEGAGTITAIISILVDGDNHNDPIADSTRGILDGHIVLQRSLAEEGRYPPIDPLASIS 370

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           RLA KAW+ D++KLVS L  LIHRFEETRD+R+IGGYR G D  LD A+ QVPIIYD LK
Sbjct: 371 RLARKAWTPDQEKLVSRLKVLIHRFEETRDLRMIGGYRQGADPDLDMAIKQVPIIYDVLK 430

Query: 419 QSPSDLSSEDVF 430
           QSP D  S D F
Sbjct: 431 QSPGDRDSLDAF 442


>gi|86356307|ref|YP_468199.1| flagellum-specific ATP synthase [Rhizobium etli CFN 42]
 gi|86280409|gb|ABC89472.1| H(+)-transporting ATP synthase, flagellum-specific protein
           [Rhizobium etli CFN 42]
          Length = 465

 Score =  572 bits (1473), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 275/432 (63%), Positives = 333/432 (77%), Gaps = 2/432 (0%)

Query: 1   MQKNLETLAQLAEDYSKN--LVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDN 58
           +   L  LA L + Y+     V  GG + +I + +YTV  LS++V LG+FV H+     +
Sbjct: 11  LSPKLVHLAGLVDRYASPEFAVAHGGRVQTIAAGHYTVRGLSRHVRLGEFVAHKSATGIH 70

Query: 59  LGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDS 118
           LG+V+R+  D++Y+CP+  GE I + D V   G FRISPS  WCGR +N+L +PIDG   
Sbjct: 71  LGEVVRVEPDLIYVCPIEPGEPIGIHDTVIRKGAFRISPSDSWCGRTVNSLCEPIDGLGP 130

Query: 119 LGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLL 178
           +  G     I +  PP+M RQRV  GFKTG+R IDIF+PLC GQR+G+FAGSG+GKSTLL
Sbjct: 131 IAAGLDRRSISNTAPPSMTRQRVATGFKTGVRAIDIFSPLCLGQRLGIFAGSGVGKSTLL 190

Query: 179 SMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTA 238
           SM AR+D FDKV+I+LVGERGREVREFIED LG ++KK++ VVATSDESP+LRKMAPLTA
Sbjct: 191 SMLARADAFDKVVIALVGERGREVREFIEDTLGSDMKKAIAVVATSDESPMLRKMAPLTA 250

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
           +TIAE+F  KG+NVL I+DS+TRFAH+IRE+AT SGE P+ARGYP SVF+ELPRLLER G
Sbjct: 251 ITIAEHFRDKGENVLFIVDSVTRFAHAIREVATASGEPPIARGYPASVFTELPRLLERAG 310

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
           P  +  G ITA+IS+LVDGDNHNDPIADS R ILDGHIVL RSLAEEGRYPP+DPLAS+S
Sbjct: 311 PGPEGAGTITAIISILVDGDNHNDPIADSTRGILDGHIVLQRSLAEEGRYPPIDPLASIS 370

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           RLA KAW+ D++KLVS L  LIHRFEETRD+RLIGGYR G D  LD AV QVPIIYD LK
Sbjct: 371 RLARKAWTPDQEKLVSRLKVLIHRFEETRDLRLIGGYRQGADPDLDMAVKQVPIIYDVLK 430

Query: 419 QSPSDLSSEDVF 430
           Q+P D  S D F
Sbjct: 431 QAPGDRESVDAF 442


>gi|116250477|ref|YP_766315.1| flagellum-specific ATP synthase [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115255125|emb|CAK06199.1| putative flagellum-specific ATP synthase [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 466

 Score =  570 bits (1469), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 273/432 (63%), Positives = 335/432 (77%), Gaps = 2/432 (0%)

Query: 1   MQKNLETLAQLAEDYSKN--LVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDN 58
           +   L  L+ L + Y+     V  GG + +I + +YTV  LS++V LG+FV H+     +
Sbjct: 11  LSPKLAHLSDLVDRYASPEFAVAHGGRVQTIAAGHYTVHGLSRHVRLGEFVAHKSATGIH 70

Query: 59  LGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDS 118
           LG+V+R+  +++Y+CP+  GE I + D V   G FRISP+  WCGR +N+L +PIDG   
Sbjct: 71  LGEVVRVEPELIYVCPIEPGEPIGIHDTVIRKGAFRISPTDSWCGRTVNSLCEPIDGLGP 130

Query: 119 LGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLL 178
           + +G     I +  PP+M R+RVE GFKTG+R IDIF+PLC GQR+G+FAGSG+GKSTLL
Sbjct: 131 ITEGLDRRSISNTAPPSMTRKRVETGFKTGVRAIDIFSPLCLGQRLGIFAGSGVGKSTLL 190

Query: 179 SMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTA 238
           SM AR+D FDKV+I+LVGERGREVREFIED LG N+KK++ VVATSDESP+LRKMAPLTA
Sbjct: 191 SMLARADAFDKVVIALVGERGREVREFIEDTLGSNMKKAIAVVATSDESPMLRKMAPLTA 250

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
           VTIAE+F  KG+NVL I+DS+TRFAH+IRE+AT SGE P+ARGYP SVF+ELPRLLER G
Sbjct: 251 VTIAEHFRDKGENVLFIVDSVTRFAHAIREVATASGEPPIARGYPASVFTELPRLLERAG 310

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
           P  +  G ITA+IS+LVDGDNHNDPIADS R ILDGHIVL RSLAEEGRYPP+DPLAS+S
Sbjct: 311 PGPEGAGTITAIISILVDGDNHNDPIADSTRGILDGHIVLQRSLAEEGRYPPIDPLASIS 370

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           RLA KAW+ D++KLVS L  LIHRFEETRD+R+IGGYR G D  LD A+ QVPIIYD LK
Sbjct: 371 RLARKAWTPDQEKLVSRLKVLIHRFEETRDLRMIGGYRQGADPDLDMAIKQVPIIYDVLK 430

Query: 419 QSPSDLSSEDVF 430
           QSP D  S D F
Sbjct: 431 QSPGDRDSLDAF 442


>gi|222147566|ref|YP_002548523.1| flagellum-specific ATP synthase [Agrobacterium vitis S4]
 gi|221734554|gb|ACM35517.1| flagellum-specific ATP synthase [Agrobacterium vitis S4]
          Length = 464

 Score =  568 bits (1465), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 263/437 (60%), Positives = 342/437 (78%), Gaps = 2/437 (0%)

Query: 4   NLETLAQLAEDYSKN--LVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQ 61
            L+ +A +A+ Y+ +   V  GG++ +I + +YTVT LS+++ LGDFV H+     +LG+
Sbjct: 14  QLDAMAAIAKRYATSDYSVAHGGHVRTIAAGHYTVTGLSRHLHLGDFVAHRSPTGIHLGE 73

Query: 62  VIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGK 121
           V+R+  D+ Y+CP+  GE I++GD V   G FR++    WCGR +NALG PIDG   +  
Sbjct: 74  VVRVEPDLAYVCPIEPGEPIAIGDTVIRKGAFRVAAQDSWCGRTLNALGDPIDGLGPVMP 133

Query: 122 GDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMF 181
           G +   I +  P +M R+RVE GF+TG++ +DIF+PLC GQR+G+FAGSG+GKSTLLSM 
Sbjct: 134 GLVRRSIANTAPSSMGRKRVETGFRTGVKAVDIFSPLCLGQRLGIFAGSGVGKSTLLSML 193

Query: 182 ARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTI 241
           A++D FDKV+I+LVGERGREVREFIED LGDN+ K+V +VATSDESP+LRKMAPLTA+T+
Sbjct: 194 AKADAFDKVVIALVGERGREVREFIEDTLGDNMAKTVAIVATSDESPMLRKMAPLTAITV 253

Query: 242 AEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSE 301
           AE+F  +GDNVL I DSITRFAH+IRE+AT +GE P+ARG+P SVF+ELP+LLER GP E
Sbjct: 254 AEHFRDQGDNVLFIADSITRFAHAIREVATAAGEPPIARGFPASVFTELPKLLERAGPGE 313

Query: 302 KEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLA 361
           +  G ITA+IS+LVDGDNHNDPIAD  R ILDGHIVL+RSLAEEGRYPP++PLAS+SRLA
Sbjct: 314 EGTGTITAIISILVDGDNHNDPIADCTRGILDGHIVLDRSLAEEGRYPPINPLASISRLA 373

Query: 362 DKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSP 421
            KAW+ D++KLVS L  LIHRFEETRD+RLIGGYR G D  LD A+ QVPI+Y+ LKQ+P
Sbjct: 374 RKAWTPDQEKLVSRLKTLIHRFEETRDLRLIGGYRAGSDPDLDMAIKQVPILYEVLKQTP 433

Query: 422 SDLSSEDVFQEITKKLQ 438
           SD +  D + ++   L+
Sbjct: 434 SDRAVVDAYADLAHALK 450


>gi|150395480|ref|YP_001325947.1| flagellum-specific ATP synthase [Sinorhizobium medicae WSM419]
 gi|150026995|gb|ABR59112.1| ATPase, FliI/YscN family [Sinorhizobium medicae WSM419]
          Length = 467

 Score =  558 bits (1438), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 269/430 (62%), Positives = 337/430 (78%), Gaps = 2/430 (0%)

Query: 11  LAEDYSKN--LVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLD 68
           L E Y+     +  GG++ +I+  +YTV+ LS++V LGDFV H+     +LG+V+R+  +
Sbjct: 21  LVERYANPEFAIAPGGHVQTISPGHYTVSGLSRHVRLGDFVAHKSATGTHLGEVVRVEPE 80

Query: 69  IVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEI 128
            V +CP+  G+ I + D+V   G FRI+P+  WCGR INAL +PID    L +GD+   I
Sbjct: 81  RVVVCPIEPGDPIGIHDIVIRKGAFRIAPTDKWCGRTINALAEPIDSLGVLLQGDVRRSI 140

Query: 129 MSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFD 188
            +  PP+M R+RVE GFKTG+R IDIF+PLC GQR+G+FAGSG+GKSTLLSM AR+D FD
Sbjct: 141 ANVAPPSMTRKRVEHGFKTGVRAIDIFSPLCLGQRLGIFAGSGVGKSTLLSMLARADAFD 200

Query: 189 KVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSK 248
           KV+I+LVGERGREVREFIED LG NL KSV VVATSDESP+LRKMAPLTAVTIAE++  +
Sbjct: 201 KVVIALVGERGREVREFIEDTLGSNLSKSVAVVATSDESPMLRKMAPLTAVTIAEHYRDQ 260

Query: 249 GDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNIT 308
           GDNVLLI+DS+TRFAH+IRE+AT +GE P+ARGYP SVF+ELPRLLER GP  +  G IT
Sbjct: 261 GDNVLLIVDSVTRFAHAIREVATAAGEPPIARGYPASVFTELPRLLERAGPGAEGTGTIT 320

Query: 309 AVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSAD 368
           A+IS+LVDGDNHNDP+ADS R ILDGHIVL RSLAEEGRYPPV+PL+S+SRLA KAW+ D
Sbjct: 321 AIISILVDGDNHNDPVADSARGILDGHIVLERSLAEEGRYPPVNPLSSISRLARKAWTPD 380

Query: 369 EKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSED 428
           ++KLV+ L  LIHRFEETRD+RLIGGYRPG D  LD A+ QVP+IYD L Q+P +  + D
Sbjct: 381 QEKLVARLKSLIHRFEETRDLRLIGGYRPGGDADLDMAIRQVPVIYDVLMQTPGERPAFD 440

Query: 429 VFQEITKKLQ 438
            F ++   L+
Sbjct: 441 AFTDLANALK 450


>gi|163758010|ref|ZP_02165098.1| flagellum-specific ATP synthase [Hoeflea phototrophica DFL-43]
 gi|162284299|gb|EDQ34582.1| flagellum-specific ATP synthase [Hoeflea phototrophica DFL-43]
          Length = 459

 Score =  520 bits (1340), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 246/438 (56%), Positives = 323/438 (73%), Gaps = 5/438 (1%)

Query: 6   ETLAQLAEDYSKNLVVQGGY-----ISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLG 60
           + LA LA +  +     GGY     ++ ++  +  V  LS++V +GDF+  +  +   L 
Sbjct: 5   QGLAVLAREVRRISRPHGGYDVSGIVTEVSPGHCVVAGLSRHVRIGDFISFRHDDGVKLA 64

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLG 120
           +V+ +  D +  CPV    + ++G+ V+  G FR+SP   WCGR INALG+P+DG   L 
Sbjct: 65  EVVSLGPDQLIACPVDGAAQAAIGERVWRQGAFRLSPHHTWCGRTINALGEPVDGLGGLE 124

Query: 121 KGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSM 180
            G +S  +    P +M RQRV    +TGIRV+D+FTP+C GQR+G+FAGSG+GKSTLLSM
Sbjct: 125 HGTVSRPVTGAPPASMLRQRVNAPLRTGIRVVDVFTPICRGQRLGIFAGSGVGKSTLLSM 184

Query: 181 FARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVT 240
           FA++  FD+ +I+LVGERGREVREFIED LG+N+KK+V VVATSDESP+LRK+APLTAVT
Sbjct: 185 FAKAADFDRAVIALVGERGREVREFIEDTLGENMKKTVAVVATSDESPMLRKLAPLTAVT 244

Query: 241 IAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPS 300
           +AE+F  +G+NVLLI+DS+TRFAH++REI   +GE PVARGYP SVF+ LP LLER GP 
Sbjct: 245 VAEHFRDQGENVLLIVDSLTRFAHALREIGMAAGEPPVARGYPASVFTALPGLLERAGPG 304

Query: 301 EKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRL 360
            K  G ITA++S+LVDGDNHNDP+ADS R ILDGH+VL+R+LA+EGRYPPV+PL S+SRL
Sbjct: 305 PKGAGAITAIVSILVDGDNHNDPVADSARGILDGHLVLDRALADEGRYPPVNPLTSISRL 364

Query: 361 ADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQS 420
           A KAW  DE+KLV  L  LIHR+EETRD+RLIGGYRPG D  LD A+ Q P+IYD L+Q+
Sbjct: 365 ARKAWRGDEEKLVMRLKALIHRYEETRDLRLIGGYRPGTDAELDMAIKQAPVIYDSLRQN 424

Query: 421 PSDLSSEDVFQEITKKLQ 438
           P    S D F E+ + ++
Sbjct: 425 PDQPPSADAFAELAEAMK 442


>gi|260466624|ref|ZP_05812812.1| ATPase, FliI/YscN family [Mesorhizobium opportunistum WSM2075]
 gi|259029630|gb|EEW30918.1| ATPase, FliI/YscN family [Mesorhizobium opportunistum WSM2075]
          Length = 466

 Score =  494 bits (1273), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 235/420 (55%), Positives = 312/420 (74%), Gaps = 1/420 (0%)

Query: 19  LVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIG 78
           LV +GG ++ +T  +Y V  LS +  LGD V  +G      G++++I+ D V + P    
Sbjct: 39  LVKRGGLVTEVTPTHYKVRGLSDFARLGDIVEQRGLAGARRGEIVKISRDEVVVAPFERS 98

Query: 79  EEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNR 138
            +  +GD VF  G   ++P   W GR I+AL + IDG   L +GD  M   +  P AM R
Sbjct: 99  ADAGIGDAVFRRGPLAVAPHGSWRGRTIDALTRAIDGGPPLVRGD-DMAASATTPGAMAR 157

Query: 139 QRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGER 198
           QRV   F TG++VIDIFTPLC GQR+GVFAGSG+GKSTLL+M A +D FD V+++L+GER
Sbjct: 158 QRVGTAFMTGVKVIDIFTPLCLGQRLGVFAGSGVGKSTLLAMLAGADAFDTVVVALIGER 217

Query: 199 GREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDS 258
           GREVREF+ED +GD++ K+V VVATSDES ++R+ AP TA+ +AE+F  +G  VLL+LDS
Sbjct: 218 GREVREFLEDTIGDSMAKTVAVVATSDESAMMRRRAPDTAMRVAEHFRDQGHRVLLVLDS 277

Query: 259 ITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGD 318
           ITRFAH++RE+AT +GE PVARGYP SVF+ELP+LLER GP  + KG+ITA+ISVLVDGD
Sbjct: 278 ITRFAHALREVATGTGEPPVARGYPASVFTELPKLLERAGPGAEGKGSITAIISVLVDGD 337

Query: 319 NHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTH 378
           +HNDP+ADSVR ILDGH+VL+R++AE+GRYPPV+PL+S+SRLA KAWS +++ LV+ L  
Sbjct: 338 DHNDPVADSVRGILDGHVVLDRAIAEQGRYPPVNPLSSISRLAGKAWSLEQRALVTRLKS 397

Query: 379 LIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
           +I RFE+TRDIRL+G Y+ GVD  LD AV QVP+IY+ L QSP D  S D F ++ + L+
Sbjct: 398 MISRFEDTRDIRLLGAYQGGVDAELDIAVRQVPLIYEALTQSPRDRPSTDPFSDLARHLK 457


>gi|13472571|ref|NP_104138.1| flagellum-specific ATP synthase [Mesorhizobium loti MAFF303099]
 gi|14023317|dbj|BAB49924.1| flagella-specific ATPase; FliI [Mesorhizobium loti MAFF303099]
          Length = 466

 Score =  492 bits (1266), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 232/423 (54%), Positives = 312/423 (73%), Gaps = 1/423 (0%)

Query: 16  SKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPV 75
           +  LV +GG ++ +T  +Y V  LS +  LGD V  +G+     G++++I+ D V + P 
Sbjct: 36  TDGLVKRGGLVTEVTQTHYKVRGLSDFARLGDMVEQRGQAGSRRGEIVKISRDEVVVAPF 95

Query: 76  GIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPA 135
               +  +GD VF  G   + P   W GR I+AL + IDG   L +G+  +   +  P A
Sbjct: 96  ERSADAGIGDAVFRRGPLAVGPHNSWRGRTIDALTRAIDGGPPLIRGE-DLSGGATTPGA 154

Query: 136 MNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLV 195
           M RQRV   F TG++VIDIFTPLC GQR+GVFAGSG+GKSTLL+M A +D FD V+++L+
Sbjct: 155 MARQRVGTAFMTGVKVIDIFTPLCFGQRMGVFAGSGVGKSTLLAMLAGADAFDTVVVALI 214

Query: 196 GERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLI 255
           GERGREVREF+ED +GD++ K+V VVATSDES ++R+ AP TA+ +AE+F  +G  VLL+
Sbjct: 215 GERGREVREFLEDTIGDSMAKTVAVVATSDESAMMRRRAPDTAMRVAEHFRDQGHRVLLV 274

Query: 256 LDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLV 315
           LDSITRFAH++RE+AT +GE PVARGYP SVF+ELP+LLER GP  + KG+ITA+ISVLV
Sbjct: 275 LDSITRFAHALREVATGTGEPPVARGYPASVFTELPKLLERAGPGAEGKGSITAIISVLV 334

Query: 316 DGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSS 375
           DGD+HNDP+ADSVR ILDGH+VL+R++AE+GRYPPV+PL+S+SRLA KAWS +++ LV+ 
Sbjct: 335 DGDDHNDPVADSVRGILDGHVVLDRAIAEQGRYPPVNPLSSISRLAGKAWSVEQRALVTR 394

Query: 376 LTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITK 435
           L  +I RFE+TRDIRL+G Y+ G D  LD AV QVP+IY+ L QSP D  S D F ++ +
Sbjct: 395 LKSMISRFEDTRDIRLLGAYQGGADAELDIAVRQVPLIYEALTQSPRDRPSADPFSDLAR 454

Query: 436 KLQ 438
            L+
Sbjct: 455 HLK 457


>gi|319781686|ref|YP_004141162.1| ATPase, FliI/YscN family [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317167574|gb|ADV11112.1| ATPase, FliI/YscN family [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 467

 Score =  490 bits (1262), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 230/423 (54%), Positives = 309/423 (73%)

Query: 16  SKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPV 75
           ++ L+ +GG +  +T  +Y V  LS +  LGD V   G      G++++I  D   + P 
Sbjct: 36  AEALLKRGGRVIEVTPTHYKVHGLSSFARLGDIVEQPGHAGARRGEIVKIGRDEAVVAPF 95

Query: 76  GIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPA 135
               +  +GD VF  G   ++P A W GR I+AL + IDG   L +GD +       P A
Sbjct: 96  ERSADSGIGDAVFRRGPLVVAPHASWRGRTIDALTRAIDGGPPLARGDDTSRGAQTTPGA 155

Query: 136 MNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLV 195
           M RQRV   F TG++VIDIFTPLC GQR+G+FAGSG+GKSTLL+M A +D FD V+++L+
Sbjct: 156 MARQRVGTAFMTGVKVIDIFTPLCFGQRLGIFAGSGVGKSTLLAMLAGADAFDTVVVALI 215

Query: 196 GERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLI 255
           GERGREVREF+ED +GD++ K++ VVATSDES ++R+ AP TA+ +AE+F  +G  VLL+
Sbjct: 216 GERGREVREFLEDTIGDSMAKTIAVVATSDESAMMRRRAPDTAMRVAEHFRDQGHRVLLV 275

Query: 256 LDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLV 315
           LDSITRFAH++RE+AT +GE PVARGYP SVF+ELP+LLER GP  + KG+ITA+ISVLV
Sbjct: 276 LDSITRFAHALREVATGTGEPPVARGYPASVFTELPKLLERAGPGTEGKGSITAIISVLV 335

Query: 316 DGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSS 375
           DGD+HNDP+ADSVR ILDGH+VL+R++AE+GRYPPV+PL+S+SRLA KAWS +++ LV+ 
Sbjct: 336 DGDDHNDPVADSVRGILDGHVVLDRTIAEQGRYPPVNPLSSISRLAGKAWSVEQRALVTR 395

Query: 376 LTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITK 435
           L  +I RFE+TRDIRL+G Y+ GVD  LD AV QVP+IY+ L Q P D  S D F ++ +
Sbjct: 396 LKSMISRFEDTRDIRLLGAYQGGVDAELDIAVRQVPLIYEALTQGPKDRPSADPFSDLAR 455

Query: 436 KLQ 438
            L+
Sbjct: 456 HLK 458


>gi|110632661|ref|YP_672869.1| flagellum-specific ATP synthase [Mesorhizobium sp. BNC1]
 gi|110283645|gb|ABG61704.1| ATPase, FliI/YscN family [Chelativorans sp. BNC1]
          Length = 465

 Score =  478 bits (1229), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 231/424 (54%), Positives = 308/424 (72%), Gaps = 2/424 (0%)

Query: 17  KNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVG 76
           + +V  GG IS +T +YY V  LS+   LG  + ++   S+  G+V+RI+ D V + P  
Sbjct: 34  QRMVRHGGRISEVTPMYYRVRGLSKTARLGQIISYRSHGSEYRGEVVRISEDDVIVAPFE 93

Query: 77  IGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGK-GDLSMEIMSKVPPA 135
              E SLG  VF  G   I P A W GRVI+AL + +D   +L +        M + P A
Sbjct: 94  HSAEASLGQAVFATGTLEIRPHASWRGRVIDALARALDDGPALIRSAPQGPAAMPRTPAA 153

Query: 136 MNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLV 195
           + RQRV + F TG+RV+D+F PLC GQRIG+FAGSG+GKSTLL+M AR++ FD V++++V
Sbjct: 154 LRRQRVAEPFLTGVRVVDLFAPLCLGQRIGIFAGSGVGKSTLLAMLARAEAFDTVVVAMV 213

Query: 196 GERGREVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLL 254
           GERGREVREF+ED LG+  +KK+V VVATSDES ++R+ A  TA+ +AE+F   G+ VLL
Sbjct: 214 GERGREVREFLEDTLGEAGMKKTVAVVATSDESAMMRRRAADTAMRVAEHFRDAGEKVLL 273

Query: 255 ILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVL 314
           +LDSITR+AH+ RE+AT +GE PVARGYP SVF++LPRLLER GP E   G+ITAV SVL
Sbjct: 274 LLDSITRYAHATREVATGAGEPPVARGYPASVFTDLPRLLERAGPGETGHGSITAVFSVL 333

Query: 315 VDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVS 374
           VDGD+HNDP+AD VR ILDGH+VL+R++AE+GR+P V PLAS+SRLAD++W+ D K++V 
Sbjct: 334 VDGDDHNDPVADCVRGILDGHLVLDRAIAEQGRFPAVSPLASISRLADRSWTDDRKRVVQ 393

Query: 375 SLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEIT 434
            L  +I RFEETRDIRL+GG++ G+D  LD AV QVP+IYD L+QSP D  + D F ++ 
Sbjct: 394 RLKAMIARFEETRDIRLLGGFQAGLDPELDLAVRQVPLIYDILRQSPKDPPAMDPFADLA 453

Query: 435 KKLQ 438
             L+
Sbjct: 454 AHLK 457


>gi|121602501|ref|YP_989404.1| flagellum-specific ATP synthase [Bartonella bacilliformis KC583]
 gi|120614678|gb|ABM45279.1| flagellum-specific ATP synthase [Bartonella bacilliformis KC583]
          Length = 537

 Score =  458 bits (1178), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 226/425 (53%), Positives = 300/425 (70%)

Query: 14  DYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYIC 73
           +YS + + QGG IS +     T   LSQ V LGD V  +       G++IR+N + V I 
Sbjct: 111 EYSSHSINQGGVISDVARGILTARGLSQSVFLGDTVCIECGTQTVRGEIIRVNEESVLIK 170

Query: 74  PVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVP 133
           P        L   VF  G   ++P A WCGRV+NA G+ IDG  +L  G   M + +  P
Sbjct: 171 PYDETIVPVLKASVFPQGPLFVAPDASWCGRVVNAFGEAIDGKGALLLGSSPMAVEAHAP 230

Query: 134 PAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIIS 193
           PA+ R RV  G +TG++VIDIFTPLC GQRIG+F+GSG+GKSTLLSM  ++D FDKV+++
Sbjct: 231 PALARARVGNGLRTGVKVIDIFTPLCFGQRIGIFSGSGVGKSTLLSMMMQADHFDKVVLA 290

Query: 194 LVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVL 253
           L GERGREVR+ ++D L D L K V V+ATSDESP++R++AP+ A TIAEYFSS GDNVL
Sbjct: 291 LTGERGREVRDMLDDTLQDKLDKVVAVIATSDESPMMRRLAPIMATTIAEYFSSLGDNVL 350

Query: 254 LILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISV 313
           L++DSITR+A ++REIA ++ E PV+RG+P  VFSELPRLLER GP  K KG+IT V +V
Sbjct: 351 LVVDSITRYALAVREIAISAHEPPVSRGFPPRVFSELPRLLERAGPGRKGKGSITGVYAV 410

Query: 314 LVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLV 373
           LVDGD+HNDPIAD++R ILDGHIVL+R++A +GR+P VD  +S+SRLA  +W+ +++ LV
Sbjct: 411 LVDGDDHNDPIADAIRGILDGHIVLDRAIAAQGRFPAVDISSSISRLASHSWTGEQRILV 470

Query: 374 SSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEI 433
            SL  +I R+EETRD+R +G YRPG D ILD+AVH VP IY  + Q+       + + E+
Sbjct: 471 QSLKEMIFRYEETRDLRAMGAYRPGTDHILDQAVHLVPSIYAAMNQNIDTPLVRNPYDEL 530

Query: 434 TKKLQ 438
            K L+
Sbjct: 531 AKLLK 535


>gi|182679723|ref|YP_001833869.1| flagellum-specific ATP synthase [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182635606|gb|ACB96380.1| ATPase, FliI/YscN family [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 442

 Score =  453 bits (1166), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 223/437 (51%), Positives = 308/437 (70%), Gaps = 2/437 (0%)

Query: 4   NLETLAQLAEDYSKN--LVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQ 61
            L+ L Q  ++  ++  LV  GG ++ +T  + +V  LS ++ LGD +      S  LG+
Sbjct: 3   TLDRLGQKLDNARRDIKLVRIGGTVTEVTPAFISVAGLSSFIKLGDCIKFGEDGSSALGE 62

Query: 62  VIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGK 121
           V+RI+     I        I LGD  +  G F+I P   W GRVINALG PIDG D+L  
Sbjct: 63  VVRIDQQNATIKIFDHASSIGLGDKAWRMGPFQICPDPSWKGRVINALGIPIDGGDALRL 122

Query: 122 GDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMF 181
           G+ S  I +  PPAM R RV K  +TG+RVID+FTPLC GQRIG+FAGSG+GKSTLL M 
Sbjct: 123 GEESQSIHAAPPPAMRRARVTKPMRTGVRVIDLFTPLCAGQRIGIFAGSGVGKSTLLGML 182

Query: 182 ARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTI 241
           A S  FD V+I LVGERGREVREF+++ L D+L  +V +VAT DES ++R++AP TA+TI
Sbjct: 183 AGSREFDTVVIGLVGERGREVREFLDEVLADHLANAVTIVATGDESSLMRRLAPNTAMTI 242

Query: 242 AEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSE 301
           AE+F  +G+NVLLI+DS+TRFAH+ R++A  +GE+ VARGY  SVF++LP+LLER GP  
Sbjct: 243 AEFFRDRGENVLLIVDSVTRFAHAARDVALAAGEMAVARGYAPSVFTDLPKLLERAGPGL 302

Query: 302 KEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLA 361
              G+IT + SVLVDGD+HN+PIAD++R  LDGHIVL+R++A++GR+P V+ L S+SRLA
Sbjct: 303 DGSGSITGIFSVLVDGDDHNEPIADTIRGTLDGHIVLDRAIADQGRFPAVNILRSISRLA 362

Query: 362 DKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSP 421
              W+ +++ LV  +  LI R+E+TRD+RL+GGY+PG D  LD+A+  VP IY  ++Q+P
Sbjct: 363 QHVWTPEQQGLVLKIRGLIARYEDTRDLRLMGGYQPGSDGELDQAIALVPKIYQAMEQTP 422

Query: 422 SDLSSEDVFQEITKKLQ 438
              +S+D F+E+ + LQ
Sbjct: 423 KSPASQDAFRELAEILQ 439


>gi|319403956|emb|CBI77544.1| Flagellum-specific ATP synthase [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 510

 Score =  452 bits (1163), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 225/431 (52%), Positives = 299/431 (69%)

Query: 8   LAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINL 67
            A+   D+  +LV QGG IS +         LSQ V LGD V  + ++    G++IR+N 
Sbjct: 78  FAKHKNDHYSHLVSQGGVISDVARGTLVARGLSQSVLLGDTVSVECESQFLRGEIIRVNE 137

Query: 68  DIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSME 127
           + V I P        L   VF  G   ++P   WCGR++NA G+ IDG   L  G  +M 
Sbjct: 138 ESVLIKPYDETVVPMLSASVFPKGPLFVAPDRSWCGRIVNAFGEAIDGKGGLSSGPRNMA 197

Query: 128 IMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCF 187
           I +  PPA+ R RV  G +TGI+VIDIFTPLC GQRIGVF+GSG+GKSTLLSM  ++D F
Sbjct: 198 IETYAPPALKRARVGAGLRTGIKVIDIFTPLCFGQRIGVFSGSGVGKSTLLSMMMQADHF 257

Query: 188 DKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSS 247
           D V+++L GERGREVR+ ++D L D L K + V+AT DESP++R++AP+ A TIAEYFSS
Sbjct: 258 DTVVLALTGERGREVRDMLDDVLHDKLHKLIGVIATGDESPMMRRLAPIMATTIAEYFSS 317

Query: 248 KGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNI 307
            GDNVLL++DS+TR+A + REIA  + E PV+RG+P  VFSELPRLLER GP  + KG+I
Sbjct: 318 LGDNVLLVVDSVTRYALATREIAITAHEPPVSRGFPPRVFSELPRLLERAGPGREGKGSI 377

Query: 308 TAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSA 367
           T V +VLVDGD+HNDPIAD++R ILDGHIVL+R++A +GR+P VD L+S+SRLA   W+ 
Sbjct: 378 TGVYAVLVDGDDHNDPIADTIRGILDGHIVLDRAIAAQGRFPAVDILSSISRLASHNWTP 437

Query: 368 DEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSE 427
           ++  LV +L  +I R+EETRD+R +G YRPG D +LD+AV  VP IY  +KQSP      
Sbjct: 438 EQCTLVKNLKEMIFRYEETRDLRAMGAYRPGTDHVLDQAVFLVPSIYAAMKQSPDMALIS 497

Query: 428 DVFQEITKKLQ 438
           D ++E+ K L+
Sbjct: 498 DPYEELAKLLK 508


>gi|319406972|emb|CBI80609.1| Flagellum-specific ATP synthase [Bartonella sp. 1-1C]
          Length = 510

 Score =  451 bits (1161), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 225/431 (52%), Positives = 299/431 (69%)

Query: 8   LAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINL 67
            A+   D+  +LV QGG IS +         LSQ V LGD V  + ++    G++IR+N 
Sbjct: 78  FAKHKNDHYSHLVSQGGVISDVARGTLVARGLSQSVLLGDTVSVECESQFLRGEIIRVNE 137

Query: 68  DIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSME 127
           + V I P        L   VF  G   ++P   WCGR++NA G+ IDG   L  G  +M 
Sbjct: 138 ESVLIKPYDETVVPMLSASVFPKGPLFVAPDRSWCGRIVNAFGEAIDGKGGLSSGPRNMA 197

Query: 128 IMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCF 187
           I +  PPA+ R RV  G +TGI+VIDIFTPLC GQRIGVF+GSG+GKSTLLSM  ++D F
Sbjct: 198 IETYAPPALKRARVGAGLRTGIKVIDIFTPLCFGQRIGVFSGSGVGKSTLLSMMMQADHF 257

Query: 188 DKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSS 247
           D V+++L GERGREVR+ ++D L D L K + V+AT DESP++R++AP+ A TIAEYFSS
Sbjct: 258 DTVVLALTGERGREVRDMLDDVLHDKLHKLIGVIATGDESPMMRRLAPIMATTIAEYFSS 317

Query: 248 KGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNI 307
            GDNVLL++DS+TR+A + REIA  + E PV+RG+P  VFSELPRLLER GP  + KG+I
Sbjct: 318 LGDNVLLVVDSVTRYALATREIAITAHEPPVSRGFPPRVFSELPRLLERAGPGREGKGSI 377

Query: 308 TAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSA 367
           T V +VLVDGD+HNDPIAD++R ILDGHIVL+R++A +GR+P VD L+S+SRLA   W+ 
Sbjct: 378 TGVYAVLVDGDDHNDPIADTIRGILDGHIVLDRAIAAQGRFPAVDILSSISRLASHNWTP 437

Query: 368 DEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSE 427
           ++  LV +L  +I R+EETRD+R +G YRPG D +LD+AV  VP IY  +KQSP      
Sbjct: 438 EQCTLVKNLKEMIFRYEETRDLRAMGAYRPGTDHVLDQAVFLVPSIYAAMKQSPDMGLIS 497

Query: 428 DVFQEITKKLQ 438
           D ++E+ K L+
Sbjct: 498 DPYEELAKLLK 508


>gi|217977820|ref|YP_002361967.1| flagellum-specific ATP synthase [Methylocella silvestris BL2]
 gi|217503196|gb|ACK50605.1| ATPase, FliI/YscN family [Methylocella silvestris BL2]
          Length = 449

 Score =  450 bits (1157), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 224/429 (52%), Positives = 300/429 (69%), Gaps = 2/429 (0%)

Query: 11  LAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVH--QGKNSDNLGQVIRINLD 68
           + +  ++ LV   G ++ ++  +  V  LS +V LG+ V    + + + N G+V+RI+  
Sbjct: 17  MTQAAAEPLVRVSGAVTELSPSHARVAGLSSFVKLGECVRFGPEAEGARNRGEVVRIDAQ 76

Query: 69  IVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEI 128
            V +     G   SLG+ VF  G  RI+P   W GRV+NA G PIDG   L +GD S  I
Sbjct: 77  GVIVKTFEAGALTSLGERVFRAGPLRIAPHPGWKGRVVNAFGAPIDGAGPLPQGDRSAMI 136

Query: 129 MSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFD 188
            +  P AM R RV    +TG+RVIDIFTPLC GQRIG+FAGSG+GKSTLL+M A S  FD
Sbjct: 137 DAPPPSAMRRARVAWPLRTGVRVIDIFTPLCAGQRIGIFAGSGVGKSTLLAMLAGSKDFD 196

Query: 189 KVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSK 248
            V+++LVGERGREVREF++D L  N   SV VVAT DE+P +R++AP TA+ IAE+F  +
Sbjct: 197 TVVVALVGERGREVREFLDDALAANRPISVAVVATGDETPSMRRLAPRTAMAIAEFFRDR 256

Query: 249 GDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNIT 308
           GD VLLI+DS+TRFAH+ R++A  +GE PVARGY  SVFS+LP+LLER GP E+  G+IT
Sbjct: 257 GDRVLLIIDSVTRFAHAARDVALAAGEPPVARGYTPSVFSDLPKLLERAGPGEEGGGSIT 316

Query: 309 AVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSAD 368
            V SVLVDGD+HNDP+AD+VR  LDGHIVL+R++A++GR+P V+ LAS+SRLA  AW+A+
Sbjct: 317 GVFSVLVDGDDHNDPVADAVRGTLDGHIVLDRAIADQGRFPAVNVLASISRLAQIAWTAE 376

Query: 369 EKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSED 428
           ++ LV  L  +I RFE++ D+RL+GGY+ G D  LD+AV   P IY  L+QSP    S D
Sbjct: 377 QRDLVVKLRGMIARFEDSSDLRLMGGYKAGQDADLDQAVALAPKIYKALQQSPQSTPSAD 436

Query: 429 VFQEITKKL 437
            F+E+ + L
Sbjct: 437 AFRELAQSL 445


>gi|158422270|ref|YP_001523562.1| flagellum-specific ATP synthase [Azorhizobium caulinodans ORS 571]
 gi|158329159|dbj|BAF86644.1| flagellum-specific ATP synthase [Azorhizobium caulinodans ORS 571]
          Length = 440

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 214/416 (51%), Positives = 296/416 (71%)

Query: 23  GGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEIS 82
           GG +  +T  Y+ V+ +S Y+ LGD V         +G+V+R++     + P      + 
Sbjct: 24  GGIVREVTPTYFRVSGISSYLRLGDRVGIDQDGRTRIGEVVRVDEAGAAVKPFDERVPVG 83

Query: 83  LGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVE 142
           +G + F  G   +SP   W GRVINALG P+DG+  L +G+  M + ++ PPAM RQR++
Sbjct: 84  MGSVAFRAGSLSLSPDRSWKGRVINALGVPLDGEGLLARGEHRMPMDAEPPPAMTRQRIQ 143

Query: 143 KGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREV 202
           KG +TG+RVID+FTPLC GQR+G+FAGSG+GKSTLL+M ARS  FD V++ LVGERGREV
Sbjct: 144 KGIRTGVRVIDLFTPLCEGQRMGIFAGSGVGKSTLLAMLARSAVFDTVVVGLVGERGREV 203

Query: 203 REFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRF 262
           REF+E  L  N  +SVVVV+TSDESP++R++AP +A+ +AEYF   G++VLLI+DS+TR+
Sbjct: 204 REFLEGPLASNRHRSVVVVSTSDESPMMRRLAPQSALAVAEYFRDLGESVLLIIDSVTRY 263

Query: 263 AHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHND 322
           AH+ R++A  +GE  VARGY  SVFS LP+LLER GP  +  G ITAV SVLVDGD+HND
Sbjct: 264 AHAARDVALAAGEPAVARGYAPSVFSTLPKLLERAGPGTEGAGCITAVFSVLVDGDDHND 323

Query: 323 PIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHR 382
           P+AD++R  LDGHIVL+R++A++GR+P V+ L S+SRLAD  W+ +E+ LV  L  ++ R
Sbjct: 324 PVADAIRGTLDGHIVLDRAIADQGRFPAVNVLGSISRLADHVWTPEERDLVRRLKSMVAR 383

Query: 383 FEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
           FE+TRD+RL+GGY  G D  LD+AV  VP IY+ L+Q      S D F E+ + ++
Sbjct: 384 FEDTRDLRLMGGYHAGSDPELDQAVALVPKIYEALRQYSDSPPSLDPFGELAQAIR 439


>gi|90422599|ref|YP_530969.1| flagellum-specific ATP synthase [Rhodopseudomonas palustris BisB18]
 gi|90104613|gb|ABD86650.1| ATPase FliI/YscN [Rhodopseudomonas palustris BisB18]
          Length = 443

 Score =  447 bits (1150), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 223/433 (51%), Positives = 303/433 (69%), Gaps = 2/433 (0%)

Query: 1   MQKNLETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLG 60
           +++   TL  L +D     V  GG +S +T  YY V  LS+YV LG+ +     N   LG
Sbjct: 4   LERLESTLVALRQDVPT--VRLGGVVSEVTPTYYRVAGLSRYVRLGELIGLDVDNQIQLG 61

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLG 120
           +V+RI+   V   P        LG + +      +SP   W GRV+NALG+P+D    L 
Sbjct: 62  EVVRIDGTGVTAKPFDSHVAAGLGLVAYRLPPKTLSPHPSWKGRVVNALGEPLDDAGVLQ 121

Query: 121 KGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSM 180
            G+  M   +  PPAM+R RV+    TG+RV+D+FTPLC GQRIG+FAGSG+GK+TLLSM
Sbjct: 122 AGERVMSTDANPPPAMSRTRVQAPLHTGVRVVDLFTPLCIGQRIGIFAGSGVGKTTLLSM 181

Query: 181 FARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVT 240
            A+S  FD V+ +LVGERGREVREF+E+ L  +  +++ VV+TSDESP++R++A  TA T
Sbjct: 182 LAQSSGFDTVVTALVGERGREVREFLEEALVHHRSRAITVVSTSDESPMMRRLAAKTATT 241

Query: 241 IAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPS 300
           IAEYF  +G++VLLI+DS+TRFAH+ RE+A  +GE  +ARGY  SVFSELPRLLER GP 
Sbjct: 242 IAEYFRDRGESVLLIVDSVTRFAHAAREVALATGEPAIARGYAPSVFSELPRLLERSGPG 301

Query: 301 EKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRL 360
              +G+IT + +VLVDGD+HN+P+AD+VRS LDGHIVL+R +A++GRYP ++ LASVSRL
Sbjct: 302 LDGQGSITGIFAVLVDGDDHNEPVADTVRSTLDGHIVLDREVADQGRYPAINVLASVSRL 361

Query: 361 ADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQS 420
           A   WS +E+ LV  L  +I RFE+TRD+RL+GGY+PG D  LD+AV  VP IY+ ++Q+
Sbjct: 362 AQHVWSPEERNLVRKLRAMIARFEDTRDLRLMGGYQPGRDNELDQAVQLVPKIYEVMQQA 421

Query: 421 PSDLSSEDVFQEI 433
           PSD +  + FQE+
Sbjct: 422 PSDPACGEPFQEL 434


>gi|319898632|ref|YP_004158725.1| flagellum-specific ATP synthase [Bartonella clarridgeiae 73]
 gi|319402596|emb|CBI76141.1| Flagellum-specific ATP synthase [Bartonella clarridgeiae 73]
          Length = 514

 Score =  446 bits (1146), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 223/431 (51%), Positives = 298/431 (69%)

Query: 8   LAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINL 67
            A+  +DY   LV QGG IS +         LSQ V LGD V  + +     G++IR+N 
Sbjct: 80  FARRKDDYYSQLVSQGGIISDVARGTLVARGLSQSVLLGDTVSVECETQLLRGEIIRVNE 139

Query: 68  DIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSME 127
           + V I P        L   VF  G   ++P   W GR++NA G+ IDG   L  G  +M 
Sbjct: 140 ESVLIKPYDETIVPVLSASVFPKGPLFVAPDRSWRGRIVNAFGEAIDGKGILSSGSQNMA 199

Query: 128 IMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCF 187
           I +  PPA+ R RV  G +TG++VIDIFTPLC GQR+G+F+GSG+GKSTLLSM  ++D F
Sbjct: 200 IETYAPPALKRARVGAGLRTGVKVIDIFTPLCFGQRVGIFSGSGVGKSTLLSMMMQADHF 259

Query: 188 DKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSS 247
           D VI++L GERGREVR+ ++D L D L K V V+AT DESP++R +AP+ A TIAEYFSS
Sbjct: 260 DTVILALTGERGREVRDMLDDTLQDKLHKLVGVIATGDESPMMRHLAPIMATTIAEYFSS 319

Query: 248 KGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNI 307
            GDNVLL++DS+TR+A + REIA ++ E PV+RG+P  VFSELPRLLER GP  + KG+I
Sbjct: 320 LGDNVLLVVDSVTRYALAAREIAISAHEPPVSRGFPPRVFSELPRLLERAGPGREGKGSI 379

Query: 308 TAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSA 367
           T V +VLVDGD+HNDPI+D++R ILDGHIVL+R++A +GR+P VD L+S+SRLA  +W+ 
Sbjct: 380 TGVYAVLVDGDDHNDPISDAIRGILDGHIVLDRAIAAQGRFPAVDILSSISRLASHSWTP 439

Query: 368 DEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSE 427
           ++  LV +L  +I R+EETRD+R +G YRPG D +LD+AV  VP IY  +KQSP      
Sbjct: 440 EQCTLVKNLKEMIFRYEETRDLRAMGAYRPGTDHVLDQAVFLVPSIYAAMKQSPDVPLIS 499

Query: 428 DVFQEITKKLQ 438
           D ++E+ K L+
Sbjct: 500 DPYEELAKLLK 510


>gi|115523167|ref|YP_780078.1| flagellum-specific ATP synthase [Rhodopseudomonas palustris BisA53]
 gi|115517114|gb|ABJ05098.1| ATPase, FliI/YscN family [Rhodopseudomonas palustris BisA53]
          Length = 443

 Score =  444 bits (1141), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 222/427 (51%), Positives = 301/427 (70%), Gaps = 2/427 (0%)

Query: 7   TLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRIN 66
           TLA L +D     V  GG +S +   +Y V  LS+ V LG+ +  +  N   +G+VIRI+
Sbjct: 10  TLASLHKDVPT--VRLGGTVSEVAPTHYRVAGLSRLVKLGELIGLEVDNQMQIGEVIRID 67

Query: 67  LDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSM 126
            + V   P        LG + +      +SP   W GRVINALG+P+DG   L  G+  M
Sbjct: 68  GNGVTAKPFESHVAAGLGLIAYRLPPKTLSPHPSWKGRVINALGQPLDGAGVLLAGEREM 127

Query: 127 EIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDC 186
              +  PPAM+R RV    +TG+RVID+F+P+C GQRIG+FAGSG+GK+TLLSM A+S  
Sbjct: 128 STDANPPPAMSRARVRAPLQTGVRVIDLFSPICVGQRIGIFAGSGVGKTTLLSMMAQSAG 187

Query: 187 FDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFS 246
           FD V+ +LVGERGREVREF+E+ L  +  ++V VV+TSDESP++R++A  TA TIAEYF 
Sbjct: 188 FDTVVTALVGERGREVREFLEEALVHHKSRAVTVVSTSDESPMMRRLAAKTATTIAEYFR 247

Query: 247 SKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGN 306
            +G++VLLI+DS+TRFAH+ RE+A  +GE  +ARGY  SVFSE+PRLLER GP    +G+
Sbjct: 248 DRGESVLLIVDSVTRFAHAAREVALATGEPAIARGYAPSVFSEIPRLLERSGPGIDGQGS 307

Query: 307 ITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWS 366
           IT + +VLVDGD+HN+P+AD+VRS LDGHIVL+R +A++GRYP V+ L+SVSRLA   WS
Sbjct: 308 ITGIFAVLVDGDDHNEPVADTVRSTLDGHIVLDREVADQGRYPAVNVLSSVSRLAQHVWS 367

Query: 367 ADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
            +E+ LV  L  +I RFE+TRD+RL+GGY+PG D  LD+AV  VP IY+ ++Q+PSD   
Sbjct: 368 PEERNLVRKLRAMIARFEDTRDLRLMGGYQPGRDSELDQAVQLVPKIYEVMQQAPSDPGC 427

Query: 427 EDVFQEI 433
            + FQE+
Sbjct: 428 TEPFQEL 434


>gi|319409191|emb|CBI82835.1| Flagellum-specific ATP synthase [Bartonella schoenbuchensis R1]
          Length = 509

 Score =  442 bits (1138), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 222/426 (52%), Positives = 297/426 (69%)

Query: 13  EDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYI 72
           +D S  LV QGG IS +         LSQ V LGD V          G++I +N + V I
Sbjct: 82  DDPSSCLVNQGGVISDVARGTLVARGLSQSVLLGDTVCIDCDGQAVRGEIIHVNEENVLI 141

Query: 73  CPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKV 132
            P        L   VF  G   ++P   WCGRV+NALG+ IDG  +L  G  +M +   V
Sbjct: 142 KPYDETVVPVLMASVFPKGPLFVAPDRSWCGRVVNALGEAIDGKGALLSGPRNMAVEGDV 201

Query: 133 PPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVII 192
           PPA+ R RV+KG +TG++VIDIFTPLC GQRIG+FAGSG+GKSTLLSM  ++D FD V++
Sbjct: 202 PPALKRARVKKGLRTGVKVIDIFTPLCFGQRIGIFAGSGVGKSTLLSMMMQADHFDTVVL 261

Query: 193 SLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNV 252
           +L GERGREVR+ ++D L + L K V V+AT DESP++R++AP+ A TIAEYFSS GDNV
Sbjct: 262 ALTGERGREVRDMLDDTLHNKLDKVVAVIATGDESPMMRRLAPIMATTIAEYFSSLGDNV 321

Query: 253 LLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVIS 312
           LL++DS+TR+A ++REIA ++ E PV+RG+P  VFSELPRLLER G   + KG+IT V +
Sbjct: 322 LLVVDSVTRYALAMREIAISAHEPPVSRGFPPRVFSELPRLLERAGSGREGKGSITGVYA 381

Query: 313 VLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKL 372
           VLVDGD+HNDPI+D++R ILDGHIVL+R++A +GR+P VD  AS+SRLA  +W+ +++ L
Sbjct: 382 VLVDGDDHNDPISDAIRGILDGHIVLDRAIAAQGRFPAVDIPASISRLAPHSWTDEQRIL 441

Query: 373 VSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQE 432
           V +L  +I R+EETRD+R +G YR G D +LD+A+  VP IY  +KQSP      D + E
Sbjct: 442 VQNLKEMIFRYEETRDLRAMGAYRAGTDQVLDQAIFLVPSIYAAMKQSPDMPLVHDPYDE 501

Query: 433 ITKKLQ 438
           + K L+
Sbjct: 502 LAKLLK 507


>gi|319405397|emb|CBI79016.1| Flagellum-specific ATP synthase [Bartonella sp. AR 15-3]
          Length = 509

 Score =  442 bits (1137), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 218/431 (50%), Positives = 298/431 (69%)

Query: 8   LAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINL 67
            A+   D+  +LV QGG IS +         LSQ V LGD V  + +     G++IR+N 
Sbjct: 77  FAKRKNDHYSHLVSQGGVISDVARGTLVARGLSQSVLLGDTVCIECETQLLRGEIIRVNE 136

Query: 68  DIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSME 127
           +   I P        L   VF  G   ++P   WCGR++NA G+ IDG   L  G  +M 
Sbjct: 137 ESALIKPYDETVVPILAASVFPKGPLFVAPDRSWCGRIVNAFGEAIDGKGVLSSGPRNMA 196

Query: 128 IMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCF 187
           I +  PPA+ R RV  G +TG++VIDIFTPLC GQRIG+F+GSG+GKSTLLSM  ++D F
Sbjct: 197 IEAYAPPALKRARVGAGLRTGVKVIDIFTPLCFGQRIGIFSGSGVGKSTLLSMMMQADHF 256

Query: 188 DKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSS 247
           D V+++L GERGREVR+ ++D + D L K + V+AT DESP++R++AP+ A TIAEYFSS
Sbjct: 257 DTVVLALTGERGREVRDMLDDIVQDKLHKLIGVIATGDESPMMRRLAPIMATTIAEYFSS 316

Query: 248 KGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNI 307
            GDNVLL++DSITR+A + REIA  + E PV+RG+P  VFSEL RLLER GP  + KG+I
Sbjct: 317 LGDNVLLVVDSITRYALAAREIAITAHEPPVSRGFPPRVFSELSRLLERAGPGRERKGSI 376

Query: 308 TAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSA 367
           T V +VLVDGD+HNDPIAD++R ILDGHIVL+R++A +GR+P VD L+S+SRLA  +W+ 
Sbjct: 377 TGVYAVLVDGDDHNDPIADTIRGILDGHIVLDRAIAAQGRFPAVDILSSISRLASHSWTP 436

Query: 368 DEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSE 427
           ++  LV +L  +I R+EETRD+R +G YRPG+D +LD+AV  VP +Y  +KQ+P      
Sbjct: 437 EQCTLVKNLKEMIFRYEETRDLRAMGAYRPGIDHVLDQAVFLVPSVYTAIKQNPDMPLII 496

Query: 428 DVFQEITKKLQ 438
           D ++E+ + L+
Sbjct: 497 DPYEELARLLK 507


>gi|161511087|ref|NP_773525.2| flagellum-specific ATP synthase [Bradyrhizobium japonicum USDA 110]
          Length = 441

 Score =  439 bits (1130), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 214/430 (49%), Positives = 294/430 (68%)

Query: 9   AQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLD 68
           A L    S  L    G IS I   ++ V+ LS++V LG+ +         +G+V+RI+ +
Sbjct: 10  ALLELQQSTPLASVSGAISEIAPTHFRVSGLSRFVRLGELIGVNSGGKPQIGEVVRIDSE 69

Query: 69  IVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEI 128
            +   P        LG + +       +P   W GRVINALG P+DG   L  G  ++  
Sbjct: 70  GIIAKPFDRQFAGGLGSVAYRMPPLSFAPDPSWKGRVINALGAPLDGQGPLTPGSRAVSA 129

Query: 129 MSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFD 188
            ++ P AM R RV K  +TG+RVID+F P+C GQR+G+FAGSG+GKSTLL+M ARS  FD
Sbjct: 130 EAEAPSAMKRARVHKPLRTGVRVIDLFAPICAGQRVGIFAGSGVGKSTLLAMLARSQGFD 189

Query: 189 KVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSK 248
            V+++LVGERGREVREFIED LG N  ++V +V+T DESP++R++AP TA+ +AEYF  +
Sbjct: 190 TVVLALVGERGREVREFIEDVLGANRNRAVTIVSTGDESPMMRRLAPKTAMAVAEYFRDR 249

Query: 249 GDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNIT 308
           G++VLL++DSITRFAH+ RE+A  +GE  VARGY  +VF++LPRLLER GP E+  G IT
Sbjct: 250 GESVLLVVDSITRFAHAAREVALAAGEPAVARGYAPTVFTDLPRLLERAGPGEEGSGTIT 309

Query: 309 AVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSAD 368
            + SVLVDGD+HN+PIAD++RS LDGHIVL+R +A++ RYP VD LASVSRLA   W  +
Sbjct: 310 GIFSVLVDGDDHNEPIADTIRSTLDGHIVLSRHIADQARYPAVDVLASVSRLAHNVWDPE 369

Query: 369 EKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSED 428
           E++LVS L  +I ++E+TRD+RL+GGY+ G D  LD+A+  VP IY  ++Q  S   S D
Sbjct: 370 ERELVSKLRTMIAKYEDTRDLRLMGGYQSGRDSGLDQAIDLVPRIYSAMRQDASAQPSAD 429

Query: 429 VFQEITKKLQ 438
            F+E+   L+
Sbjct: 430 PFRELRDMLK 439


>gi|90418401|ref|ZP_01226313.1| flagellum-specific ATP synthase FliI [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90338073|gb|EAS51724.1| flagellum-specific ATP synthase FliI [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 457

 Score =  436 bits (1122), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 210/415 (50%), Positives = 291/415 (70%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISL 83
           G+I  ++   + V  LS +V LGD +   G + D +G+V+RI    + + P        +
Sbjct: 23  GHIIDVSPQAFRVAGLSPFVRLGDRIACPGDDGDAIGEVVRIEQASLTVKPFANRFVRGV 82

Query: 84  GDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEK 143
                  G F +SPS  W GRV++A G+P DG   + +GD      +   PAM R R  K
Sbjct: 83  KAPARQIGPFMVSPSRSWKGRVLDAFGQPTDGKGPVSEGDDPRRADAPPLPAMQRGRTGK 142

Query: 144 GFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVR 203
              TG+R +DIFTPL  GQRIG+FAGSG+GKSTL+SM AR+  FD V+++LVGERGREVR
Sbjct: 143 PVATGVRALDIFTPLVRGQRIGIFAGSGVGKSTLMSMLARAKGFDTVVVALVGERGREVR 202

Query: 204 EFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFA 263
           EF+E+ +  NL K V +VAT DESP++R++AP TA ++AEYF  +GD+VLLI+DS+TR A
Sbjct: 203 EFLEETMAGNLAKVVTIVATGDESPMMRRLAPRTATSVAEYFRDRGDSVLLIVDSVTRLA 262

Query: 264 HSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDP 323
           H+ R++A  +GE PVARGYP SVFSELP+LLER GP  +  G+IT + SVLVDGD+HNDP
Sbjct: 263 HAARDVALAAGEPPVARGYPPSVFSELPQLLERAGPGLEGSGSITGIFSVLVDGDDHNDP 322

Query: 324 IADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRF 383
           IAD++R  LDGHIVL+R++AE+GR+P VD L S+SRLAD+AW+  E++LVS L  +I R+
Sbjct: 323 IADAIRGTLDGHIVLDRAIAEQGRFPAVDVLKSISRLADRAWNPQERELVSRLRSMISRY 382

Query: 384 EETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
           E+TRD+RL+GGY+ G D  LD+AV  VP +Y+ L Q P +   +  F++++ +L+
Sbjct: 383 EDTRDLRLLGGYQRGSDQTLDQAVDLVPHVYEHLVQHPEEGPCKQPFEDLSARLK 437


>gi|153011529|ref|YP_001372743.1| flagellum-specific ATP synthase [Ochrobactrum anthropi ATCC 49188]
 gi|151563417|gb|ABS16914.1| ATPase, FliI/YscN family [Ochrobactrum anthropi ATCC 49188]
          Length = 452

 Score =  434 bits (1115), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 223/438 (50%), Positives = 294/438 (67%), Gaps = 4/438 (0%)

Query: 5   LETLAQLAEDYS---KNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQ 61
           L  LA  A   S   K L   GG +S ++     V  LS+   LGD V    +   +L +
Sbjct: 7   LSRLAAFARQQSVAPKPLTGIGGTVSDVSRSAIAVRGLSRDAHLGDAVAIHAQGGQSLAE 66

Query: 62  VIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGK 121
           +IR+    V + P       SLG  VF  G  RI P+  W GRVINALG+ +DG  +L  
Sbjct: 67  IIRVADTQVLVKPFDDRIIPSLGAAVFEEGPMRIRPALEWRGRVINALGEAVDGKGALQP 126

Query: 122 GDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMF 181
           G   M   S  P A+ R RV++G +TG+ VIDIFTPLC GQRIG+FAGSG+GKSTLL+M 
Sbjct: 127 GTRPMASESLAPAALRRGRVDRGLRTGVNVIDIFTPLCFGQRIGIFAGSGVGKSTLLAMM 186

Query: 182 ARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTI 241
            R+  FD V+++L GERGREVRE +E+ +  +L K++ VVAT DESP++R++AP TA  I
Sbjct: 187 TRAADFDTVVLALTGERGREVREMLEETMAGHLDKTITVVATGDESPMMRRLAPNTATAI 246

Query: 242 AEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSE 301
           AEYF   G NVLLI+DS+TRFAH+ RE+A  + E PV+RGYP SVFS+LPRLLER GP  
Sbjct: 247 AEYFRDLGQNVLLIVDSVTRFAHAAREVAIAAEEPPVSRGYPPSVFSQLPRLLERAGPGI 306

Query: 302 KEK-GNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRL 360
            E  G+IT + SVLVDGD+HNDP++D++R  LDGHIVL+R++A +GR+P VD   SVSRL
Sbjct: 307 TEAGGSITGIYSVLVDGDDHNDPVSDTIRGTLDGHIVLDRAIAAQGRFPAVDIPGSVSRL 366

Query: 361 ADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQS 420
           A   W+ +++KLVS L  ++ RFEETRD+R IG Y+ G D +LD+AV  VP IYD L+QS
Sbjct: 367 AKHNWTPEQRKLVSQLRGMVARFEETRDLRAIGAYQKGHDGLLDQAVDLVPRIYDALQQS 426

Query: 421 PSDLSSEDVFQEITKKLQ 438
           P    S+D + ++   L+
Sbjct: 427 PETGLSDDPYNDLAAALR 444


>gi|328545465|ref|YP_004305574.1| H(+)-transporting ATP synthase, flagellum-specific protein
           [polymorphum gilvum SL003B-26A1]
 gi|326415206|gb|ADZ72269.1| H(+)-transporting ATP synthase, flagellum-specific protein
           [Polymorphum gilvum SL003B-26A1]
          Length = 440

 Score =  433 bits (1114), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 217/415 (52%), Positives = 286/415 (68%)

Query: 23  GGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEIS 82
           GG ++ +T     +  LS+ VCLGD VV  GK  +   ++IR++   V + P     +I+
Sbjct: 24  GGRVTQVTPGSVRICGLSRSVCLGDLVVLSGKGGERRSEIIRLDEQDVLVKPFDSHVDIA 83

Query: 83  LGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVE 142
           +G   F  G   I P   W GRVI+ALG P D    L  G  +M      P  + R R+ 
Sbjct: 84  IGARAFRKGSLTIHPHESWKGRVIDALGHPADDRGVLRPGPAAMLPDCDPPATLERARIR 143

Query: 143 KGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREV 202
           K  +TG+RVID+FTPLC GQRIG+FAGSG+GKSTLL+M A S  FD V++ LVGERGREV
Sbjct: 144 KPVRTGVRVIDLFTPLCVGQRIGIFAGSGVGKSTLLAMLAGSGDFDTVVVGLVGERGREV 203

Query: 203 REFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRF 262
           REF+ED LG+  ++SVVVVAT +ES ++R++AP TA+ +AEYF   G +VLLI+DS TRF
Sbjct: 204 REFVEDVLGEARERSVVVVATGNESAMMRRLAPKTAMGVAEYFRDLGQSVLLIIDSATRF 263

Query: 263 AHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHND 322
           AH+ R++A  +GE PVARGY  SVFS+L RLLER GP  + KG IT + SVLVDGD+HND
Sbjct: 264 AHAARDVAMAAGEPPVARGYTPSVFSDLTRLLERAGPGGEGKGAITGIFSVLVDGDDHND 323

Query: 323 PIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHR 382
           P+AD++R +LDGHIVL+RS+A+ GRYP VD L SVSRL+  AWSA+E++L+  L  +I R
Sbjct: 324 PVADTLRGVLDGHIVLDRSIADAGRYPAVDVLKSVSRLSQHAWSAEERELILRLKAMISR 383

Query: 383 FEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKL 437
           FE+TRD+RL+GGY+PG D  LDKA   VP IY+ L+Q        D F ++ + L
Sbjct: 384 FEDTRDLRLMGGYQPGSDPALDKACTLVPRIYEALRQDARSAQVGDPFADLARAL 438


>gi|254699440|ref|ZP_05161268.1| flagellum-specific ATP synthase [Brucella suis bv. 5 str. 513]
 gi|256014919|ref|YP_003104928.1| flagellum-specific ATP synthase FliI [Brucella microti CCM 4915]
 gi|256059628|ref|ZP_05449825.1| flagellum-specific ATP synthase [Brucella neotomae 5K33]
 gi|256111962|ref|ZP_05452913.1| flagellum-specific ATP synthase [Brucella melitensis bv. 3 str.
           Ether]
 gi|261323598|ref|ZP_05962795.1| flagellum-specific ATP synthase [Brucella neotomae 5K33]
 gi|261749891|ref|ZP_05993600.1| flagellum-specific ATP synthase [Brucella suis bv. 5 str. 513]
 gi|265993411|ref|ZP_06105968.1| flagellum-specific ATP synthase [Brucella melitensis bv. 3 str.
           Ether]
 gi|255997579|gb|ACU49266.1| flagellum-specific ATP synthase FliI [Brucella microti CCM 4915]
 gi|261299578|gb|EEY03075.1| flagellum-specific ATP synthase [Brucella neotomae 5K33]
 gi|261739644|gb|EEY27570.1| flagellum-specific ATP synthase [Brucella suis bv. 5 str. 513]
 gi|262764281|gb|EEZ10313.1| flagellum-specific ATP synthase [Brucella melitensis bv. 3 str.
           Ether]
          Length = 453

 Score =  433 bits (1113), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 218/418 (52%), Positives = 289/418 (69%), Gaps = 2/418 (0%)

Query: 23  GGYISSITSVYYTVTCLSQYVCLGDFV-VHQGKNSDNLGQVIRINLDIVYICPVGIGEEI 81
           GG +S ++     V  LS+   LGD V +  G+ + +L ++IR+    V + P       
Sbjct: 28  GGTVSDVSRSSIAVRGLSRDARLGDTVAIRAGEGAPSLAEIIRVADLQVLVKPFDDRIMP 87

Query: 82  SLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRV 141
           SLG  VF  G  RI P+  W GRVINALG  IDG  +L  G   M   S  P A+ R RV
Sbjct: 88  SLGAAVFEEGPLRIRPAPEWRGRVINALGNAIDGKGALKPGTRPMAAESLAPAALRRARV 147

Query: 142 EKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGRE 201
           ++G +TG+ VIDIFTPLC GQRIG+FAGSG+GKSTLL+M  R+  FD V+++L GERGRE
Sbjct: 148 DRGLRTGVNVIDIFTPLCFGQRIGIFAGSGVGKSTLLAMMTRAADFDTVVLALTGERGRE 207

Query: 202 VREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITR 261
           VRE +E+ +  +L K++ VVAT DESP++R++AP TA  IAEYF   G NVLLI+DS+TR
Sbjct: 208 VREMLEETMAGHLGKTITVVATGDESPMMRRLAPNTATAIAEYFRDLGQNVLLIVDSVTR 267

Query: 262 FAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEK-GNITAVISVLVDGDNH 320
           FAH+ RE+A  + E PVARGYP SVFS+LPRLLER GP   E  G+IT + SVLVDGD+H
Sbjct: 268 FAHAAREVAIAAEEPPVARGYPPSVFSQLPRLLERAGPGSAEAGGSITGIYSVLVDGDDH 327

Query: 321 NDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLI 380
           NDP++D++R  LDGHIVL+R++A +GR+P VD  ASVSRLA   W+ +++KLV  L  ++
Sbjct: 328 NDPVSDTIRGTLDGHIVLDRAIAAQGRFPAVDIPASVSRLAKHNWTPEQRKLVMQLRSMV 387

Query: 381 HRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
            RFEETRD+R IG Y+ G D +LD+AV  VP IY+ L+QSP    S+D + ++   L+
Sbjct: 388 ARFEETRDLRAIGAYQKGHDGLLDQAVDFVPRIYEALQQSPETGLSDDPYNDLAAALR 445


>gi|163844324|ref|YP_001621979.1| flagellum-specific ATP synthase [Brucella suis ATCC 23445]
 gi|163675047|gb|ABY39157.1| ATPase FliI/YscN family [Brucella suis ATCC 23445]
          Length = 453

 Score =  432 bits (1112), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 218/418 (52%), Positives = 289/418 (69%), Gaps = 2/418 (0%)

Query: 23  GGYISSITSVYYTVTCLSQYVCLGDFV-VHQGKNSDNLGQVIRINLDIVYICPVGIGEEI 81
           GG +S ++     V  LS+   LGD V +  G+ + +L ++IR+    V + P       
Sbjct: 28  GGTVSDVSRSSIAVRGLSRDARLGDTVAIRAGEGAPSLAEIIRVADLQVLVKPFDDRIMP 87

Query: 82  SLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRV 141
           SLG  VF  G  RI P+  W GRVINALG  IDG  +L  G   M   S  P A+ R RV
Sbjct: 88  SLGAAVFEEGPLRIRPAPEWRGRVINALGNAIDGKGALKPGTRPMAAESLAPAALRRARV 147

Query: 142 EKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGRE 201
           ++G +TG+ VIDIFTPLC GQRIG+FAGSG+GKSTLL+M  R+  FD V+++L GERGRE
Sbjct: 148 DRGLRTGVNVIDIFTPLCFGQRIGIFAGSGVGKSTLLAMMTRAADFDTVVLALTGERGRE 207

Query: 202 VREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITR 261
           VRE +E+ +  +L K++ VVAT DESP++R++AP TA  IAEYF   G NVLLI+DS+TR
Sbjct: 208 VREMLEETMAGHLGKTITVVATGDESPMMRRLAPNTATAIAEYFRDLGQNVLLIVDSVTR 267

Query: 262 FAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKE-KGNITAVISVLVDGDNH 320
           FAH+ RE+A  + E PVARGYP SVFS+LPRLLER GP   E  G+IT + SVLVDGD+H
Sbjct: 268 FAHAAREVAIAAEEPPVARGYPPSVFSQLPRLLERAGPGSAEGGGSITGIYSVLVDGDDH 327

Query: 321 NDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLI 380
           NDP++D++R  LDGHIVL+R++A +GR+P VD  ASVSRLA   W+ +++KLV  L  ++
Sbjct: 328 NDPVSDTIRGTLDGHIVLDRAIAAQGRFPAVDIPASVSRLAKHNWTPEQRKLVMQLRSMV 387

Query: 381 HRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
            RFEETRD+R IG Y+ G D +LD+AV  VP IY+ L+QSP    S+D + ++   L+
Sbjct: 388 ARFEETRDLRAIGAYQKGHDGLLDQAVDFVPRIYEALQQSPETGLSDDPYNDLAAALR 445


>gi|300024617|ref|YP_003757228.1| ATPase, FliI/YscN family [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526438|gb|ADJ24907.1| ATPase, FliI/YscN family [Hyphomicrobium denitrificans ATCC 51888]
          Length = 456

 Score =  432 bits (1111), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 215/415 (51%), Positives = 282/415 (67%), Gaps = 1/415 (0%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISL 83
           G ++ I+  Y  VT LS++V +GD V   G     L +V  I   ++ + P      I L
Sbjct: 31  GRVARISPTYIVVTGLSKFVSIGDAVSIAGIGGSVLAEVASIEAQVINVTPFIADHRIEL 90

Query: 84  GDLVFHW-GRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVE 142
           G  V    G+  +SP   W GR +NALG PID    L  GD ++ I    P AM R R+ 
Sbjct: 91  GASVTALSGQLTLSPHESWLGRTLNALGHPIDDQGPLIAGDRAVPIQGSPPAAMRRSRLG 150

Query: 143 KGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREV 202
           +  KTG++ ID+FTP+C GQRIG+FAGSG+GKSTLL+M +R+   D  +++LVGER REV
Sbjct: 151 EQLKTGVKAIDLFTPICAGQRIGIFAGSGVGKSTLLAMLSRAPSSDVTVLALVGERSREV 210

Query: 203 REFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRF 262
           R+F++D L  +  + V VVATSDESP++R++AP  A+ IAEY+  +G NVLLI+DS+TR+
Sbjct: 211 RDFLDDTLSASRDRVVSVVATSDESPMMRRLAPAAAMCIAEYYRDQGKNVLLIIDSLTRY 270

Query: 263 AHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHND 322
           AH++RE+A  S E PVARGYP SVFS LPRLLER G  E+  G ITAV+SVLVDGD+HND
Sbjct: 271 AHAMRELALASDEPPVARGYPPSVFSALPRLLERAGTGEEGAGTITAVLSVLVDGDDHND 330

Query: 323 PIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHR 382
           PIAD+ R ILDGHIVL RS+A +GR P VDPLAS+SRLA K  +  + +  + L   I R
Sbjct: 331 PIADAARGILDGHIVLERSIASQGRLPAVDPLASLSRLAPKIRTKQQSQFTTQLIESISR 390

Query: 383 FEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKL 437
           FE+TRD+R IGGYRPG DL LD+A+  VP +YD LKQ  ++   EDVF  + + L
Sbjct: 391 FEDTRDLRAIGGYRPGSDLTLDRALETVPRVYDALKQDLNETPVEDVFAFLAQTL 445


>gi|254559267|ref|YP_003066362.1| flagellum-specific ATP synthase [Methylobacterium extorquens DM4]
 gi|254266545|emb|CAX22309.1| flagellum-specific ATP synthase [Methylobacterium extorquens DM4]
          Length = 442

 Score =  432 bits (1111), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 212/441 (48%), Positives = 297/441 (67%), Gaps = 3/441 (0%)

Query: 1   MQKN-LETLAQLAEDYSKNL--VVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSD 57
           M +N +E L Q  E   ++L  V   G +  +T+    V  +S +V LGD +        
Sbjct: 1   MTRNAIERLEQAMEAGRRDLPLVRIAGPVREVTASAARVAGVSAFVRLGDRMGFSADGRT 60

Query: 58  NLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDD 117
            +G+V+RI+     + P     E  +G L    G  ++ P   W GRVI+ALG+P+DG  
Sbjct: 61  QVGEVVRIDAAGATVKPFESRIEAGIGSLAHRIGPAQLRPDPRWKGRVIDALGRPVDGLG 120

Query: 118 SLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
            L +G  S+ + +  P AM R RV+    TG+R ID+FTPLC GQRIG+FAGSG+GKSTL
Sbjct: 121 PLAEGPASVPLDADPPAAMTRARVKTPLPTGVRAIDLFTPLCAGQRIGIFAGSGVGKSTL 180

Query: 178 LSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLT 237
           L+M A +  FD V+++LVGERGREVREF+E  +     ++V+VV+T DESP++R+ AP  
Sbjct: 181 LAMLAGAQGFDSVVVALVGERGREVREFLEGPIAAARDRAVIVVSTGDESPMMRRQAPKV 240

Query: 238 AVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERI 297
           A+ +AE F  +G++VLLI+DS+TR+AH+ R++A  +GE  VARGYP SVFS+LPRLLER 
Sbjct: 241 ALAVAESFRDRGESVLLIVDSVTRYAHAARDVALAAGEPAVARGYPPSVFSDLPRLLERA 300

Query: 298 GPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASV 357
           GP  +  G IT + SVLVDGD+HNDP+ADS+R  LDGH+VL+R++AE+GRYP ++ L S+
Sbjct: 301 GPGAEGTGTITGIFSVLVDGDDHNDPVADSIRGTLDGHVVLDRAIAEQGRYPAIELLGSI 360

Query: 358 SRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFL 417
           SRLA + W+ D+++LV  L  ++ RFEETRD+RL+GGYR G D  LD+AV  VP IY+ L
Sbjct: 361 SRLAGEVWTGDQRELVRKLKSMMARFEETRDLRLMGGYRAGSDPDLDQAVSLVPRIYEAL 420

Query: 418 KQSPSDLSSEDVFQEITKKLQ 438
           +Q P    S D F E+ + L+
Sbjct: 421 RQEPGQPPSRDAFLELAQSLR 441


>gi|161620215|ref|YP_001594101.1| flagellum-specific ATP synthase [Brucella canis ATCC 23365]
 gi|254702557|ref|ZP_05164385.1| flagellum-specific ATP synthase [Brucella suis bv. 3 str. 686]
 gi|260568535|ref|ZP_05839004.1| flagellum-specific ATP synthase [Brucella suis bv. 4 str. 40]
 gi|261753135|ref|ZP_05996844.1| flagellum-specific ATP synthase [Brucella suis bv. 3 str. 686]
 gi|161337026|gb|ABX63330.1| ATPase FliI/YscN family [Brucella canis ATCC 23365]
 gi|260155200|gb|EEW90281.1| flagellum-specific ATP synthase [Brucella suis bv. 4 str. 40]
 gi|261742888|gb|EEY30814.1| flagellum-specific ATP synthase [Brucella suis bv. 3 str. 686]
          Length = 453

 Score =  432 bits (1111), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 218/418 (52%), Positives = 289/418 (69%), Gaps = 2/418 (0%)

Query: 23  GGYISSITSVYYTVTCLSQYVCLGDFV-VHQGKNSDNLGQVIRINLDIVYICPVGIGEEI 81
           GG +S ++     V  LS+   LGD V +  G+ + +L ++IR+    V + P       
Sbjct: 28  GGTVSDVSRSSIAVRGLSRDARLGDTVAIRAGEGAPSLAEIIRVADLQVLVKPFDDRIMP 87

Query: 82  SLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRV 141
           SLG  VF  G  RI P+  W GRVINALG  IDG  +L  G   M   S  P A+ R RV
Sbjct: 88  SLGAAVFEEGPLRIRPAPEWRGRVINALGNAIDGKGALKLGTRPMAAESLAPAALRRARV 147

Query: 142 EKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGRE 201
           ++G +TG+ VIDIFTPLC GQRIG+FAGSG+GKSTLL+M  R+  FD V+++L GERGRE
Sbjct: 148 DRGLRTGVNVIDIFTPLCFGQRIGIFAGSGVGKSTLLAMMTRAADFDTVVLALTGERGRE 207

Query: 202 VREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITR 261
           VRE +E+ +  +L K++ VVAT DESP++R++AP TA  IAEYF   G NVLLI+DS+TR
Sbjct: 208 VREMLEETMAGHLGKTITVVATGDESPMMRRLAPNTATAIAEYFRDLGQNVLLIVDSVTR 267

Query: 262 FAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEK-GNITAVISVLVDGDNH 320
           FAH+ RE+A  + E PVARGYP SVFS+LPRLLER GP   E  G+IT + SVLVDGD+H
Sbjct: 268 FAHAAREVAIAAEEPPVARGYPPSVFSQLPRLLERAGPGSAEAGGSITGIYSVLVDGDDH 327

Query: 321 NDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLI 380
           NDP++D++R  LDGHIVL+R++A +GR+P VD  ASVSRLA   W+ +++KLV  L  ++
Sbjct: 328 NDPVSDTIRGTLDGHIVLDRAIAAQGRFPAVDIPASVSRLAKHNWTPEQRKLVMQLRSMV 387

Query: 381 HRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
            RFEETRD+R IG Y+ G D +LD+AV  VP IY+ L+QSP    S+D + ++   L+
Sbjct: 388 ARFEETRDLRAIGAYQKGHDGLLDQAVDFVPRIYEALQQSPETGLSDDPYNDLAAALR 445


>gi|218528726|ref|YP_002419542.1| flagellum-specific ATP synthase [Methylobacterium chloromethanicum
           CM4]
 gi|218521029|gb|ACK81614.1| ATPase, FliI/YscN family [Methylobacterium chloromethanicum CM4]
          Length = 442

 Score =  432 bits (1110), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 210/436 (48%), Positives = 294/436 (67%), Gaps = 2/436 (0%)

Query: 5   LETLAQLAEDYSKNL--VVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQV 62
           +E L Q  E   ++L  V   G +  +T+    V  +S +V LGD +         +G+V
Sbjct: 6   IERLEQAMEAGRRDLPLVRVAGPVREVTASAARVAGVSAFVRLGDRMGFSADGRTQVGEV 65

Query: 63  IRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKG 122
           +RI+     + P     E  +G L    G  ++ P   W GRVI+ALG+P+DG   L +G
Sbjct: 66  VRIDAAGATVKPFESRIEAGIGSLAHRIGPAQLRPDPRWKGRVIDALGRPVDGLGPLAEG 125

Query: 123 DLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFA 182
             S+ + +  P AM R RV+    TG+R ID+FTPLC GQRIG+FAGSG+GKSTLL+M A
Sbjct: 126 PASVPLDADPPAAMTRARVKTPLPTGVRAIDLFTPLCAGQRIGIFAGSGVGKSTLLAMLA 185

Query: 183 RSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIA 242
            +  FD V+++LVGERGREVREF+E  +     ++V+VV+T DESP++R+ AP  A+ +A
Sbjct: 186 GAQGFDSVVVALVGERGREVREFLEGPIAAARDRAVIVVSTGDESPMMRRQAPKVALAVA 245

Query: 243 EYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEK 302
           E F  +G++VLLI+DS+TR+AH+ R++A  +GE  VARGYP SVFS+LPRLLER GP  +
Sbjct: 246 ESFRDRGESVLLIVDSVTRYAHAARDVALAAGEPAVARGYPPSVFSDLPRLLERAGPGAE 305

Query: 303 EKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLAD 362
             G IT + SVLVDGD+HNDP+ADS+R  LDGH+VL+R++AE+GRYP ++ L S+SRLA 
Sbjct: 306 GTGTITGIFSVLVDGDDHNDPVADSIRGTLDGHVVLDRAIAEQGRYPAIELLGSISRLAG 365

Query: 363 KAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPS 422
           + W+ D+++LV  L  ++ RFEETRD+RL+GGYR G D  LD+AV  VP IY+ L+Q P 
Sbjct: 366 EVWTGDQRELVRKLKSMMARFEETRDLRLMGGYRAGSDPDLDQAVSLVPRIYEALRQEPG 425

Query: 423 DLSSEDVFQEITKKLQ 438
              S D F E+ + L+
Sbjct: 426 QPPSRDAFLELAQSLR 441


>gi|188579924|ref|YP_001923369.1| flagellum-specific ATP synthase [Methylobacterium populi BJ001]
 gi|179343422|gb|ACB78834.1| ATPase, FliI/YscN family [Methylobacterium populi BJ001]
          Length = 442

 Score =  431 bits (1109), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 207/422 (49%), Positives = 291/422 (68%)

Query: 17  KNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVG 76
           + LV  GG +  +T+    V  +S +V LGD +         +G+V+RI+     + P  
Sbjct: 20  RPLVRVGGPVREVTASAARVAGVSAFVRLGDRMGFSADGRVQVGEVVRIDSAGATVKPFE 79

Query: 77  IGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAM 136
              E  +G L    G  ++ P   W GRVI+ALG+P+DG   L +G  S+ + +  P AM
Sbjct: 80  SRIEAGIGSLAHRIGPAQLRPDPRWKGRVIDALGRPVDGLGPLAEGPDSVPLDADPPAAM 139

Query: 137 NRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVG 196
            R RV     TG+R +D+FTPLC GQRIG+FAGSG+GKSTLL+M A ++ FD V+++LVG
Sbjct: 140 TRARVRTPLPTGVRAVDLFTPLCAGQRIGIFAGSGVGKSTLLAMLAGAEGFDSVVVALVG 199

Query: 197 ERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLIL 256
           ERGREVREF+E  +  + +++V+VV+T DESP++R+ AP  A+ +AE F  +G++VLLI+
Sbjct: 200 ERGREVREFLEGPIAASRERAVIVVSTGDESPMMRRQAPKVALAVAECFRDRGESVLLIV 259

Query: 257 DSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVD 316
           DS+TR+AH+ R++A  +GE  VARGYP SVFS+LPRLLER GP  +  G IT + SVLVD
Sbjct: 260 DSVTRYAHAARDVALAAGEPAVARGYPPSVFSDLPRLLERAGPGAEGSGTITGIFSVLVD 319

Query: 317 GDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSL 376
           GD+HNDP+ADS+R  LDGH+VL+R++AE+GRYP +D L S+SRLA + W+ D+++LV  L
Sbjct: 320 GDDHNDPVADSIRGTLDGHVVLDRAIAEQGRYPAIDLLGSISRLAGEVWTGDQRELVRKL 379

Query: 377 THLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKK 436
             ++ RFEETRD+RL+GGYR G D  LD+AV  VP IY+ L+Q P    S D F E+ + 
Sbjct: 380 KSMMARFEETRDLRLMGGYRAGSDPDLDQAVSLVPRIYEALRQEPGQPPSRDAFLELAQS 439

Query: 437 LQ 438
           L+
Sbjct: 440 LR 441


>gi|306846297|ref|ZP_07478858.1| ATPase FliI/YscN family [Brucella sp. BO1]
 gi|306273292|gb|EFM55161.1| ATPase FliI/YscN family [Brucella sp. BO1]
          Length = 453

 Score =  431 bits (1109), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 217/418 (51%), Positives = 288/418 (68%), Gaps = 2/418 (0%)

Query: 23  GGYISSITSVYYTVTCLSQYVCLGDFV-VHQGKNSDNLGQVIRINLDIVYICPVGIGEEI 81
           GG +S ++     V  LS+   LGD V +  G+ + +L ++IR+    V + P       
Sbjct: 28  GGTVSDVSRSSIAVRGLSRDARLGDTVAIRAGEGAPSLAEIIRVADLQVLVKPFDDRIMP 87

Query: 82  SLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRV 141
           SLG  VF  G  RI P+  W GRVINALG  IDG  +L  G   M   S  P A+ R RV
Sbjct: 88  SLGAAVFEEGPLRIRPAPEWRGRVINALGNAIDGKGALKPGTRPMAAESLAPAALRRARV 147

Query: 142 EKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGRE 201
           ++G +TG+ VIDIFTPLC GQRIG+FAGSG+GKSTLL+M  R+  FD V+++L GERGRE
Sbjct: 148 DRGLRTGVNVIDIFTPLCFGQRIGIFAGSGVGKSTLLAMMTRAADFDTVVLALTGERGRE 207

Query: 202 VREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITR 261
           VRE +E+ +  +L K++ VVAT DESP++R++AP TA  IAEYF   G NVLLI+DS+TR
Sbjct: 208 VREMLEETMAGHLGKTITVVATGDESPMMRRLAPNTATAIAEYFRDLGQNVLLIVDSVTR 267

Query: 262 FAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEK-GNITAVISVLVDGDNH 320
           FAH+ RE+A  + E PVARGYP SVFS+LPRLLER GP   E  G+IT + SVLVDGD+H
Sbjct: 268 FAHAAREVAIAAEEPPVARGYPPSVFSQLPRLLERAGPGSAEAGGSITGIYSVLVDGDDH 327

Query: 321 NDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLI 380
           NDP++D++R  LDGHIVL+R++A +GR+P VD   SVSRLA   W+ +++KLV  L  ++
Sbjct: 328 NDPVSDTIRGTLDGHIVLDRAIAAQGRFPAVDIPVSVSRLAKHNWTPEQRKLVMQLRSMV 387

Query: 381 HRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
            RFEETRD+R IG Y+ G D +LD+AV  VP IY+ L+QSP    S+D + ++   L+
Sbjct: 388 ARFEETRDLRAIGAYQKGHDGLLDQAVDFVPRIYEALQQSPETGLSDDPYNDLAAALR 445


>gi|225628604|ref|ZP_03786638.1| ATPase FliI/YscN family protein [Brucella ceti str. Cudo]
 gi|254711395|ref|ZP_05173206.1| flagellum-specific ATP synthase [Brucella pinnipedialis B2/94]
 gi|254711994|ref|ZP_05173805.1| flagellum-specific ATP synthase [Brucella ceti M644/93/1]
 gi|254715064|ref|ZP_05176875.1| flagellum-specific ATP synthase [Brucella ceti M13/05/1]
 gi|256029975|ref|ZP_05443589.1| flagellum-specific ATP synthase [Brucella pinnipedialis M292/94/1]
 gi|256158140|ref|ZP_05456056.1| flagellum-specific ATP synthase [Brucella ceti M490/95/1]
 gi|256252909|ref|ZP_05458445.1| flagellum-specific ATP synthase [Brucella ceti B1/94]
 gi|261216771|ref|ZP_05931052.1| flagellum-specific ATP synthase [Brucella ceti M13/05/1]
 gi|261219998|ref|ZP_05934279.1| flagellum-specific ATP synthase [Brucella ceti B1/94]
 gi|261319001|ref|ZP_05958198.1| flagellum-specific ATP synthase [Brucella pinnipedialis B2/94]
 gi|261319638|ref|ZP_05958835.1| flagellum-specific ATP synthase [Brucella ceti M644/93/1]
 gi|265986996|ref|ZP_06099553.1| flagellum-specific ATP synthase [Brucella pinnipedialis M292/94/1]
 gi|265996657|ref|ZP_06109214.1| flagellum-specific ATP synthase [Brucella ceti M490/95/1]
 gi|225616450|gb|EEH13498.1| ATPase FliI/YscN family protein [Brucella ceti str. Cudo]
 gi|260918582|gb|EEX85235.1| flagellum-specific ATP synthase [Brucella ceti B1/94]
 gi|260921860|gb|EEX88428.1| flagellum-specific ATP synthase [Brucella ceti M13/05/1]
 gi|261292328|gb|EEX95824.1| flagellum-specific ATP synthase [Brucella ceti M644/93/1]
 gi|261298224|gb|EEY01721.1| flagellum-specific ATP synthase [Brucella pinnipedialis B2/94]
 gi|262550954|gb|EEZ07115.1| flagellum-specific ATP synthase [Brucella ceti M490/95/1]
 gi|264659193|gb|EEZ29454.1| flagellum-specific ATP synthase [Brucella pinnipedialis M292/94/1]
          Length = 453

 Score =  431 bits (1109), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 217/418 (51%), Positives = 289/418 (69%), Gaps = 2/418 (0%)

Query: 23  GGYISSITSVYYTVTCLSQYVCLGDFV-VHQGKNSDNLGQVIRINLDIVYICPVGIGEEI 81
           GG +S ++     V  LS+   LGD V +  G+ + +L ++IR+    V + P       
Sbjct: 28  GGTVSDVSRSSIAVRGLSRDARLGDTVAIRAGEGAPSLAEIIRVADLQVLVKPFDDRIMP 87

Query: 82  SLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRV 141
           SLG  VF  G  RI P+  W GRVINALG  IDG  +L  G   M   S  P A+ R RV
Sbjct: 88  SLGAAVFEEGPLRIRPAPEWRGRVINALGNAIDGKGALKPGTRPMAAESLAPAALRRARV 147

Query: 142 EKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGRE 201
           ++G +TG+ VIDIFTPLC GQRIG+FAGSG+GKSTLL+M  R+  FD V+++L GERGRE
Sbjct: 148 DRGLRTGVNVIDIFTPLCFGQRIGIFAGSGVGKSTLLAMMTRAADFDTVVLALTGERGRE 207

Query: 202 VREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITR 261
           VRE +E+ +  +L K++ VVAT DESP++R++AP TA  IAEYF   G NVLLI+DS+TR
Sbjct: 208 VREMLEETMAGHLGKTITVVATGDESPMMRRLAPNTATAIAEYFRDLGQNVLLIVDSVTR 267

Query: 262 FAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEK-GNITAVISVLVDGDNH 320
           FAH+ RE+A  + E PVARGYP SVFS+LPRLLER GP   E  G+IT + SVLVDGD+H
Sbjct: 268 FAHAAREVAIAAEEPPVARGYPPSVFSQLPRLLERAGPGSAEAGGSITGIYSVLVDGDDH 327

Query: 321 NDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLI 380
           NDP++D++R  LDGHIVL+R++A +GR+P VD  ASVSRLA   W+ +++KLV  L  ++
Sbjct: 328 NDPVSDTIRGTLDGHIVLDRAIAAQGRFPAVDIPASVSRLAKHNWTPEQRKLVMQLRSMV 387

Query: 381 HRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
            RFE+TRD+R IG Y+ G D +LD+AV  VP IY+ L+QSP    S+D + ++   L+
Sbjct: 388 ARFEKTRDLRAIGAYQKGHDGLLDQAVDFVPRIYEALQQSPETGLSDDPYNDLAAALR 445


>gi|256043053|ref|ZP_05445998.1| flagellum-specific ATP synthase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|260564284|ref|ZP_05834769.1| flagellum-specific ATP synthase [Brucella melitensis bv. 1 str.
           16M]
 gi|265989490|ref|ZP_06102047.1| flagellum-specific ATP synthase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|260151927|gb|EEW87020.1| flagellum-specific ATP synthase [Brucella melitensis bv. 1 str.
           16M]
 gi|263000159|gb|EEZ12849.1| flagellum-specific ATP synthase [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 453

 Score =  431 bits (1108), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 217/418 (51%), Positives = 288/418 (68%), Gaps = 2/418 (0%)

Query: 23  GGYISSITSVYYTVTCLSQYVCLGDFV-VHQGKNSDNLGQVIRINLDIVYICPVGIGEEI 81
           GG +S ++     V  LS+   LGD V +  G+ + +L ++IR+    V + P       
Sbjct: 28  GGTVSDVSRSSIAVRGLSRDARLGDTVAIRAGEGAPSLAEIIRVADLQVLVKPFDDRIMP 87

Query: 82  SLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRV 141
           SLG  VF  G  RI P+  W GRVINALG  IDG  +L  G   M   S  P A+ R RV
Sbjct: 88  SLGAAVFEEGPLRIRPAPEWRGRVINALGNAIDGKGALKPGTRPMAAESLAPAALRRARV 147

Query: 142 EKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGRE 201
           ++G +TG+ VIDIFTPLC GQR G+FAGSG+GKSTLL+M  R+  FD V+++L GERGRE
Sbjct: 148 DRGLRTGVNVIDIFTPLCFGQRTGIFAGSGVGKSTLLAMMTRAADFDTVVLALTGERGRE 207

Query: 202 VREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITR 261
           VRE +E+ +  +L K++ VVAT DESP++R++AP TA  IAEYF   G NVLLI+DS+TR
Sbjct: 208 VREMLEETMAGHLGKTITVVATGDESPMMRRLAPNTATAIAEYFRDLGQNVLLIVDSVTR 267

Query: 262 FAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEK-GNITAVISVLVDGDNH 320
           FAH+ RE+A  + E PVARGYP SVFS+LPRLLER GP   E  G+IT + SVLVDGD+H
Sbjct: 268 FAHAAREVAIAAEEPPVARGYPPSVFSQLPRLLERAGPGSAEAGGSITGIYSVLVDGDDH 327

Query: 321 NDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLI 380
           NDP++D++R  LDGHIVL+R++A +GR+P VD  ASVSRLA   W+ +++KLV  L  ++
Sbjct: 328 NDPVSDTIRGTLDGHIVLDRAIAAQGRFPAVDIPASVSRLAKHNWTPEQRKLVMQLRSMV 387

Query: 381 HRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
            RFEETRD+R IG Y+ G D +LD+AV  VP IY+ L+QSP    S+D + ++   L+
Sbjct: 388 ARFEETRDLRAIGAYQKGHDGLLDQAVDFVPRIYEALQQSPETGLSDDPYNDLAAALR 445


>gi|225685990|ref|YP_002733962.1| flagellum-specific ATP synthase [Brucella melitensis ATCC 23457]
 gi|256262884|ref|ZP_05465416.1| flagellum-specific ATP synthase [Brucella melitensis bv. 2 str.
           63/9]
 gi|225642095|gb|ACO02008.1| ATPase FliI/YscN family protein [Brucella melitensis ATCC 23457]
 gi|263092721|gb|EEZ16930.1| flagellum-specific ATP synthase [Brucella melitensis bv. 2 str.
           63/9]
 gi|326410316|gb|ADZ67380.1| flagellum-specific ATP synthase [Brucella melitensis M28]
 gi|326553609|gb|ADZ88248.1| flagellum-specific ATP synthase [Brucella melitensis M5-90]
          Length = 453

 Score =  431 bits (1108), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 217/418 (51%), Positives = 289/418 (69%), Gaps = 2/418 (0%)

Query: 23  GGYISSITSVYYTVTCLSQYVCLGDFV-VHQGKNSDNLGQVIRINLDIVYICPVGIGEEI 81
           GG +S ++     V  LS+   LGD V +  G+ + +L ++IR+    V + P       
Sbjct: 28  GGTVSDVSRSSIAVRGLSRDARLGDTVAIRAGEGAPSLAEIIRVADLQVLVKPFDDRIMP 87

Query: 82  SLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRV 141
           SLG  VF  G  RI P+  W GRVINALG  IDG  +L  G   M   S  P A+ R RV
Sbjct: 88  SLGAAVFEEGPLRIRPAPEWRGRVINALGNAIDGKGALKPGTRPMAAESLAPAALRRARV 147

Query: 142 EKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGRE 201
           ++G +TG+ VIDIFTPLC GQRIG+FAGSG+GKSTLL++  R+  FD V+++L GERGRE
Sbjct: 148 DRGLRTGVNVIDIFTPLCFGQRIGIFAGSGVGKSTLLAIMTRAADFDTVVLALTGERGRE 207

Query: 202 VREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITR 261
           VRE +E+ +  +L K++ VVAT DESP++R++AP TA  IAEYF   G NVLLI+DS+TR
Sbjct: 208 VREMLEETMAGHLGKTITVVATGDESPMMRRLAPNTATAIAEYFRDLGQNVLLIVDSVTR 267

Query: 262 FAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEK-GNITAVISVLVDGDNH 320
           FAH+ RE+A  + E PVARGYP SVFS+LPRLLER GP   E  G+IT + SVLVDGD+H
Sbjct: 268 FAHAAREVAIAAEEPPVARGYPPSVFSQLPRLLERAGPGSAEAGGSITGIYSVLVDGDDH 327

Query: 321 NDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLI 380
           NDP++D++R  LDGHIVL+R++A +GR+P VD  ASVSRLA   W+ +++KLV  L  ++
Sbjct: 328 NDPVSDTIRGTLDGHIVLDRAIAAQGRFPAVDIPASVSRLAKHNWTPEQRKLVMQLRSMV 387

Query: 381 HRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
            RFEETRD+R IG Y+ G D +LD+AV  VP IY+ L+QSP    S+D + ++   L+
Sbjct: 388 ARFEETRDLRAIGAYQKGHDGLLDQAVDFVPRIYEALQQSPETGLSDDPYNDLAAALR 445


>gi|294853153|ref|ZP_06793825.1| flagellar protein export ATPase FliI [Brucella sp. NVSL 07-0026]
 gi|294818808|gb|EFG35808.1| flagellar protein export ATPase FliI [Brucella sp. NVSL 07-0026]
          Length = 453

 Score =  431 bits (1107), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 217/418 (51%), Positives = 289/418 (69%), Gaps = 2/418 (0%)

Query: 23  GGYISSITSVYYTVTCLSQYVCLGDFV-VHQGKNSDNLGQVIRINLDIVYICPVGIGEEI 81
           GG +S ++     V  LS+   LGD V +  G+ + +L ++IR+    V + P       
Sbjct: 28  GGTVSDVSRSSIAVRGLSRDARLGDTVAIRAGEGAPSLAEIIRVADLQVLVKPFDDRIMP 87

Query: 82  SLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRV 141
           SLG  VF  G  RI P+  W GRVINALG  IDG  +L  G   M   S  P A+ R RV
Sbjct: 88  SLGAAVFEEGPLRIRPAPEWRGRVINALGNAIDGKGALKPGTRPMAAESLAPAALRRARV 147

Query: 142 EKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGRE 201
           ++G +TG+ VIDIFTPLC GQRIG+FAGSG+GKSTLL+M  R+  FD V+++L GERGRE
Sbjct: 148 DRGLRTGVNVIDIFTPLCFGQRIGIFAGSGVGKSTLLAMMTRAADFDTVVLALTGERGRE 207

Query: 202 VREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITR 261
           VRE +E+ +  +L K++ VVAT DESP++R++AP TA  IAEYF   G NVLLI+DS+TR
Sbjct: 208 VREMLEETMAGHLGKTITVVATGDESPMMRRLAPNTATAIAEYFRDLGQNVLLIVDSVTR 267

Query: 262 FAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEK-GNITAVISVLVDGDNH 320
           FAH+ RE+A  + E PVARGYP SVFS+LPRLLER GP   E  G+IT + SVLVDGD+H
Sbjct: 268 FAHAAREVAIAAEEPPVARGYPPSVFSQLPRLLERAGPGSAEAGGSITGIYSVLVDGDDH 327

Query: 321 NDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLI 380
           NDP++D++R  LDG+IVL+R++A +GR+P VD  ASVSRLA   W+ +++KLV  L  ++
Sbjct: 328 NDPVSDTIRGTLDGYIVLDRAIAAQGRFPAVDIPASVSRLAKHNWTPEQRKLVMQLRSMV 387

Query: 381 HRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
            RFEETRD+R IG Y+ G D +LD+AV  VP IY+ L+QSP    S+D + ++   L+
Sbjct: 388 ARFEETRDLRAIGAYQKGHDGLLDQAVDFVPRIYEALQQSPETGLSDDPYNDLAAALR 445


>gi|62317081|ref|YP_222934.1| flagellum-specific ATP synthase [Brucella abortus bv. 1 str. 9-941]
 gi|83269074|ref|YP_418365.1| flagellum-specific ATP synthase [Brucella melitensis biovar Abortus
           2308]
 gi|189022348|ref|YP_001932089.1| flagellum-specific ATP synthase [Brucella abortus S19]
 gi|237816643|ref|ZP_04595635.1| ATPase FliI/YscN family [Brucella abortus str. 2308 A]
 gi|254691430|ref|ZP_05154684.1| flagellum-specific ATP synthase [Brucella abortus bv. 6 str. 870]
 gi|254695271|ref|ZP_05157099.1| flagellum-specific ATP synthase [Brucella abortus bv. 3 str. Tulya]
 gi|254698370|ref|ZP_05160198.1| flagellum-specific ATP synthase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254731815|ref|ZP_05190393.1| flagellum-specific ATP synthase [Brucella abortus bv. 4 str. 292]
 gi|256256616|ref|ZP_05462152.1| flagellum-specific ATP synthase [Brucella abortus bv. 9 str. C68]
 gi|260544322|ref|ZP_05820143.1| flagellum-specific ATP synthase [Brucella abortus NCTC 8038]
 gi|260757048|ref|ZP_05869396.1| flagellum-specific ATP synthase [Brucella abortus bv. 6 str. 870]
 gi|260759581|ref|ZP_05871929.1| flagellum-specific ATP synthase [Brucella abortus bv. 4 str. 292]
 gi|260762825|ref|ZP_05875157.1| flagellum-specific ATP synthase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260882858|ref|ZP_05894472.1| flagellum-specific ATP synthase [Brucella abortus bv. 9 str. C68]
 gi|261215637|ref|ZP_05929918.1| flagellum-specific ATP synthase [Brucella abortus bv. 3 str. Tulya]
 gi|297249973|ref|ZP_06933674.1| flagellar protein export ATPase FliI [Brucella abortus bv. 5 str.
           B3196]
 gi|62197274|gb|AAX75573.1| flagellum-specific ATP synthase FliI [Brucella abortus bv. 1 str.
           9-941]
 gi|82939348|emb|CAJ12295.1| H+-transporting two-sector ATPase, alpha/beta subunit, central
           region:Disease resistance protein:ATP/GTP-binding site
           motif A [Brucella melitensis biovar Abortus 2308]
 gi|189020922|gb|ACD73643.1| flagellum-specific ATP synthase [Brucella abortus S19]
 gi|237787456|gb|EEP61672.1| ATPase FliI/YscN family [Brucella abortus str. 2308 A]
 gi|260097593|gb|EEW81467.1| flagellum-specific ATP synthase [Brucella abortus NCTC 8038]
 gi|260669899|gb|EEX56839.1| flagellum-specific ATP synthase [Brucella abortus bv. 4 str. 292]
 gi|260673246|gb|EEX60067.1| flagellum-specific ATP synthase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260677156|gb|EEX63977.1| flagellum-specific ATP synthase [Brucella abortus bv. 6 str. 870]
 gi|260872386|gb|EEX79455.1| flagellum-specific ATP synthase [Brucella abortus bv. 9 str. C68]
 gi|260917244|gb|EEX84105.1| flagellum-specific ATP synthase [Brucella abortus bv. 3 str. Tulya]
 gi|297173842|gb|EFH33206.1| flagellar protein export ATPase FliI [Brucella abortus bv. 5 str.
           B3196]
          Length = 453

 Score =  431 bits (1107), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 217/418 (51%), Positives = 288/418 (68%), Gaps = 2/418 (0%)

Query: 23  GGYISSITSVYYTVTCLSQYVCLGDFV-VHQGKNSDNLGQVIRINLDIVYICPVGIGEEI 81
           GG +S ++     V  LS+   LGD V +  G+ + +L ++IR+    V + P       
Sbjct: 28  GGTVSDVSRSSIAVRGLSRDARLGDTVAIRAGEGAPSLAEIIRVADLQVLVKPFDDRIMP 87

Query: 82  SLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRV 141
           SLG  VF  G  RI P+  W GRVINALG  IDG  +L  G   M   S  P A+ R RV
Sbjct: 88  SLGAAVFEEGPLRIRPAPEWRGRVINALGNAIDGKGALKPGTRPMAAESLAPAALRRARV 147

Query: 142 EKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGRE 201
           ++G +TG+ VIDIFTPLC GQRIG+FAGSG+GKSTLL+M  R+  FD V+++L GERGRE
Sbjct: 148 DRGLRTGVNVIDIFTPLCFGQRIGIFAGSGVGKSTLLAMMTRAADFDTVVLALTGERGRE 207

Query: 202 VREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITR 261
           VRE +E+ +  +L K++ VVAT DESP++R++AP TA  IAEYF   G NVLLI+DS+TR
Sbjct: 208 VREMLEETMAGHLGKTITVVATGDESPMMRRLAPNTATAIAEYFRDLGQNVLLIVDSVTR 267

Query: 262 FAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEK-GNITAVISVLVDGDNH 320
           FAH+ RE+A  + E PVARGYP SVFS+LPRLLER GP   E  G+IT + SVLVDGD+H
Sbjct: 268 FAHAAREVAIAAEEPPVARGYPPSVFSQLPRLLERAGPGSAEAGGSITGIYSVLVDGDDH 327

Query: 321 NDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLI 380
           NDP++D++R  LDGHIVL+R++A +GR+P VD  ASVSRLA   W+ +++KLV  L  ++
Sbjct: 328 NDPVSDTIRGTLDGHIVLDRAIAAQGRFPAVDIPASVSRLAKHNWTPEQRKLVMQLRSMV 387

Query: 381 HRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
            RFEETRD+R IG Y+   D +LD+AV  VP IY+ L+QSP    S+D + ++   L+
Sbjct: 388 ARFEETRDLRAIGAYQKSHDGLLDQAVDFVPRIYEALQQSPETGLSDDPYNDLAAALR 445


>gi|148558082|ref|YP_001257195.1| flagellum-specific ATP synthase [Brucella ovis ATCC 25840]
 gi|148369367|gb|ABQ62239.1| flagellum-specific ATP synthase [Brucella ovis ATCC 25840]
          Length = 453

 Score =  430 bits (1106), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 217/418 (51%), Positives = 288/418 (68%), Gaps = 2/418 (0%)

Query: 23  GGYISSITSVYYTVTCLSQYVCLGDFV-VHQGKNSDNLGQVIRINLDIVYICPVGIGEEI 81
           GG +S ++     V  LS+   LGD V +  G+ + +L ++IR+    V + P       
Sbjct: 28  GGTVSDVSRSSIAVRGLSRDARLGDMVAIRAGEGAPSLAEIIRVADLQVLVKPFDDRIMP 87

Query: 82  SLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRV 141
           SLG  VF  G  RI P+  W GRVINALG  IDG  +L  G   M   S  P A+ R RV
Sbjct: 88  SLGAAVFEEGPLRIRPAPEWRGRVINALGNAIDGKGALKPGTRPMAAESLAPAALRRARV 147

Query: 142 EKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGRE 201
           ++G +TG+ VIDIFTPLC GQRIG+FAGSG+GKSTLL+M  R+  FD V+++L GERGRE
Sbjct: 148 DRGLRTGVNVIDIFTPLCFGQRIGIFAGSGVGKSTLLAMMTRAADFDTVVLALTGERGRE 207

Query: 202 VREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITR 261
           VRE +E+ +  +L K++ VVAT DESP++R++AP TA  IAEYF   G NVLLI+DS+TR
Sbjct: 208 VREMLEETMAGHLGKTITVVATGDESPMMRRLAPNTATAIAEYFRDLGQNVLLIVDSVTR 267

Query: 262 FAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEK-GNITAVISVLVDGDNH 320
           FAH+ RE+A  + E PVARGY  SVFS+LPRLLER GP   E  G+IT + SVLVDGD+H
Sbjct: 268 FAHAAREVAIAAEEPPVARGYTPSVFSQLPRLLERAGPGSAEAGGSITGIYSVLVDGDDH 327

Query: 321 NDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLI 380
           NDP++D++R  LDGHIVL+R++A +GR+P VD  ASVSRLA   W+ +++KLV  L  ++
Sbjct: 328 NDPVSDTIRGTLDGHIVLDRAIAAQGRFPAVDIPASVSRLAKHNWTPEQRKLVMQLRSMV 387

Query: 381 HRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
            RFEETRD+R IG Y+ G D +LD+AV  VP IY+ L+QSP    S+D + ++   L+
Sbjct: 388 ARFEETRDLRAIGAYQKGHDGLLDQAVDFVPRIYEALQQSPETGLSDDPYNDLAAALR 445


>gi|254473365|ref|ZP_05086762.1| flagellum-specific ATP synthase protein [Pseudovibrio sp. JE062]
 gi|211957481|gb|EEA92684.1| flagellum-specific ATP synthase protein [Pseudovibrio sp. JE062]
          Length = 386

 Score =  430 bits (1106), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 204/384 (53%), Positives = 278/384 (72%)

Query: 54  KNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPI 113
            N +  G+VIRI  D V + P     ++ LG  V   G     P   W GR+INA G PI
Sbjct: 3   NNGEEFGEVIRIEPDSVLVKPYASRSDLGLGIKVKRCGELSFYPDNSWRGRIINAFGHPI 62

Query: 114 DGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIG 173
           DG  S+ +G       +  PP ++R RV+    TG+RV+D+FTP+CHGQR+G+FAGSG+G
Sbjct: 63  DGLGSMAEGPTLASFNNLPPPPVHRARVKDAALTGVRVLDLFTPICHGQRLGIFAGSGVG 122

Query: 174 KSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKM 233
           KSTLLSM ARS+ FD V+I L+GERGREVREF+E+ LGD L KSVVVVAT DESP++R++
Sbjct: 123 KSTLLSMIARSNSFDTVVIGLIGERGREVREFVEETLGDQLSKSVVVVATGDESPMMRRL 182

Query: 234 APLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRL 293
           AP TA+T+AE+F  +G +VLLI+DS+TR+AH++R++A  +GE  ++RGYP SVFSELP L
Sbjct: 183 APKTAMTVAEHFRDQGQSVLLIVDSVTRYAHALRDVALAAGEPALSRGYPPSVFSELPLL 242

Query: 294 LERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDP 353
           LER GP  +  G +TA+ SVLVDGD+HNDP+AD++R +LDGH+VL+R +AEEGRYP V+ 
Sbjct: 243 LERAGPGIEGSGMMTAIFSVLVDGDDHNDPVADNIRGLLDGHVVLDRHIAEEGRYPAVNV 302

Query: 354 LASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPII 413
           L S+SRLA   WS  E++L++ L  +I +FE+T+D+R++GGY+ GVD +LD+A+   P I
Sbjct: 303 LGSISRLAQSCWSPQERELITKLKAMIAKFEDTKDLRMMGGYKEGVDPLLDQAIEIAPKI 362

Query: 414 YDFLKQSPSDLSSEDVFQEITKKL 437
           Y  L Q     SS+D F E+ + L
Sbjct: 363 YSALVQGLDAPSSQDAFNELAQLL 386


>gi|254720628|ref|ZP_05182439.1| flagellum-specific ATP synthase [Brucella sp. 83/13]
 gi|265985672|ref|ZP_06098407.1| flagellum-specific ATP synthase [Brucella sp. 83/13]
 gi|306837352|ref|ZP_07470231.1| ATPase FliI/YscN family [Brucella sp. NF 2653]
 gi|264664264|gb|EEZ34525.1| flagellum-specific ATP synthase [Brucella sp. 83/13]
 gi|306407544|gb|EFM63744.1| ATPase FliI/YscN family [Brucella sp. NF 2653]
          Length = 453

 Score =  430 bits (1106), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 218/418 (52%), Positives = 289/418 (69%), Gaps = 2/418 (0%)

Query: 23  GGYISSITSVYYTVTCLSQYVCLGDFV-VHQGKNSDNLGQVIRINLDIVYICPVGIGEEI 81
           GG +S ++     V  LS+   LGD V +  G+ + +L ++IR+    V + P       
Sbjct: 28  GGTVSDVSRSSIAVRGLSRDARLGDTVAIRAGEGAPSLAEIIRVADLQVLVKPFDDRIMP 87

Query: 82  SLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRV 141
           SLG  VF  G  RI P+  W GRVINALG  IDG  +L  G   M   S  P A+ R RV
Sbjct: 88  SLGAAVFEEGPLRIRPAPEWRGRVINALGNAIDGKGALKPGTRPMAAESLAPAALCRARV 147

Query: 142 EKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGRE 201
           ++G +TG+ VIDIFTPLC GQRIG+FAGSG+GKSTLL+M  R+  FD V+++L GERGRE
Sbjct: 148 DRGLRTGVNVIDIFTPLCFGQRIGIFAGSGVGKSTLLAMMTRAADFDTVVLALTGERGRE 207

Query: 202 VREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITR 261
           VRE +E+ +  +L K++ VVAT DESP++R++AP TA  IAEYF   G NVLLI+DS+TR
Sbjct: 208 VREMLEETMVGHLGKTITVVATGDESPVMRRLAPNTATAIAEYFRDLGQNVLLIVDSVTR 267

Query: 262 FAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEK-GNITAVISVLVDGDNH 320
           FAH+ RE+A  + E PVARGYP SVFS+LPRLLER GP   E  G+IT + SVLVDGD+H
Sbjct: 268 FAHAAREVAIAAEEPPVARGYPPSVFSQLPRLLERAGPGSAEAGGSITGIYSVLVDGDDH 327

Query: 321 NDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLI 380
           NDP++D++R  LDGHIVL+R++A +GR+P VD  ASVSRLA   W+ +++KLV  L  ++
Sbjct: 328 NDPVSDTIRGTLDGHIVLDRAIAAQGRFPAVDIPASVSRLAKHNWTPEQRKLVMQLRSIV 387

Query: 381 HRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
            RFEETRD+R IG Y+ G D +LD+AV  VP IY+ L+QSP    S+D + ++   L+
Sbjct: 388 ARFEETRDLRAIGAYQKGHDGLLDQAVDFVPRIYEALQQSPETGLSDDPYNDLAAALR 445


>gi|240137256|ref|YP_002961725.1| flagellum-specific ATP synthase [Methylobacterium extorquens AM1]
 gi|240007222|gb|ACS38448.1| flagellum-specific ATP synthase [Methylobacterium extorquens AM1]
          Length = 442

 Score =  430 bits (1106), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 207/420 (49%), Positives = 287/420 (68%)

Query: 19  LVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIG 78
           LV   G +  +T+    V  +S +V LGD +         +G+V+RI+     + P    
Sbjct: 22  LVRVAGPVREVTASAARVAGVSAFVRLGDRMGFSADGRTQVGEVVRIDAAGATVKPFESR 81

Query: 79  EEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNR 138
            E  +G L    G  ++ P   W GRVI+ALG+PIDG   L +G  S+ + +  P AM R
Sbjct: 82  IEAGIGSLAHRIGPAQLRPDPRWKGRVIDALGRPIDGLGPLAEGPASVPLDADPPAAMTR 141

Query: 139 QRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGER 198
            RV+    TG+R ID+FTPLC GQRIG+FAGSG+GKSTLL+M A +  FD V+++LVGER
Sbjct: 142 ARVKTPLPTGVRAIDLFTPLCAGQRIGIFAGSGVGKSTLLAMLAGAQGFDSVVVALVGER 201

Query: 199 GREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDS 258
           GREVREF+E  +     ++V+VV+T DESP++R+ AP  A+ +AE F  +G++VLLI+DS
Sbjct: 202 GREVREFLEGPIAAARDRAVIVVSTGDESPMMRRQAPKVALAVAESFRDRGESVLLIVDS 261

Query: 259 ITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGD 318
           +TR+AH+ R++A  +GE  VARGYP SVFS+LPRLLER GP  +  G IT + SVLVDGD
Sbjct: 262 VTRYAHAARDVALAAGEPAVARGYPPSVFSDLPRLLERAGPGAEGTGTITGIFSVLVDGD 321

Query: 319 NHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTH 378
           +HNDP+ADS+R  LDGH+VL+R++AE+GRYP ++ L S+SRLA + W+ D+++LV  L  
Sbjct: 322 DHNDPVADSIRGTLDGHVVLDRAIAEQGRYPAIELLGSISRLAGEVWTGDQRELVRKLKS 381

Query: 379 LIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
           ++ RFEETRD+RL+GGYR G D  LD+AV  VP IY+ L+Q P    S D F E+ + L+
Sbjct: 382 MMARFEETRDLRLMGGYRAGSDPDLDQAVSLVPRIYEALRQEPGQPPSRDAFLELAQSLR 441


>gi|163850122|ref|YP_001638165.1| flagellum-specific ATP synthase [Methylobacterium extorquens PA1]
 gi|163661727|gb|ABY29094.1| ATPase, FliI/YscN family [Methylobacterium extorquens PA1]
          Length = 442

 Score =  430 bits (1106), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 206/420 (49%), Positives = 287/420 (68%)

Query: 19  LVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIG 78
           LV   G +  +T+    V  +S +V LGD +         +G+V+RI+     + P    
Sbjct: 22  LVRVAGPVREVTASAARVAGVSAFVRLGDRMGFSADGRTQVGEVVRIDAAGATVKPFESR 81

Query: 79  EEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNR 138
            E  +G L    G  ++ P   W GRVI+ALG+P+DG   L +G  S+ + +  P AM R
Sbjct: 82  IEAGIGSLAHRIGPAQLRPDPRWKGRVIDALGRPVDGLGPLAEGPASVPLDADPPAAMTR 141

Query: 139 QRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGER 198
            RV+    TG+R ID+FTPLC GQRIG+FAGSG+GKSTLL+M A +  FD V+++LVGER
Sbjct: 142 ARVKTPLPTGVRAIDLFTPLCAGQRIGIFAGSGVGKSTLLAMLAGAQGFDSVVVALVGER 201

Query: 199 GREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDS 258
           GREVREF+E  +     ++V+VV+T DESP++R+ AP  A+ +AE F  +G++VLLI+DS
Sbjct: 202 GREVREFLEGPIAAARDRAVIVVSTGDESPMMRRQAPKVALAVAESFRDRGESVLLIVDS 261

Query: 259 ITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGD 318
           +TR+AH+ R++A  +GE  VARGYP SVFS+LPRLLER GP  +  G IT + SVLVDGD
Sbjct: 262 VTRYAHAARDVALAAGEPAVARGYPPSVFSDLPRLLERAGPGAEGTGTITGIFSVLVDGD 321

Query: 319 NHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTH 378
           +HNDP+ADS+R  LDGH+VL+R++AE+GRYP ++ L S+SRLA + W+ D+++LV  L  
Sbjct: 322 DHNDPVADSIRGTLDGHVVLDRAIAEQGRYPAIELLGSISRLAGEVWTGDQRELVRKLKS 381

Query: 379 LIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
           ++ RFEETRD+RL+GGYR G D  LD+AV  VP IY+ L+Q P    S D F E+ + L+
Sbjct: 382 MMARFEETRDLRLMGGYRAGSDPDLDQAVSLVPRIYEALRQEPGQPPSRDAFLELAQSLR 441


>gi|296447448|ref|ZP_06889373.1| ATPase, FliI/YscN family [Methylosinus trichosporium OB3b]
 gi|296255068|gb|EFH02170.1| ATPase, FliI/YscN family [Methylosinus trichosporium OB3b]
          Length = 446

 Score =  430 bits (1105), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 210/424 (49%), Positives = 289/424 (68%), Gaps = 1/424 (0%)

Query: 16  SKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPV 75
           +K+L    G ++ + + +  V  LS +V LG+ V       + LGQV+++  D   +   
Sbjct: 17  NKDLARVSGLVTEVAASHCRVLGLSDFVELGECVRFGAPTDERLGQVVKVAKDGAIVKCF 76

Query: 76  GIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPA 135
                I L    F  G   I+P   W GRV++A G+P+D   ++ +GD S+++ +  P A
Sbjct: 77  DDRARIGLNTPAFRAGPIEIAPHPDWIGRVLDAFGRPVDDRGAVSRGDASLQVDASAPLA 136

Query: 136 MNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLV 195
           M R RV    +TG++ +D FTP+C GQRIGVFAGSG+GKSTLL M AR+  FD  ++ LV
Sbjct: 137 MRRARVTTPVRTGVKAVDCFTPICAGQRIGVFAGSGVGKSTLLGMLARAPGFDLAVVCLV 196

Query: 196 GERGREVREFIEDYL-GDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLL 254
           GERGREVREF+E+ L G + + S+ +VAT DESP++R++APLTA T+AEYF   G NVLL
Sbjct: 197 GERGREVREFLEEALAGAHARDSITIVATGDESPMMRRLAPLTATTVAEYFRDCGRNVLL 256

Query: 255 ILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVL 314
           I+DS+TRFAH+ RE+A  +GE PVA GY  SVF+++PRLLER GP E+ KG IT V SVL
Sbjct: 257 IVDSVTRFAHASREVALAAGEPPVAHGYTPSVFADIPRLLERAGPGEEGKGTITGVFSVL 316

Query: 315 VDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVS 374
           VDGDNHNDPIAD VR  LDGHIVL+R++AE+GRYP +D   S+SRLA  AW  +++ L+ 
Sbjct: 317 VDGDNHNDPIADCVRGTLDGHIVLDRAIAEQGRYPAIDLKTSISRLAHHAWRPEQRHLIQ 376

Query: 375 SLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEIT 434
            L  L+ RFE+TRD+R++GGY+ G D  LD++V  VP +Y+ + QSP    S D F+E+ 
Sbjct: 377 KLRALVSRFEDTRDLRMLGGYQKGSDPELDQSVLLVPKLYEAVCQSPQSPPSMDPFREVA 436

Query: 435 KKLQ 438
            +LQ
Sbjct: 437 DRLQ 440


>gi|254504837|ref|ZP_05116988.1| ATPase FliI/YscN family [Labrenzia alexandrii DFL-11]
 gi|222440908|gb|EEE47587.1| ATPase FliI/YscN family [Labrenzia alexandrii DFL-11]
          Length = 448

 Score =  425 bits (1093), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 205/414 (49%), Positives = 288/414 (69%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISL 83
           G ++ +++    V+ LS+ VCLGD +  +G++    G++IR+    V + P+    +I +
Sbjct: 31  GQVTQVSAEAIRVSGLSRVVCLGDLIQFEGRSGVRQGEIIRLEQKDVVVKPLERVSDIGI 90

Query: 84  GDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEK 143
           G +    G   I P   W GR+INALG+PIDG   L  G  +  +    PPAMNR++V +
Sbjct: 91  GSVASLMGGLAIHPDLSWRGRIINALGEPIDGQGQLRHGVEAFLLDRAPPPAMNREKVTE 150

Query: 144 GFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVR 203
           G +TG+RVID+FTPLC GQRIGVFAGSG+GKSTLL M A    FD V++ LVGERGREVR
Sbjct: 151 GVRTGVRVIDLFTPLCVGQRIGVFAGSGVGKSTLLGMLAGFGEFDTVVVGLVGERGREVR 210

Query: 204 EFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFA 263
           EFI+D LG+ +  SVVV +T DES + R++AP TA+++AEYF ++G  VLLILDS TRFA
Sbjct: 211 EFIDDILGETIANSVVVASTGDESAMQRRLAPKTAMSVAEYFRAQGHKVLLILDSATRFA 270

Query: 264 HSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDP 323
           H+ R++A  +GE PVARGYP SVF++L RL+ER GP    +G+IT + SVLVDGD+HNDP
Sbjct: 271 HAARDVALAAGEPPVARGYPPSVFADLARLIERAGPGASGEGSITGIFSVLVDGDDHNDP 330

Query: 324 IADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRF 383
           ++D++R +LDGHIVL+R  AE GRYPPV+ L S SRLA +AW+ D+++L+  +  LI  +
Sbjct: 331 VSDAIRGLLDGHIVLDRKTAESGRYPPVEILKSTSRLASRAWTEDQQELIHRIKGLISHY 390

Query: 384 EETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKL 437
           E+T+D+R++GG++   D  L+KA   VP IY+ ++Q        D F E+ + L
Sbjct: 391 EDTKDLRMMGGFQITGDEHLEKACRLVPRIYEAMRQGAKQPVPGDPFAELAQAL 444


>gi|118589941|ref|ZP_01547345.1| flagellum-specific ATP synthase [Stappia aggregata IAM 12614]
 gi|118437438|gb|EAV44075.1| flagellum-specific ATP synthase [Stappia aggregata IAM 12614]
          Length = 448

 Score =  424 bits (1091), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 205/407 (50%), Positives = 285/407 (70%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISL 83
           G ++ ++S    V+ LS+ VCLGD V  +G++    G++IR++   V I P+    +I +
Sbjct: 31  GRVTQVSSESIRVSGLSRVVCLGDLVQFEGRSGVRQGEIIRLDQKDVVIKPLERVTDIGI 90

Query: 84  GDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEK 143
           G +    G   I P   W GR++NALG+PIDG   L  G  +  +    PPAMNR ++ +
Sbjct: 91  GSVASVMGGLAIHPDMSWRGRIVNALGEPIDGAGPLAHGVEAFLLDRAPPPAMNRSKISE 150

Query: 144 GFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVR 203
           G +TG+RVID+FTPLC GQR+GVFAGSG+GKSTLL M A    FD V++ LVGERGREVR
Sbjct: 151 GVRTGVRVIDLFTPLCVGQRVGVFAGSGVGKSTLLGMLAGFGDFDTVVVGLVGERGREVR 210

Query: 204 EFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFA 263
           EFI+D LG+ L  SVVV +T DES + R++AP TA+++AEYF ++G  VLLILDS TRFA
Sbjct: 211 EFIDDILGETLAHSVVVASTGDESAMQRRLAPKTAMSVAEYFRAQGHKVLLILDSATRFA 270

Query: 264 HSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDP 323
           H+ R++A  +GE PVARG+P SVF++L RL+ER GP    +G+IT + SVLVDGD+HNDP
Sbjct: 271 HAARDVALAAGEPPVARGFPPSVFADLARLIERAGPGSSGEGSITGIFSVLVDGDDHNDP 330

Query: 324 IADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRF 383
           ++D++R +LDGHIVL+R +AE G YPPV  L S SRLAD+AW+ D++ L+  +  LI  +
Sbjct: 331 VSDAIRGLLDGHIVLDRQIAESGHYPPVSVLKSTSRLADRAWTQDQQDLIHRIKGLISYY 390

Query: 384 EETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVF 430
           E+T+D+RL+GG++   D  L+KA   VP IY+ L+Q    ++  D F
Sbjct: 391 EDTKDLRLMGGFQTAGDEKLEKACRLVPRIYEALRQRSDQVAPSDPF 437


>gi|306841067|ref|ZP_07473790.1| ATPase FliI/YscN family [Brucella sp. BO2]
 gi|306288905|gb|EFM60208.1| ATPase FliI/YscN family [Brucella sp. BO2]
          Length = 413

 Score =  424 bits (1090), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 213/402 (52%), Positives = 281/402 (69%), Gaps = 2/402 (0%)

Query: 39  LSQYVCLGDFV-VHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISP 97
           LS+   LGD V +  G+ + +L ++IR+    V + P       SLG  VF  G  RI P
Sbjct: 4   LSRDARLGDTVAIRAGEGAPSLAEIIRVADLQVLVKPFDDRIMPSLGAAVFEEGPLRIRP 63

Query: 98  SACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTP 157
           +  W GRVINALG  IDG  +L  G   M   S  P A+ R RV++G +TG+ VIDIFTP
Sbjct: 64  TPEWRGRVINALGNAIDGKGALKPGTRPMAAESLAPAALRRARVDRGLRTGVNVIDIFTP 123

Query: 158 LCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKS 217
           LC GQRIG+FAGSG+GKSTLL+M  R+  FD V+++L GERGREVRE +E+ +  +L K+
Sbjct: 124 LCFGQRIGIFAGSGVGKSTLLAMMTRAADFDTVVLALTGERGREVREMLEETMAGHLGKT 183

Query: 218 VVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELP 277
           + VVAT DESP++R++AP TA  IAEYF   G NVLLI+DS+TRFAH+ RE+A  + E P
Sbjct: 184 ITVVATGDESPMMRRLAPNTATAIAEYFRDLGQNVLLIVDSVTRFAHAAREVAIAAEEPP 243

Query: 278 VARGYPTSVFSELPRLLERIGPSEKEK-GNITAVISVLVDGDNHNDPIADSVRSILDGHI 336
           VARGYP SVFS+LPRLLER GP   E  G+IT + SVLVDGD+HNDP++D++R  LDGHI
Sbjct: 244 VARGYPPSVFSQLPRLLERAGPGSAEAGGSITGIYSVLVDGDDHNDPVSDTIRGTLDGHI 303

Query: 337 VLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYR 396
           VL+R++A +GR+P VD   SVSRLA   W+ +++KLV  L  ++ RFEETRD+R IG Y+
Sbjct: 304 VLDRAIAAQGRFPAVDIPGSVSRLAKHNWTPEQRKLVMQLRSMVARFEETRDLRAIGAYQ 363

Query: 397 PGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
            G D +LD+AV  VP IY+ L+QSP    S+D + ++   L+
Sbjct: 364 KGHDGLLDQAVDFVPRIYEALQQSPETGLSDDPYNDLAAALR 405


>gi|323136552|ref|ZP_08071633.1| ATPase, FliI/YscN family [Methylocystis sp. ATCC 49242]
 gi|322397869|gb|EFY00390.1| ATPase, FliI/YscN family [Methylocystis sp. ATCC 49242]
          Length = 447

 Score =  424 bits (1089), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 211/434 (48%), Positives = 291/434 (67%), Gaps = 5/434 (1%)

Query: 1   MQKNLETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLG 60
           ++K ++  AQ      K+ V   G ++     ++ V  LS ++ L D V+ +G +     
Sbjct: 9   LRKAVDLYAQ-----EKDWVRIRGVVTEAFPSHFRVEGLSPFLRLDDCVMLEGHDRCFPA 63

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLG 120
           Q IRIN D   I        + LG  V   G F I+P   W GRV+NA   PID  +   
Sbjct: 64  QAIRINRDGALIKAFESHAGVGLGARVTRTGPFEIAPHPDWKGRVLNAFAAPIDRREPPP 123

Query: 121 KGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSM 180
            G+    + +  P AM+R RV     TG+RV+D FTPLC GQR+GVFAGSG+GKSTLL+M
Sbjct: 124 PGEARRAVDASPPKAMSRGRVRDPAPTGVRVVDAFTPLCRGQRVGVFAGSGVGKSTLLAM 183

Query: 181 FARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVT 240
            +RS  FD V+I LVGERGREVR+F+++ LGD    ++ +VAT DESP++R++APLTA +
Sbjct: 184 MSRSAAFDAVVICLVGERGREVRDFLDEILGDRSNLAITIVATGDESPMMRRLAPLTATS 243

Query: 241 IAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPS 300
           IAEYF  +G++VLLI+DS+TR+AH++REIA ++GE PVA G+  SVF++LPRLLER GP 
Sbjct: 244 IAEYFRDRGESVLLIMDSVTRYAHALREIALSAGEPPVANGFAPSVFADLPRLLERAGPG 303

Query: 301 EKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRL 360
            +  G ITA+ SVL+DGDNHNDPIAD +R  LDGHIVL R +AE+GRYP ++ L S+SRL
Sbjct: 304 VEGGGAITAIFSVLIDGDNHNDPIADCIRGTLDGHIVLEREIAEQGRYPAINVLKSISRL 363

Query: 361 ADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQS 420
           AD+ WS +++ L++    LI ++E+TRD+R++GGY+PG D  LD+A+   P +Y+ LKQS
Sbjct: 364 ADRVWSGEQRDLINECRALISKYEDTRDLRMLGGYQPGADAALDRAIELAPRLYEALKQS 423

Query: 421 PSDLSSEDVFQEIT 434
           P    S D   EI 
Sbjct: 424 PHGEPSIDAIGEIA 437


>gi|170748126|ref|YP_001754386.1| flagellum-specific ATP synthase [Methylobacterium radiotolerans JCM
           2831]
 gi|170654648|gb|ACB23703.1| ATPase, FliI/YscN family [Methylobacterium radiotolerans JCM 2831]
          Length = 439

 Score =  422 bits (1086), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 211/430 (49%), Positives = 285/430 (66%)

Query: 9   AQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLD 68
           A L       L+  GG +  I + +  +      + LGD +  +    +  G+V+RI+ D
Sbjct: 9   AMLGRRDDPPLIRIGGSVREIGAGHCRIRIAVPLLRLGDRMRIEAAGREIDGEVVRIDED 68

Query: 69  IVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEI 128
            V + P     E  LG   +        P   W  RV+NALG PIDG   L  G  +M +
Sbjct: 69  GVILKPFEGRIEAGLGAPAYRVPTSGARPCEAWKDRVVNALGTPIDGKGDLPTGTRAMPL 128

Query: 129 MSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFD 188
            +  PPAM R RV+   +TG+R +D+FTPLC  QRIG+FAGSG+GK+TLLSM AR   FD
Sbjct: 129 DADPPPAMARSRVDSPLRTGVRAMDLFTPLCAAQRIGIFAGSGVGKTTLLSMLARCSGFD 188

Query: 189 KVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSK 248
            V+++LVGERGREVREF+E  + ++  ++VVVVAT DESP++R+ AP  A  +AEYF  +
Sbjct: 189 AVVVALVGERGREVREFLEGPMRESRSRAVVVVATGDESPMMRRQAPKLAFAVAEYFRDQ 248

Query: 249 GDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNIT 308
           G +VLL+LDS+TRFAH+ RE+A  +GE PVARGYP SVF +LPRLLER GP     G IT
Sbjct: 249 GQSVLLVLDSVTRFAHAAREVALAAGEPPVARGYPPSVFGDLPRLLERAGPGLDGGGAIT 308

Query: 309 AVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSAD 368
            + SVLVDGD+HNDP+ADS+R  LDGHIVL+R++A++GRYP +D L S+SRLAD+ W+  
Sbjct: 309 GLFSVLVDGDDHNDPVADSIRGTLDGHIVLDRAIADQGRYPAIDVLGSISRLADRVWTEQ 368

Query: 369 EKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSED 428
           +++LV  L  LI R+E++RD+RL+GGY  G D  LD+AV  VP IYD L+Q P+D  S D
Sbjct: 369 QRQLVRMLKSLIARYEDSRDLRLMGGYHVGADPELDQAVALVPKIYDALRQDPTDPQSLD 428

Query: 429 VFQEITKKLQ 438
            F ++   L+
Sbjct: 429 AFLDLATALR 438


>gi|114706757|ref|ZP_01439657.1| flagellum-specific ATP synthase [Fulvimarina pelagi HTCC2506]
 gi|114537705|gb|EAU40829.1| flagellum-specific ATP synthase [Fulvimarina pelagi HTCC2506]
          Length = 446

 Score =  420 bits (1080), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 205/415 (49%), Positives = 286/415 (68%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISL 83
           G I  +    + V  LS +V LGD +   G++ D LG+V+RI+ D + + P        +
Sbjct: 20  GRIVDVGPQSFRVAGLSPFVRLGDCISCPGEDRDELGEVVRIDADSLTVKPYTTRFNRGV 79

Query: 84  GDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEK 143
           G      G F I+P A W GRV++A  +P D    + +G+    + ++   A+ R R+ +
Sbjct: 80  GSPAIKVGPFSITPDASWRGRVLDAFCRPQDDKGPVRQGEAIRPVDAQPLSALKRARLSE 139

Query: 144 GFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVR 203
           G  TG+ V+DIFTPL  GQRIGVFAGSG+GKSTL+ M ++S  FD VI++LVGERGREVR
Sbjct: 140 GVPTGVSVVDIFTPLVKGQRIGVFAGSGVGKSTLMGMLSQSKGFDTVIVALVGERGREVR 199

Query: 204 EFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFA 263
           EF+E+ +   L K V +VAT DESP++R++AP TA  +AE+F  +GD+VLLI+DS+TR+A
Sbjct: 200 EFLEEVMAGQLDKVVTIVATGDESPMMRRLAPRTATAVAEHFRDRGDDVLLIVDSVTRYA 259

Query: 264 HSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDP 323
           H+ R++A ++GE PV+RGYP S+FSELP+LLER G   +  G IT + +VLVDGD+HNDP
Sbjct: 260 HAARDVALSAGEPPVSRGYPPSIFSELPQLLERAGTGIEGSGTITGIYAVLVDGDDHNDP 319

Query: 324 IADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRF 383
           IAD++R  LDGHIVL+R +AE+GR+P VD L S+SRLA+KAW   E++LV+ L  +  RF
Sbjct: 320 IADAIRGTLDGHIVLDREIAEQGRFPAVDYLKSISRLAEKAWHGSERELVTRLRAMTSRF 379

Query: 384 EETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
           E+TRD+RL+GGY+ G D  LD+AV  VP IYDFL Q P +   E  F  ++  L+
Sbjct: 380 EDTRDLRLLGGYQRGSDQTLDQAVDLVPHIYDFLTQRPGEGWHEKPFDALSAALK 434


>gi|312115281|ref|YP_004012877.1| ATPase, FliI/YscN family [Rhodomicrobium vannielii ATCC 17100]
 gi|311220410|gb|ADP71778.1| ATPase, FliI/YscN family [Rhodomicrobium vannielii ATCC 17100]
          Length = 459

 Score =  420 bits (1080), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 214/433 (49%), Positives = 290/433 (66%), Gaps = 3/433 (0%)

Query: 5   LETLAQLAED-YSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVI 63
           LETLA+  E      L +  G +  +++ +  V  LS+Y  LGD+V       D + + +
Sbjct: 22  LETLAETFEAALDDRLAIVSGRVVELSTEHIRVEGLSKYTKLGDWVSIATDVGDAIAETL 81

Query: 64  RINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGD 123
           R+  D + +  +    +  LG  V      ++ P   W GRVI+ALG+PID    L +G 
Sbjct: 82  RVERDTILVRTIEERHQPFLGAPVRLASTMKLRPDETWKGRVIDALGRPIDNGPPLARGR 141

Query: 124 LSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFAR 183
            S+ +    P A+ RQRV +   TG+RVID+FTPLC GQRIG+FAGSG+GKSTLLSM  R
Sbjct: 142 RSIPVDQAPPLALERQRVSEPVPTGVRVIDVFTPLCAGQRIGIFAGSGVGKSTLLSMLTR 201

Query: 184 SDCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIA 242
              FD  + + +GERGREVREFI+D L    L K+V+VV+TSDESP++R++A  TA T+A
Sbjct: 202 GSSFDVTVFAAIGERGREVREFIDDTLAKAGLAKAVLVVSTSDESPMMRRLAAKTAFTVA 261

Query: 243 EYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEK 302
           EYF  +G  VLL+ DS+TR+AH++REIA +SGE PV+RGYP SVF++LP+LLER G +  
Sbjct: 262 EYFRDEGQRVLLVFDSVTRYAHAVREIALSSGEPPVSRGYPPSVFTDLPKLLERAG-NAS 320

Query: 303 EKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLAD 362
             G+IT V SVLVDGD+HNDP+AD++R ILDGHIVL+R++A++GR+P VD L SVSRLA 
Sbjct: 321 GTGSITGVFSVLVDGDDHNDPVADTLRGILDGHIVLDRAIADQGRFPAVDILGSVSRLAP 380

Query: 363 KAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPS 422
           + WS  +K  V  L  LI RFEETRDIR+I G++P  D  LDKAV  VP +Y +L QS  
Sbjct: 381 RVWSPSQKTAVRDLRGLISRFEETRDIRMIAGHKPNNDAELDKAVRLVPALYRYLTQSAE 440

Query: 423 DLSSEDVFQEITK 435
           DL   +   ++ +
Sbjct: 441 DLHPGETLDDMLR 453


>gi|170744542|ref|YP_001773197.1| flagellum-specific ATP synthase [Methylobacterium sp. 4-46]
 gi|168198816|gb|ACA20763.1| ATPase, FliI/YscN family [Methylobacterium sp. 4-46]
          Length = 441

 Score =  417 bits (1072), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 199/423 (47%), Positives = 288/423 (68%)

Query: 16  SKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPV 75
           S  +V  GG +  +T+    V  ++ +V LGD +  +      + +V+R++     + P 
Sbjct: 18  SLPVVRVGGPVREVTASACRVAGVAPFVRLGDRMGIEADGRVQIAEVVRVDAAGATLKPF 77

Query: 76  GIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPA 135
               E  +G   F  G  R+ P+  W GRV++ALG+P+DG   L  G   + + +  P A
Sbjct: 78  EARIEAGIGTRAFRIGPARVRPAPSWKGRVLDALGRPLDGLGPLPPGPDLVPLDADPPAA 137

Query: 136 MNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLV 195
           + R R+    +TG+R ID+FTPLC GQRIG+FAGSG+GKSTLL+M A +  FD V+++LV
Sbjct: 138 LGRARLRAPLRTGVRAIDLFTPLCAGQRIGIFAGSGVGKSTLLAMLAGARGFDSVVVALV 197

Query: 196 GERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLI 255
           GERGREVREF+E  L  +  ++ +VV+T DESP++R+ AP  A+ +AE    +G+ VLLI
Sbjct: 198 GERGREVREFLEGPLAASRGRAAIVVSTGDESPMMRRQAPRLAMAVAESLRDRGEAVLLI 257

Query: 256 LDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLV 315
           +DS+TR+AH+ R++A  +GE  VARG+P SVFS+LPRLLER GP +  +G+IT + SVLV
Sbjct: 258 VDSVTRYAHAARDVALAAGEPAVARGFPPSVFSDLPRLLERAGPGQDGRGSITGIFSVLV 317

Query: 316 DGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSS 375
           DGD+HNDP+ADS+R  LDGH+VL+R +A++GRYP +D L S+SRL+D+ W+ +++ +V  
Sbjct: 318 DGDDHNDPVADSIRGTLDGHVVLDRGIADQGRYPAIDLLGSISRLSDQVWTPEQRDVVRR 377

Query: 376 LTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITK 435
           L  +I RFEETRD+RL+GGYR G D  LD+AV  VP IY+ L+Q P    SED F E+ +
Sbjct: 378 LKGMIARFEETRDLRLMGGYRAGSDAELDQAVGLVPRIYESLRQEPGQPPSEDAFLELAQ 437

Query: 436 KLQ 438
            L+
Sbjct: 438 SLR 440


>gi|27355166|dbj|BAC52150.1| flagellum-specific ATP synthase [Bradyrhizobium japonicum USDA 110]
          Length = 379

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 198/377 (52%), Positives = 270/377 (71%)

Query: 62  VIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGK 121
           ++RI+ + +   P        LG + +       +P   W GRVINALG P+DG   L  
Sbjct: 1   MVRIDSEGIIAKPFDRQFAGGLGSVAYRMPPLSFAPDPSWKGRVINALGAPLDGQGPLTP 60

Query: 122 GDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMF 181
           G  ++   ++ P AM R RV K  +TG+RVID+F P+C GQR+G+FAGSG+GKSTLL+M 
Sbjct: 61  GSRAVSAEAEAPSAMKRARVHKPLRTGVRVIDLFAPICAGQRVGIFAGSGVGKSTLLAML 120

Query: 182 ARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTI 241
           ARS  FD V+++LVGERGREVREFIED LG N  ++V +V+T DESP++R++AP TA+ +
Sbjct: 121 ARSQGFDTVVLALVGERGREVREFIEDVLGANRNRAVTIVSTGDESPMMRRLAPKTAMAV 180

Query: 242 AEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSE 301
           AEYF  +G++VLL++DSITRFAH+ RE+A  +GE  VARGY  +VF++LPRLLER GP E
Sbjct: 181 AEYFRDRGESVLLVVDSITRFAHAAREVALAAGEPAVARGYAPTVFTDLPRLLERAGPGE 240

Query: 302 KEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLA 361
           +  G IT + SVLVDGD+HN+PIAD++RS LDGHIVL+R +A++ RYP VD LASVSRLA
Sbjct: 241 EGSGTITGIFSVLVDGDDHNEPIADTIRSTLDGHIVLSRHIADQARYPAVDVLASVSRLA 300

Query: 362 DKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSP 421
              W  +E++LVS L  +I ++E+TRD+RL+GGY+ G D  LD+A+  VP IY  ++Q  
Sbjct: 301 HNVWDPEERELVSKLRTMIAKYEDTRDLRLMGGYQSGRDSGLDQAIDLVPRIYSAMRQDA 360

Query: 422 SDLSSEDVFQEITKKLQ 438
           S   S D F+E+   L+
Sbjct: 361 SAQPSADPFRELRDMLK 377


>gi|17989450|ref|NP_542083.1| flagellum-specific ATP synthase [Brucella melitensis bv. 1 str.
           16M]
 gi|17985329|gb|AAL54347.1| flagellum-specific ATP synthase [Brucella melitensis bv. 1 str.
           16M]
          Length = 380

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 201/358 (56%), Positives = 260/358 (72%), Gaps = 1/358 (0%)

Query: 82  SLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRV 141
           SLG  VF  G  RI P+  W GRVINALG  IDG  +L  G   M   S  P A+ R RV
Sbjct: 15  SLGAAVFEEGPLRIRPAPEWRGRVINALGNAIDGKGALKPGTRPMAAESLAPAALRRARV 74

Query: 142 EKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGRE 201
           ++G +TG+ VIDIFTPLC GQR G+FAGSG+GKSTLL+M  R+  FD V+++L GERGRE
Sbjct: 75  DRGLRTGVNVIDIFTPLCFGQRTGIFAGSGVGKSTLLAMMTRAADFDTVVLALTGERGRE 134

Query: 202 VREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITR 261
           VRE +E+ +  +L K++ VVAT DESP++R++AP TA  IAEYF   G NVLLI+DS+TR
Sbjct: 135 VREMLEETMAGHLGKTITVVATGDESPMMRRLAPNTATAIAEYFRDLGQNVLLIVDSVTR 194

Query: 262 FAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEK-GNITAVISVLVDGDNH 320
           FAH+ RE+A  + E PVARGYP SVFS+LPRLLER GP   E  G+IT + SVLVDGD+H
Sbjct: 195 FAHAAREVAIAAEEPPVARGYPPSVFSQLPRLLERAGPGSAEAGGSITGIYSVLVDGDDH 254

Query: 321 NDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLI 380
           NDP++D++R  LDGHIVL+R++A +GR+P VD  ASVSRLA   W+ +++KLV  L  ++
Sbjct: 255 NDPVSDTIRGTLDGHIVLDRAIAAQGRFPAVDIPASVSRLAKHNWTPEQRKLVMQLRSMV 314

Query: 381 HRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
            RFEETRD+R IG Y+ G D +LD+AV  VP IY+ L+QSP    S+D + ++   L+
Sbjct: 315 ARFEETRDLRAIGAYQKGHDGLLDQAVDFVPRIYEALQQSPETGLSDDPYNDLAAALR 372


>gi|23011134|ref|ZP_00051589.1| COG1157: Flagellar biosynthesis/type III secretory pathway ATPase
           [Magnetospirillum magnetotacticum MS-1]
          Length = 339

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 186/335 (55%), Positives = 253/335 (75%)

Query: 104 RVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQR 163
           RV++ALG+P+DG   L +G  S+ + +  P AM R RV+    TG+R ID+FTPLC GQR
Sbjct: 4   RVVDALGRPVDGLGPLQEGGDSVALDADPPSAMTRARVKTPLLTGVRAIDLFTPLCAGQR 63

Query: 164 IGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVAT 223
           IG+FAGSG+GKSTLL+M A ++ FD V+++LVGERGREVREF+E  +     ++V+VV+T
Sbjct: 64  IGIFAGSGVGKSTLLAMLAGAEGFDSVVVALVGERGREVREFLEGPIAAVRDRAVIVVST 123

Query: 224 SDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYP 283
            DESP++R+ AP  A+ +AE F  +G++VLLI+DS+TR+AH+ R++A  +GE  VARGYP
Sbjct: 124 GDESPMMRRQAPKVALAVAESFRDRGESVLLIVDSVTRYAHAARDVALAAGEPAVARGYP 183

Query: 284 TSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLA 343
            SVFS+LPRLLER GP  + KG IT + SVLVDGD+HNDP+ADS+R  LDGH+VL+R++A
Sbjct: 184 PSVFSDLPRLLERAGPGAEGKGAITGIFSVLVDGDDHNDPVADSIRGTLDGHVVLDRAIA 243

Query: 344 EEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLIL 403
           E+GRYP +D L S+SRLA + WS D+++LV  L  ++ RFEETRD+RL+GGYR G D  L
Sbjct: 244 EQGRYPAIDLLGSISRLAGEVWSGDQRELVRKLKTMMARFEETRDLRLMGGYRAGSDPDL 303

Query: 404 DKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
           D+AV  VP IY+ L+Q P    S D F E+ + L+
Sbjct: 304 DQAVTLVPRIYEALRQEPGQPPSRDAFLELAQSLR 338


>gi|10644737|gb|AAG21379.1| flagella-specific ATPase [Bartonella bacilliformis]
          Length = 315

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 184/313 (58%), Positives = 244/313 (77%)

Query: 126 MEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSD 185
           M + +  PPA+ R RV  G +TG++VIDIFTPLC GQRIG+F+GSG+GKSTLLSM  ++D
Sbjct: 1   MAVEAHAPPALARARVGNGLRTGVKVIDIFTPLCFGQRIGIFSGSGVGKSTLLSMMMQAD 60

Query: 186 CFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYF 245
            FDKV+++L GERGREVR+ ++D L D L K V V+ATSDESP++R++AP+ A TIAEYF
Sbjct: 61  HFDKVVLALTGERGREVRDMLDDTLQDKLDKVVAVIATSDESPMMRRLAPIMATTIAEYF 120

Query: 246 SSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKG 305
           SS GDNVLL++DSITR+A ++REIA ++ E PV+RG+P  VFSELPRLLER GP  K KG
Sbjct: 121 SSLGDNVLLVVDSITRYALAVREIAISAHEPPVSRGFPPRVFSELPRLLERAGPGRKGKG 180

Query: 306 NITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAW 365
           +IT V +VLVDGD+HNDPIAD++R ILDGHIVL+R++A +GR+P VD  +S+SRLA  +W
Sbjct: 181 SITGVYAVLVDGDDHNDPIADAIRGILDGHIVLDRAIAAQGRFPAVDISSSISRLASHSW 240

Query: 366 SADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLS 425
           + +++ LV SL  +I R+EETRD+R +G YRPG D ILD+AVH VP IY  + Q+     
Sbjct: 241 TGEQRILVQSLKEMIFRYEETRDLRAMGAYRPGTDHILDQAVHLVPSIYAAMNQNIDTPL 300

Query: 426 SEDVFQEITKKLQ 438
             + + E+ K L+
Sbjct: 301 VRNPYDELAKLLK 313


>gi|254706313|ref|ZP_05168141.1| flagellum-specific ATP synthase [Brucella pinnipedialis M163/99/10]
 gi|261313760|ref|ZP_05952957.1| flagellum-specific ATP synthase [Brucella pinnipedialis M163/99/10]
 gi|261302786|gb|EEY06283.1| flagellum-specific ATP synthase [Brucella pinnipedialis M163/99/10]
          Length = 390

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 192/363 (52%), Positives = 252/363 (69%), Gaps = 2/363 (0%)

Query: 23  GGYISSITSVYYTVTCLSQYVCLGDFV-VHQGKNSDNLGQVIRINLDIVYICPVGIGEEI 81
           GG +S ++     V  LS+   LGD V +  G+ + +L ++IR+    V + P       
Sbjct: 28  GGTVSDVSRSSIAVRGLSRDARLGDTVAIRAGEGAPSLAEIIRVADLQVLVKPFDDRIMP 87

Query: 82  SLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRV 141
           SLG  VF  G  RI P+  W GRVINALG  IDG  +L  G   M   S  P A+ R RV
Sbjct: 88  SLGAAVFEEGPLRIRPAPEWRGRVINALGNAIDGKGALKPGTRPMAAESLAPAALRRARV 147

Query: 142 EKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGRE 201
           ++G +TG+ VIDIFTPLC GQRIG+FAGSG+GKSTLL+M  R+  FD V+++L GERGRE
Sbjct: 148 DRGLRTGVNVIDIFTPLCFGQRIGIFAGSGVGKSTLLAMMTRAADFDTVVLALTGERGRE 207

Query: 202 VREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITR 261
           VRE +E+ +  +L K++ VVAT DESP++R++AP TA  IAEYF   G NVLLI+DS+TR
Sbjct: 208 VREMLEETMAGHLGKTITVVATGDESPMMRRLAPNTATAIAEYFRDLGQNVLLIVDSVTR 267

Query: 262 FAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEK-GNITAVISVLVDGDNH 320
           FAH+ RE+A  + E PVARGYP SVFS+LPRLLER GP   E  G+IT + SVLVDGD+H
Sbjct: 268 FAHAAREVAIAAEEPPVARGYPPSVFSQLPRLLERAGPGSAEAGGSITGIYSVLVDGDDH 327

Query: 321 NDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLI 380
           NDP++D++R  LDGHIVL+R++A +GR+P VD  ASVSRLA   W+ +++KLV  L  ++
Sbjct: 328 NDPVSDTIRGTLDGHIVLDRAIAAQGRFPAVDIPASVSRLAKHNWTPEQRKLVMQLRSMV 387

Query: 381 HRF 383
            RF
Sbjct: 388 ARF 390


>gi|23499892|ref|NP_699332.1| flagellum-specific ATP synthase [Brucella suis 1330]
 gi|23463467|gb|AAN33337.1| flagellum-specific ATP synthase FliI [Brucella suis 1330]
          Length = 422

 Score =  379 bits (972), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 201/418 (48%), Positives = 263/418 (62%), Gaps = 33/418 (7%)

Query: 23  GGYISSITSVYYTVTCLSQYVCLGDFV-VHQGKNSDNLGQVIRINLDIVYICPVGIGEEI 81
           GG +S ++     V  LS+   LGD V +  G+ + +L ++IR+    V + P       
Sbjct: 28  GGTVSDVSRSSIAVRGLSRDARLGDTVAIRAGEGAPSLAEIIRVADLQVLVKPFDDRIMP 87

Query: 82  SLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRV 141
           SLG  VF  G  RI P+  W GRVINALG  IDG  +L  G   M   S  P A+ R RV
Sbjct: 88  SLGAAVFEEGPLRIRPAPEWRGRVINALGNAIDGKGALKLGTRPMAAESLAPAALRRARV 147

Query: 142 EKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGRE 201
           ++G +TG+ VIDIFTPLC GQRIG+FAGSG+GKSTLL+M  R+  FD V+++L GERGRE
Sbjct: 148 DRGLRTGVNVIDIFTPLCFGQRIGIFAGSGVGKSTLLAMMTRAADFDTVVLALTGERGRE 207

Query: 202 VREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITR 261
           VRE +E+ +  +L K++ VVAT DESP++R++AP TA  IAEYF   G NVLLI+DS+TR
Sbjct: 208 VREMLEETMAGHLGKTITVVATGDESPMMRRLAPNTATAIAEYFRDLGQNVLLIVDSVTR 267

Query: 262 FAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEK-GNITAVISVLVDGDNH 320
           FAH+ RE+A  + E PVARGYP SVFS+LPRLLER GP   E  G+I  + SVLVDGD+H
Sbjct: 268 FAHAAREVAIAAEEPPVARGYPPSVFSQLPRLLERAGPGSAEAGGSIAGIYSVLVDGDDH 327

Query: 321 NDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLI 380
           NDP                               ASVSRLA   W+ +++KLV  L  ++
Sbjct: 328 NDP-------------------------------ASVSRLAKHNWTPEQRKLVMQLRSMV 356

Query: 381 HRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
            RFEETRD+R IG Y+ G D +LD+AV  VP IY+ L+QSP    S+D + ++   L+
Sbjct: 357 ARFEETRDLRAIGAYQKGHDGLLDQAVDFVPRIYEALQQSPETGLSDDPYNDLAAALR 414


>gi|114765225|ref|ZP_01444357.1| flagellum-specific ATP synthase [Pelagibaca bermudensis HTCC2601]
 gi|114542360|gb|EAU45388.1| flagellum-specific ATP synthase [Roseovarius sp. HTCC2601]
          Length = 418

 Score =  337 bits (863), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 176/402 (43%), Positives = 256/402 (63%), Gaps = 3/402 (0%)

Query: 35  TVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLV-FHWGRF 93
           TV+ L + V +G   V QG N   L +V+ I+     + P G  + +  GD V       
Sbjct: 3   TVSGLERAVGIGAHCVVQGANGPVLAEVVGIDESGTRLLPFGSWDGVRTGDPVAVTQSGA 62

Query: 94  RISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVID 153
            + P   W GRV+NALG+P+DG   L +GD    + +  PPA  R+RV     T ++V+D
Sbjct: 63  ELRPDDAWIGRVVNALGQPLDGKGRLPEGDRPRPLRAAPPPAFTRRRVGDRLSTRLKVMD 122

Query: 154 IFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD- 212
           +F PLC GQR+GVF+GSG+GKST+++M AR+   D +++ LVGERGREV++F++D LG+ 
Sbjct: 123 VFAPLCRGQRMGVFSGSGVGKSTMMAMLARNAQADVIVVGLVGERGREVQDFLQDDLGEE 182

Query: 213 NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATN 272
            L ++VVVV+T DE P++R+ A  TA T+AE+F  +G  VLL+LDS+TRFA + REI   
Sbjct: 183 GLARAVVVVSTGDEPPLMRRQAAWTATTVAEHFRDQGKQVLLLLDSVTRFAMAQREIGLA 242

Query: 273 SGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSIL 332
            GE P A+GYP + F+ELPR++ER GP   E G+ITA+ +VLVDGD+ +DPIAD+VR I+
Sbjct: 243 GGEPPTAKGYPPTTFAELPRMMERAGPGSGEGGDITALYTVLVDGDDMDDPIADAVRGIM 302

Query: 333 DGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLI 392
           DGHIVL+R +AE GR+P V+ L S+SR+       +E  +  +    + R+ +  ++  I
Sbjct: 303 DGHIVLDRRIAETGRFPAVNLLRSISRMLPDCHGPEEYAIYRAARCAMARYADMEELIRI 362

Query: 393 GGYRPGVDLILDKAVHQVPIIYDFLKQSPSD-LSSEDVFQEI 433
           G YRPG D  +D A+     + D L+QS  D +   + F  I
Sbjct: 363 GAYRPGSDAEVDAAIKLFQPLEDLLRQSKRDAMEPNETFARI 404


>gi|84502399|ref|ZP_01000535.1| flagellum-specific ATP synthase [Oceanicola batsensis HTCC2597]
 gi|84389211|gb|EAQ02008.1| flagellum-specific ATP synthase [Oceanicola batsensis HTCC2597]
          Length = 450

 Score =  335 bits (858), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 184/440 (41%), Positives = 271/440 (61%), Gaps = 5/440 (1%)

Query: 1   MQKNLETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLG 60
           M+     L+ LA       +   G +S+I  +  TV  L++ + +G     +GK    L 
Sbjct: 1   MKTAFSQLSTLARTTEGARIA--GEVSAIVGLTLTVVGLNRALGIGQRCTIKGKKGPVLA 58

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLV-FHWGRFRISPSACWCGRVINALGKPIDGDDSL 119
           +V+ ++     + P G    +++GD V        I P   W GRV+NALG PIDG  SL
Sbjct: 59  EVVSVDEKGTQVLPFGNWNGVTIGDRVEISTSGESIRPDLSWIGRVLNALGDPIDGLGSL 118

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
            +G +     +  P A  R+RV +   TG+RV D+FTPLC GQR+G+FAGSG+GKS+LLS
Sbjct: 119 HEGPVPCPPKNTPPNAYARRRVGERIDTGVRVFDVFTPLCKGQRMGIFAGSGVGKSSLLS 178

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTA 238
           M AR    D +++ LVGERGREV++FI+  LG + L +SV+VV+T DE P++R+ A  TA
Sbjct: 179 MMARRAEADVIVVGLVGERGREVQDFIQKDLGAEGLNRSVIVVSTGDEPPLMRRQAAWTA 238

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
             +AEYF  +G  VLL++DS+TRFA + REI    GE P  +GYP +VFSELP+LLER G
Sbjct: 239 TAVAEYFRDQGLQVLLLIDSVTRFAMAQREIGLAGGEPPTTKGYPPTVFSELPQLLERSG 298

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
           P   EKG+ITA+ +VLVDGD+ N+P++D+ R I+DGH+VL+R++AE+GR+P V+   SVS
Sbjct: 299 PGVGEKGDITALYTVLVDGDDMNEPVSDAARGIMDGHVVLDRAIAEQGRFPAVNIQKSVS 358

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+     +  E  ++ +    + R+ +  ++  IG YR G D  +D AV       +FL 
Sbjct: 359 RMLPDCHNPGEYAVLKAARRALARYADMEELIRIGAYREGSDEEIDAAVRFARPAENFLT 418

Query: 419 QSPSD-LSSEDVFQEITKKL 437
           QS ++  +SE  F ++ + L
Sbjct: 419 QSKTESTTSEQAFAKLYELL 438


>gi|89068700|ref|ZP_01156086.1| flagellum-specific ATP synthase [Oceanicola granulosus HTCC2516]
 gi|89045663|gb|EAR51725.1| flagellum-specific ATP synthase [Oceanicola granulosus HTCC2516]
          Length = 438

 Score =  334 bits (856), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 175/417 (41%), Positives = 258/417 (61%), Gaps = 3/417 (0%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISL 83
           G +SS+  +  T T L + + +G      G     LG+V+ ++    +I P G  + I  
Sbjct: 8   GRVSSVRGLLLTATGLERAIGIGQRCRVLGAGGAVLGEVVGVDGAGSHILPFGTWDGIVA 67

Query: 84  GDLV-FHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVE 142
           GD V       R+ P   W GRV++ LG+P+D    L +G     + +  PPA +R+RV 
Sbjct: 68  GDQVEVSPQGERVRPCDGWIGRVVDPLGRPLDRAGPLPEGRSPRAVRAGPPPAFDRRRVG 127

Query: 143 KGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREV 202
              +TGIR  D FTPLC GQR+GVFAGSG+GKSTL++M AR+   D +++ L+GERGREV
Sbjct: 128 ARLETGIRAFDAFTPLCRGQRMGVFAGSGVGKSTLMAMLARNADVDVIVVGLIGERGREV 187

Query: 203 REFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITR 261
           ++FI+  LG + L ++V+VVAT DE P++R+ A  TA+ +AE+F  +G  VLL+LDSITR
Sbjct: 188 QDFIQADLGPEGLARAVLVVATGDEPPLMRRQAAWTAMAVAEHFRDRGKQVLLLLDSITR 247

Query: 262 FAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHN 321
           FA + REI  + GE P +RGYP +VF+ELPRLLER GP    +G+ITA+ +VLV+G +  
Sbjct: 248 FATAQREIGLSGGEPPTSRGYPPTVFAELPRLLERAGPGCDGQGDITALFTVLVEGSDME 307

Query: 322 DPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIH 381
           +P+ADSVR I DGH++L+R +AE GRYP +D   SVSR+       DE  ++S+    + 
Sbjct: 308 EPVADSVRGITDGHVILDRRIAERGRYPAIDLQRSVSRMLPDCHGPDEFAILSAARRALG 367

Query: 382 RFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLS-SEDVFQEITKKL 437
           R+ +  ++  IG YRPG D   D A+     +  +L Q   + +   + F ++ + L
Sbjct: 368 RYGDMEELVRIGAYRPGSDPETDAAIRFADPVAAYLGQRKGEATPPRETFADLYRLL 424


>gi|209963545|ref|YP_002296460.1| flagellum-specific ATP synthase [Rhodospirillum centenum SW]
 gi|209957011|gb|ACI97647.1| H+-transporting two-sector ATPase FliI [Rhodospirillum centenum SW]
          Length = 461

 Score =  332 bits (852), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 178/416 (42%), Positives = 259/416 (62%), Gaps = 8/416 (1%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLG-QVIRINLDIVYICPVGIGEEIS 82
           G +SS + +   V  L + + +GD      ++   L  +VI  ++    + P G  + + 
Sbjct: 21  GKVSSCSGMTVEVEGLERRLAVGDACRVFARDGRALACEVIGFSVGRAVLMPFGPLDGLG 80

Query: 83  LGDLVFHWGR---FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQ 139
           LG  V   G    FR  P+  W GRV++  G+P+DG   L +GD +  + +  P A  R+
Sbjct: 81  LGCRVETGGEPASFR--PALSWLGRVVDGFGRPVDGRGPLSRGDENRVLRAAPPHAYERR 138

Query: 140 RVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERG 199
           R+    +TG+RV+D F PLC GQR+GVFAGSG+GKSTLL+M ARS   D  +I L+GERG
Sbjct: 139 RIGPRLETGLRVVDTFVPLCRGQRLGVFAGSGVGKSTLLAMLARSSAADVNVIGLIGERG 198

Query: 200 REVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDS 258
           REV+EFI+D LG + L +SVVVVATSDE  ++R+ A    + +AEYF  +G +VL ++DS
Sbjct: 199 REVQEFIQDDLGPEGLARSVVVVATSDEPALMRRQAAWLTLGLAEYFRDQGRDVLCMMDS 258

Query: 259 ITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGD 318
           +TRFA + REI  ++GE P  +GYP +VF+ELPRLLER GP  +  G+IT + +VLV+G 
Sbjct: 259 VTRFAMAQREIGLSAGEPPTTKGYPPTVFAELPRLLERAGPGREGTGDITGIFTVLVEGG 318

Query: 319 NHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTH 378
           +H++P+AD+VR ILDGH+VL RS+AE GRYP  D L SVSR      S +E   +     
Sbjct: 319 DHDEPVADAVRGILDGHLVLTRSIAERGRYPAADVLKSVSRALPGCHSEEENLTMGRARA 378

Query: 379 LIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLS-SEDVFQEI 433
           L+ R+E   ++  +G Y+ G D  LD A+     + +FL+Q  ++ + S D F  +
Sbjct: 379 LLARYESMEELVRLGAYKAGSDPELDLAIKANEPLENFLRQGKTETTASADAFARL 434


>gi|154252622|ref|YP_001413446.1| flagellum-specific ATP synthase [Parvibaculum lavamentivorans DS-1]
 gi|154156572|gb|ABS63789.1| flagellar protein export ATPase FliI [Parvibaculum lavamentivorans
           DS-1]
          Length = 445

 Score =  331 bits (849), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 162/333 (48%), Positives = 227/333 (68%), Gaps = 2/333 (0%)

Query: 95  ISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDI 154
           + PS+ W GRV+NA+G+P+DG   + +G     + +  PPA  RQRV      G+R ++ 
Sbjct: 91  VYPSSAWLGRVVNAMGEPMDGKGPIAQGAQPYLLRNMPPPAHTRQRVRGKIDLGVRALNT 150

Query: 155 FTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DN 213
           FT  C GQR+G+FAGSG+GKS LLSM AR+   D  +I L+GERGREV+EFIED LG + 
Sbjct: 151 FTTCCRGQRMGIFAGSGVGKSVLLSMLARNTACDVSVIGLIGERGREVQEFIEDDLGPEG 210

Query: 214 LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNS 273
           L +SVVVVATSDE  ++R+ A    +++AEYF  +  NVL ++DS+TRFA + REI  ++
Sbjct: 211 LARSVVVVATSDEPALMRRQAAYLTLSLAEYFRDRDQNVLCMMDSVTRFAVAQREIGLST 270

Query: 274 GELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILD 333
           GE P ++GY  +VF+ELP+LLER GP     GNIT + +VLVDGD+HN+P+AD+VRSILD
Sbjct: 271 GEPPTSKGYTPTVFAELPKLLERAGPGTG-SGNITGLFTVLVDGDDHNEPVADAVRSILD 329

Query: 334 GHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIG 393
           GHIV+ RS+AE GRYP ++ L SVSR       A+E +L+     L+  +++  ++  +G
Sbjct: 330 GHIVMERSIAERGRYPAINVLKSVSRTMPDCNEAEENELIRRARALMATYDDMEELIRLG 389

Query: 394 GYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
            YRPG D  +D+A+   P +  FL Q+  D SS
Sbjct: 390 AYRPGSDPQVDEAIFYQPALEAFLAQNKHDASS 422


>gi|144900259|emb|CAM77123.1| flagellum-specific ATP synthase [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 450

 Score =  330 bits (846), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 166/345 (48%), Positives = 234/345 (67%), Gaps = 3/345 (0%)

Query: 95  ISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDI 154
           + PS  W GRVINA  +P+DG   L  GD    I +  P A +RQRV      G+R ++ 
Sbjct: 95  VHPSDAWLGRVINAFAQPVDGLGPLPLGDNPYPIRATPPSAHSRQRVAGKVDLGVRAVNS 154

Query: 155 FTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DN 213
           F  +C GQR+G+FAGSG+GKS++LSM A++   D  II L+GERGRE REFIED LG + 
Sbjct: 155 FLTMCRGQRMGIFAGSGVGKSSILSMMAKNTSCDVSIIGLIGERGREAREFIEDDLGEEG 214

Query: 214 LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNS 273
           +K+SVVVV+TSDESP++R+ A    +++AEYF  +G +VL ++DS+TRFA + REI+ ++
Sbjct: 215 MKRSVVVVSTSDESPLMRRQAAYLTLSVAEYFRDQGKDVLCMMDSVTRFAMAQREISLSA 274

Query: 274 GELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILD 333
           GE P ++GY  +VF+ELPRLLER GP    KG+IT + +VLVDGD+HN+PI+D+VR ILD
Sbjct: 275 GEPPASKGYTPTVFAELPRLLERAGPGTG-KGSITGLFTVLVDGDDHNEPISDAVRGILD 333

Query: 334 GHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIG 393
           GHIVL+R++A+ GRYP V+ L SVSR      +  E  LVS    L+  +E+  ++  +G
Sbjct: 334 GHIVLDRAIADRGRYPAVNILRSVSRTMPGCNNEQENALVSRARKLLATYEDMAELIRLG 393

Query: 394 GYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS-EDVFQEITKKL 437
            YR G D  +D+A+H  P+I   L Q   D +S  D + ++ + L
Sbjct: 394 AYRKGTDPAVDEAIHYYPMIEKLLTQGKKDATSLRDCYAQLAQVL 438


>gi|254505088|ref|ZP_05117239.1| flagellar protein export ATPase FliI [Labrenzia alexandrii DFL-11]
 gi|222441159|gb|EEE47838.1| flagellar protein export ATPase FliI [Labrenzia alexandrii DFL-11]
          Length = 441

 Score =  328 bits (840), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 159/326 (48%), Positives = 222/326 (68%), Gaps = 1/326 (0%)

Query: 95  ISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDI 154
           + PS  W GRVINALG+PIDG   L  G L  ++ S  PPA  R RV      G+R ++ 
Sbjct: 92  VHPSNAWLGRVINALGEPIDGKGPLPNGGLPRKLRSAPPPASERARVGPPLDLGVRALNT 151

Query: 155 FTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD-N 213
           F   C GQR+G+FAGSG+GKS L+SM AR+   D  +I L+GERGREV+EFIED LG+  
Sbjct: 152 FVTCCEGQRMGIFAGSGVGKSVLMSMLARNTQCDTAVIGLIGERGREVQEFIEDDLGEEG 211

Query: 214 LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNS 273
           L +SVVVVATSDES ++R+ A   A+T+AE+F  +GD VL ++DS+TRFA + REI  + 
Sbjct: 212 LARSVVVVATSDESVLMRRQAAYLAMTVAEHFRDEGDKVLCMMDSVTRFAMAQREIGLSI 271

Query: 274 GELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILD 333
           GE P ++GY  +VF+ELPRLLER GP +   G+IT + +VLV+GDNHN+P+AD+VR ILD
Sbjct: 272 GEPPTSKGYTPTVFTELPRLLERAGPGKSGSGSITGLFTVLVEGDNHNEPVADAVRGILD 331

Query: 334 GHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIG 393
           GH+V+ R +AE GRYP ++ L SVSR   +    +++ ++     L+  + +  ++  +G
Sbjct: 332 GHVVMERGIAERGRYPAINVLKSVSRTMPRCVPPEQQPVLRKAKQLLSTYTDMEELIRLG 391

Query: 394 GYRPGVDLILDKAVHQVPIIYDFLKQ 419
            YR G D  +D+A+++   I DFL Q
Sbjct: 392 AYRRGSDPTVDEAIYRFGPIDDFLNQ 417


>gi|92118831|ref|YP_578560.1| flagellum-specific ATP synthase [Nitrobacter hamburgensis X14]
 gi|91801725|gb|ABE64100.1| ATPase FliI/YscN [Nitrobacter hamburgensis X14]
          Length = 454

 Score =  327 bits (838), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 160/350 (45%), Positives = 239/350 (68%), Gaps = 5/350 (1%)

Query: 94  RISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVID 153
           ++ P+  W GRV+NA+G+PIDG  +L +G + +   +  PPA +R+RV K    G+R ++
Sbjct: 102 QVRPAPSWLGRVLNAMGEPIDGKGALPQGPVPVPFRNSPPPAHSRKRVGKPLDLGVRALN 161

Query: 154 IFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD- 212
            F   C GQR+G+FAGSG+GKS LLSM AR+   D  +I LVGERGREV+EF++D LG+ 
Sbjct: 162 TFLTCCRGQRLGIFAGSGVGKSVLLSMLARNADADISVIGLVGERGREVQEFLQDDLGEE 221

Query: 213 NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATN 272
            L +SVVVVATSDE  ++R+ A    + +AEYF  +G +V+ ++DS+TRFA + REI  +
Sbjct: 222 GLARSVVVVATSDEPALMRRQAAYLTLAVAEYFRDEGKDVMCMMDSVTRFAMAQREIGLS 281

Query: 273 SGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSIL 332
           +GE P  +GY  +VF+ELPRLLER GP   +KG IT + +VLVDGD+HN+P+AD+VR IL
Sbjct: 282 TGEPPTTKGYTPTVFTELPRLLERAGPGAADKGTITGIFTVLVDGDDHNEPVADAVRGIL 341

Query: 333 DGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLI 392
           DGHIV+ R++AE GRYP ++ L SVSR   K+       +++    ++  F +  ++  +
Sbjct: 342 DGHIVMQRAIAERGRYPAINVLKSVSRTMPKSADPAFLPVITRGRQVMATFSDMEELIRL 401

Query: 393 GGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS-EDVF---QEITKKLQ 438
           G YR G +  +D+A+   P++ DFL+Q+  +++S ED +   Q+I K L+
Sbjct: 402 GAYRTGSNAEVDEAIRLNPLLEDFLRQAKDEVTSIEDGYRRLQQILKTLE 451


>gi|58040126|ref|YP_192090.1| flagellum-specific ATP synthase [Gluconobacter oxydans 621H]
 gi|58002540|gb|AAW61434.1| Flagellum-specific ATP synthase [Gluconobacter oxydans 621H]
          Length = 452

 Score =  326 bits (835), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 184/443 (41%), Positives = 274/443 (61%), Gaps = 18/443 (4%)

Query: 5   LETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNL-GQVI 63
           LE L+ L  D+    VV  G +  +  +  TV  L  ++ +GD V  +  +   +  +V+
Sbjct: 8   LERLSNLTCDW----VV--GSVKDVIGLCLTVIGLEGFITIGDRVAVKALDGRVVQSEVV 61

Query: 64  RINLDIVYICPVGIGEEISLG-----DLVFHWGRFRISPSACWCGRVINALGKPIDGDDS 118
               D+  +   G  + I  G      L  H G   ++ S  W GRV++ LG+PIDG   
Sbjct: 62  GFQGDVARLMSFGPLDGIGPGCEARIPLNRHDGGLGVNES--WLGRVLDPLGQPIDGKGP 119

Query: 119 LGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLL 178
           L        +    P A +R R+ +    G+R +D FT    GQR+G+FAGSG+GKSTLL
Sbjct: 120 LFPSFERQPVQCPPPNAASRARLGERIDLGVRALDTFTTCRRGQRLGLFAGSGVGKSTLL 179

Query: 179 SMFAR-SDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPL 236
           SM AR +DC D  +ISLVGERGREVREFIED LG + L +SV+V+ATSD  P++R+ A L
Sbjct: 180 SMLARGADC-DVAVISLVGERGREVREFIEDDLGPEGLARSVLVIATSDSPPLMRREAAL 238

Query: 237 TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLER 296
           +A+ IAEYF ++G +VLL++DS+TRF  ++REI  ++GE P  RGYP SVF+ELPRLLER
Sbjct: 239 SAMAIAEYFRNQGKSVLLLMDSVTRFCMALREIGLSAGEPPATRGYPPSVFAELPRLLER 298

Query: 297 IGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLAS 356
            GP   ++G ITA+ +VLV+GD+ N+P+AD+VR ILDGHI+L+R + E+GRYP +D L S
Sbjct: 299 AGPGYADQGMITALFTVLVEGDDQNEPVADAVRGILDGHIILDRKIGEQGRYPAIDVLRS 358

Query: 357 VSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDF 416
           +SR      S +E  L       +  ++   D+  +G Y+PG D  +D+A+  +P + +F
Sbjct: 359 LSRAVPGCNSPEENALTQRARAAMATYQRMADMIRLGAYKPGTDREVDEAIALMPKLNEF 418

Query: 417 LKQSPSDLSSE-DVFQEITKKLQ 438
           L Q  ++ ++  + F+++ + +Q
Sbjct: 419 LSQGRNERTTRAEAFEQLAQIMQ 441


>gi|296531772|ref|ZP_06894594.1| H+-transporting two-sector ATPase FliI [Roseomonas cervicalis ATCC
           49957]
 gi|296267911|gb|EFH13716.1| H+-transporting two-sector ATPase FliI [Roseomonas cervicalis ATCC
           49957]
          Length = 448

 Score =  325 bits (834), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 176/435 (40%), Positives = 265/435 (60%), Gaps = 6/435 (1%)

Query: 6   ETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFV-VHQGKNSDNLGQVIR 64
           +T AQLA    +    + G ++++     +VT L + V +GD + V +       G+ + 
Sbjct: 13  DTAAQLARLPRRQ---RYGTLAAVRGAALSVTGLGEGVAIGDRMRVQRHGRPPVHGEFVA 69

Query: 65  INLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDL 124
            + D     P G  E +S G  ++      + PS  W GRV+++LG+P+DG   L +G  
Sbjct: 70  FSPDSAIAVPEGGTEGLSPGARLWLEEPLCLYPSDAWLGRVVDSLGRPMDGRGPLPQGRR 129

Query: 125 SMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARS 184
            + +    P A++R+ +    +TG+R +D+FTP+C GQR+G+FA SG+GKSTL+ M AR 
Sbjct: 130 GVRLRQPPPAALSRKLIGARLETGLRALDVFTPICRGQRLGIFAASGVGKSTLIGMLARF 189

Query: 185 DCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAE 243
              D +++ LVGERGREVREF++  LG+   ++SVVVV+TSDE  + R+ A   ++ IAE
Sbjct: 190 VAADVIVLGLVGERGREVREFLDHVLGEAGRRRSVVVVSTSDEPALSRRRAAQASLAIAE 249

Query: 244 YFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKE 303
           +F ++G  V L+LDSITR AH+ REI   +GE   AR Y  SVF+ELP LLER GP  + 
Sbjct: 250 HFRAEGRQVFLLLDSITRLAHAQREIGLAAGEPATARSYTPSVFTELPALLERAGPGPEG 309

Query: 304 KGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADK 363
           +G+ITA+ +VLVDGD+H++PI+D+VR ILDGHIVL+R + E GR+P +D L SVSR   +
Sbjct: 310 EGDITAIFTVLVDGDDHDEPISDAVRGILDGHIVLDRRIGERGRWPAIDVLRSVSRALPR 369

Query: 364 AWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSD 423
             SA+E  L++    L+    +  ++  +G YRPG D  +D A+   P +   L Q   +
Sbjct: 370 CHSAEENALLAEARRLMATHADMAEMIRLGAYRPGSDAGVDAAIAHQPGLEALLAQGVDE 429

Query: 424 LSSE-DVFQEITKKL 437
            SS  + F  +   L
Sbjct: 430 RSSTGEAFARLRASL 444


>gi|163744317|ref|ZP_02151677.1| flagellum-specific ATP synthase [Oceanibulbus indolifex HEL-45]
 gi|161381135|gb|EDQ05544.1| flagellum-specific ATP synthase [Oceanibulbus indolifex HEL-45]
          Length = 446

 Score =  324 bits (831), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 182/441 (41%), Positives = 266/441 (60%), Gaps = 7/441 (1%)

Query: 1   MQKNLETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLG 60
           MQ     L   A +  +  +   G + +IT +  T   L + + +G+  +  G +     
Sbjct: 1   MQTLFSELTSFAREAGEAEIT--GEVRAITGITLTAVGLERVLGIGERCIVHGSDGPVHA 58

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLV-FHWGRFRISPSACWCGRVINALGKPIDGDDSL 119
           +V+ +      + P G    ++ GD V    GR  I P   W GRVI+A   P+DG   L
Sbjct: 59  EVVGLGTHGTELLPFGSWRGVAAGDRVEVAIGRDVIRPDESWKGRVISASAAPLDGKGHL 118

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
            +G+    + +  P A +R+R+     T +R +D+FTPLC GQR+G+FAGSG+GKSTL++
Sbjct: 119 PEGNQPRPLRAAPPGAFDRKRIGPKLATHVRALDVFTPLCQGQRLGIFAGSGVGKSTLMA 178

Query: 180 MFAR-SDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLT 237
           M AR +DC D V+++LVGERGREV++FI   LG + ++K+V+VVAT DE P+ R+ A  T
Sbjct: 179 MLARYTDC-DVVVMALVGERGREVQDFISSDLGPEGMEKAVLVVATGDEPPLTRRQAAWT 237

Query: 238 AVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERI 297
           A+ +AE+F  +G +VLL++DS+TRFA + REI   S E P A+GYP +VFSELP++LER 
Sbjct: 238 AMAVAEHFRDQGQHVLLLMDSVTRFAMAQREIGLASREPPTAKGYPPTVFSELPQMLERA 297

Query: 298 GPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASV 357
           GP    KG+ITA+ +VLVDGD+ NDPIAD+VR I DGHIVL+R +AE+GRYP +D LASV
Sbjct: 298 GPGPVGKGDITAIFTVLVDGDDMNDPIADAVRGITDGHIVLDRKIAEKGRYPAIDLLASV 357

Query: 358 SRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFL 417
           SR      S  E  L+++    +    +  ++  IG YR G +  LD+A+        FL
Sbjct: 358 SRTLPDCHSDAEYTLLTAAHKALAAHADMEELIRIGAYRSGSNPELDRAIAFAGPCEAFL 417

Query: 418 KQSPSDLSSEDV-FQEITKKL 437
            Q  ++ +     F E+   L
Sbjct: 418 SQRKAEHTPPQASFAEVAGML 438


>gi|46201676|ref|ZP_00054580.2| COG1157: Flagellar biosynthesis/type III secretory pathway ATPase
           [Magnetospirillum magnetotacticum MS-1]
          Length = 450

 Score =  323 bits (827), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 160/326 (49%), Positives = 223/326 (68%), Gaps = 2/326 (0%)

Query: 95  ISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDI 154
           + P   W GRVIN  G+P+DG   L  GD++  + ++ P A +R RV      G+R ++ 
Sbjct: 95  VYPDRGWLGRVINGFGEPVDGLGPLPGGDIAYPVKAQPPSAHSRTRVSGKIDLGLRSVNA 154

Query: 155 FTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DN 213
           F   C GQR+G+FAGSG+GKS+++SM AR+   D  ++ L+GERGRE REFIED LG + 
Sbjct: 155 FLTCCRGQRMGIFAGSGVGKSSIMSMMARNTSADIAVLGLIGERGREAREFIEDDLGPEG 214

Query: 214 LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNS 273
           +K+SVVVV+TSDESP+LR+ A    +T+AEYF  +G +VL ++DS+TRFA + REI+ ++
Sbjct: 215 MKRSVVVVSTSDESPLLRRQAAYMTLTVAEYFRDQGLDVLCMMDSVTRFAMAQREISLSA 274

Query: 274 GELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILD 333
           GE P ++GY  +VF+ELPRLLER GP    KG+IT + +VLVD D+HN+PIAD+VR ILD
Sbjct: 275 GEPPASKGYTPTVFAELPRLLERAGPGTG-KGSITGLFTVLVDADDHNEPIADAVRGILD 333

Query: 334 GHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIG 393
           GHIVL+RS+AE GRYP ++ L SVSR      +  E  LV     L+  +E+  ++  +G
Sbjct: 334 GHIVLDRSIAERGRYPAINILRSVSRTMPGCNNQQENDLVRRARALLSTYEDMAELIRLG 393

Query: 394 GYRPGVDLILDKAVHQVPIIYDFLKQ 419
            YR G D  +D+A+H  P I  FL Q
Sbjct: 394 AYRRGTDPKVDEAIHYYPAIEAFLGQ 419


>gi|307944615|ref|ZP_07659955.1| flagellar protein export ATPase FliI [Roseibium sp. TrichSKD4]
 gi|307772364|gb|EFO31585.1| flagellar protein export ATPase FliI [Roseibium sp. TrichSKD4]
          Length = 441

 Score =  321 bits (823), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 160/341 (46%), Positives = 224/341 (65%), Gaps = 1/341 (0%)

Query: 87  VFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFK 146
           V H     + PS  W GRVINA+G+PIDG   L +G+    + +  PPA  R RV     
Sbjct: 84  VIHARESVVHPSDAWLGRVINAMGEPIDGKGELPRGEAPRWMRAAPPPASERARVGPPLD 143

Query: 147 TGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFI 206
            G+R ++ F   C GQR+G+FAGSG+GKS L+SM AR+   D  +I L+GERGREV+EFI
Sbjct: 144 LGVRALNTFVTCCQGQRMGIFAGSGVGKSVLMSMLARNTDCDISVIGLIGERGREVQEFI 203

Query: 207 EDYLGDN-LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHS 265
           ED LG+  L +SVVVVATSDES ++R+ A    +T+AE+F  +G NVL ++DSITRFA +
Sbjct: 204 EDDLGEEGLARSVVVVATSDESVLMRRQAAYLTMTMAEHFRDEGQNVLCMMDSITRFAMA 263

Query: 266 IREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIA 325
            REI  + GE P ++GY  +VF+ELPRLLER GP    KG+IT + +VLV+GDNHN+P+A
Sbjct: 264 QREIGLSIGEPPTSKGYTPTVFTELPRLLERAGPGLVGKGSITGLFTVLVEGDNHNEPVA 323

Query: 326 DSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEE 385
           D+VR ILDGH+V+ RS+AE GRYP ++ L SVSR   +    + + ++     L+  + +
Sbjct: 324 DAVRGILDGHVVMERSIAERGRYPAINVLKSVSRTMPRCVPEEYQPILRKAKQLLSTYTD 383

Query: 386 TRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
             ++  +G YR G D  +D+A+ +   I  FL Q   + +S
Sbjct: 384 MEELIRLGAYRKGSDATVDEAISRFEPIETFLNQRKGEATS 424


>gi|83591865|ref|YP_425617.1| flagellum-specific ATP synthase [Rhodospirillum rubrum ATCC 11170]
 gi|83574779|gb|ABC21330.1| ATPase FliI/YscN [Rhodospirillum rubrum ATCC 11170]
          Length = 475

 Score =  321 bits (823), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 158/330 (47%), Positives = 227/330 (68%), Gaps = 1/330 (0%)

Query: 95  ISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDI 154
           I P+  W GRVINA+G+ +DG  +L  G+ ++ I  + P A +RQRV      G+R I+ 
Sbjct: 95  IYPTRDWLGRVINAMGEAVDGKGALPAGERAVAIRGRPPSAHSRQRVGGKLDLGVRAINT 154

Query: 155 FTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD-N 213
           F   C GQR+G+FAGSG+GKS+++SMF R+   D +++ LVGERGRE REFIED LG+  
Sbjct: 155 FLTCCRGQRMGIFAGSGVGKSSVMSMFIRNTNADVIVMGLVGERGREAREFIEDDLGEEG 214

Query: 214 LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNS 273
           LK++V VVATSDESP++R+ A    + +AEYF  +G +VL ++DS+TRFA + REI+ ++
Sbjct: 215 LKRAVTVVATSDESPLMRRQAAYMTLAVAEYFRDQGLDVLCLMDSVTRFAMAQREISLSA 274

Query: 274 GELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILD 333
           GE P ++GY  +VF+ELP+LLER GP  +  G+IT + +VLV+GD+HN+PI+D+VR ILD
Sbjct: 275 GEPPASKGYTPTVFAELPKLLERAGPGVEGSGSITGLFTVLVEGDDHNEPISDAVRGILD 334

Query: 334 GHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIG 393
           GHIVL+R++AE GRYP ++ L SVSR      S  E  LV+    L+  +E   ++  +G
Sbjct: 335 GHIVLDRAIAERGRYPAINILRSVSRTMPGCNSPAENALVAKGRRLMAAYENMAELIRLG 394

Query: 394 GYRPGVDLILDKAVHQVPIIYDFLKQSPSD 423
            YR G D   D A+H  P +  FL Q+ ++
Sbjct: 395 AYRKGSDPETDTAIHYHPALDAFLTQAKTE 424


>gi|288962371|ref|YP_003452666.1| flagellum-specific ATP synthase [Azospirillum sp. B510]
 gi|288914637|dbj|BAI76122.1| flagellum-specific ATP synthase [Azospirillum sp. B510]
          Length = 445

 Score =  320 bits (819), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 166/400 (41%), Positives = 247/400 (61%), Gaps = 3/400 (0%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLG-QVIRINLDIVYICPVGIGEEIS 82
           G +++++ +   V  + + + +G   + + ++   +  +V+          P G  + + 
Sbjct: 22  GRVTAVSGLMVEVGGIEKELSVGGRCIVETRDRRRVPCEVVGFRQGRALAMPFGALDGVG 81

Query: 83  LGDLVFHWG-RFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRV 141
           LG      G +  I P+  W GRV+NALG+P+DG   L KG     I +  P A +R RV
Sbjct: 82  LGCRALVAGDQAMIYPTDAWLGRVVNALGEPVDGKGPLPKGPQGTPIRNTPPNAHSRARV 141

Query: 142 EKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGRE 201
            +    GIR I+ F   C GQR+G+FAGSG+GKS+++SM AR    +  +I L+GERGRE
Sbjct: 142 GEKLDLGIRAINAFLTCCRGQRMGIFAGSGVGKSSVMSMLARFSAAEVAVIGLIGERGRE 201

Query: 202 VREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSIT 260
           ++EFI + LG+  L +SVVV ATSDE+P++RK A    + +AE+F  +G +VL ++DS+T
Sbjct: 202 LQEFITEDLGEEGLARSVVVCATSDEAPLMRKQAAYMTLAVAEHFRDQGRDVLCMMDSVT 261

Query: 261 RFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNH 320
           RFA + REI  ++GE P  +GYP +VF+ELPRLLER GP     G IT + +VLVDGD+H
Sbjct: 262 RFAMAQREIGLSAGEPPTTKGYPPTVFAELPRLLERAGPGVVGSGTITGLFTVLVDGDDH 321

Query: 321 NDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLI 380
           N+PIAD+VR ILDGHIV+ R + E GRYP ++ L SVSR      +A+E +LV     L+
Sbjct: 322 NEPIADAVRGILDGHIVMERQIGERGRYPAINILRSVSRTMPGCNTANENELVGHARRLL 381

Query: 381 HRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQS 420
             ++   ++  +G YR G D  +D+A+H  P +  FLKQ 
Sbjct: 382 SSYDNMAEMIRLGAYRRGTDPQVDEAIHFQPALEAFLKQG 421


>gi|83309727|ref|YP_419991.1| flagellum-specific ATP synthase [Magnetospirillum magneticum AMB-1]
 gi|82944568|dbj|BAE49432.1| Flagellar biosynthesis/type III secretory pathway ATPase
           [Magnetospirillum magneticum AMB-1]
          Length = 450

 Score =  319 bits (818), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 159/333 (47%), Positives = 226/333 (67%), Gaps = 2/333 (0%)

Query: 95  ISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDI 154
           + P   W GRVIN  G+P+DG   L  GD +  + ++ P A +R RV      G+R ++ 
Sbjct: 95  VFPDRGWLGRVINGFGEPVDGLGPLPGGDTAYPVKAQPPSAHSRSRVSGKIDLGLRSVNA 154

Query: 155 FTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DN 213
           F   C GQR+G+FAGSG+GKS+L+SM AR+   D  ++ L+GERGRE REFIED LG + 
Sbjct: 155 FLTCCRGQRMGIFAGSGVGKSSLMSMMARNTSADISVLGLIGERGREAREFIEDDLGPEG 214

Query: 214 LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNS 273
           +K+SVVVV+TSDESP++R+ A    +T+AE+F  +G +VL ++DS+TRFA + REI+ ++
Sbjct: 215 MKRSVVVVSTSDESPLMRRQAAYMTLTVAEFFRDQGLDVLCMMDSVTRFAMAQREISLSA 274

Query: 274 GELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILD 333
           GE P ++GY  +VF+ELPRLLER GP    KG+IT + +VLVD D+HN+PIAD+VR ILD
Sbjct: 275 GEPPASKGYTPTVFAELPRLLERAGPGVG-KGSITGLFTVLVDADDHNEPIADAVRGILD 333

Query: 334 GHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIG 393
           GHIVL+RS+AE GRYP ++ L SVSR      +  E  LV     L+  +E+  ++  +G
Sbjct: 334 GHIVLDRSIAERGRYPAINILRSVSRTMPGCNNQQENDLVRRARSLLSTYEDMAELIRLG 393

Query: 394 GYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
            YR G D  +D+A+H  P I  FL Q  ++ ++
Sbjct: 394 AYRRGTDPKVDEAIHYYPAIEAFLGQLKTEATT 426


>gi|288962705|ref|YP_003452999.1| flagellum-specific ATP synthase [Azospirillum sp. B510]
 gi|288914971|dbj|BAI76455.1| flagellum-specific ATP synthase [Azospirillum sp. B510]
          Length = 447

 Score =  319 bits (818), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 171/349 (48%), Positives = 231/349 (66%), Gaps = 4/349 (1%)

Query: 93  FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVI 152
           F + P   W GRV+NALG+PIDG   L  G+    +    P A  R+RV +   +GIRVI
Sbjct: 92  FTLRPGQGWLGRVVNALGEPIDGKGPLANGEHPRALRQPPPAACARRRVGRRIDSGIRVI 151

Query: 153 DIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG- 211
           D F PLC GQR+GVFAGSG+GKSTLL+M AR    D ++I L+GERGREVREFI+D LG 
Sbjct: 152 DGFVPLCRGQRLGVFAGSGVGKSTLLAMVARHAEADTIVIGLIGERGREVREFIQDDLGP 211

Query: 212 DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIAT 271
           + L +SVV+VATSDE P++R+ A L  +T+AE    +G +VL ++DS+TRFA + REI  
Sbjct: 212 EGLARSVVIVATSDEPPLMRRQAALLTMTVAEEMRDQGKHVLCLMDSVTRFAMAQREIGL 271

Query: 272 NSGELPVARGYPTSVFSELPRLLERI--GPSEKEKGNITAVISVLVDGDNHNDPIADSVR 329
            +GE P A+ YP SVF+ELPRLLER   GP    +G+ITA+ +VLVDGD+H++PIAD+VR
Sbjct: 272 AAGEPPTAKSYPPSVFAELPRLLERAGPGPEGVGEGDITAIFTVLVDGDDHDEPIADAVR 331

Query: 330 SILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDI 389
            ILDGH+VL+R +AE+GRYP V+ L SVSR        +E ++V     L   ++  +++
Sbjct: 332 GILDGHLVLDRGIAEQGRYPAVNLLRSVSRSLPGCHGVEENRIVGRTRALAATYDGMKEM 391

Query: 390 RLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLS-SEDVFQEITKKL 437
             +G Y+ G D   D A+   P + +FL+Q   D S S D F  +   L
Sbjct: 392 IRLGAYKRGTDPETDAAIDLHPRLEEFLRQGKDDPSPSADSFTRLESLL 440


>gi|83944173|ref|ZP_00956629.1| flagellum-specific ATP synthase [Sulfitobacter sp. EE-36]
 gi|83845040|gb|EAP82921.1| flagellum-specific ATP synthase [Sulfitobacter sp. EE-36]
          Length = 463

 Score =  318 bits (816), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 171/404 (42%), Positives = 247/404 (61%), Gaps = 6/404 (1%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISL 83
           G + SIT +  TV+ L     +G             G+V+      + + P G  E +S+
Sbjct: 22  GTVRSITGMTLTVSGLEAMAAIGSQCRVYTPAGHIDGEVVSAQGSDLCVLPFGTWEGVSV 81

Query: 84  G---DLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQR 140
           G   +L+ H     +SP   W G V++ALG+P+       +        +  P A +R++
Sbjct: 82  GNTVELIEH--DDMVSPDDSWIGTVVDALGRPLTQYTRARRPRRKTRFRANPPGAFDRKK 139

Query: 141 VEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGR 200
           V +  +T I+ IDIFTP+C GQR+GVFAGSG+GKST+++M AR+   D ++I L+GERGR
Sbjct: 140 VGEKLETQIKCIDIFTPICRGQRMGVFAGSGVGKSTMMAMLARNTDADVIVIGLIGERGR 199

Query: 201 EVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSI 259
           EV++FI++ LG+  + ++VVVV+T DE+P+LRK A LT   IAEYF S G  VLL+LDS+
Sbjct: 200 EVQQFIQEDLGEEGMARAVVVVSTGDEAPLLRKQAALTTTAIAEYFKSTGKQVLLLLDSV 259

Query: 260 TRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDN 319
           TRFA + REI    GE P  RGYP SVFSELP LLER GP    +G+IT + +VLVDGD+
Sbjct: 260 TRFAMAQREIGLARGEPPTLRGYPPSVFSELPHLLERAGPGMAAEGDITGLYTVLVDGDD 319

Query: 320 HNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHL 379
            N+PIAD+VR I+DGH+VL+R +AE+GR+P +D   S+SR+     S +E ++       
Sbjct: 320 MNEPIADAVRGIVDGHLVLDRRIAEQGRFPAIDLQKSLSRMLPGCHSPEEYEITKVARKA 379

Query: 380 IHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSD 423
           + R+ +  D+  +G Y+ G D   D+A+        FL QS  D
Sbjct: 380 LGRYADMEDLIRLGAYKAGSDPETDQAITFFQAASPFLSQSRGD 423


>gi|296283215|ref|ZP_06861213.1| flagellum-specific ATP synthase [Citromicrobium bathyomarinum
           JL354]
          Length = 442

 Score =  317 bits (811), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 162/338 (47%), Positives = 227/338 (67%), Gaps = 3/338 (0%)

Query: 91  GRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIR 150
           G+  + P+  W GRV++ LG+P+D    L  G  +    +  P A NR RV +  +TG+R
Sbjct: 89  GQSMLRPTDQWLGRVVDGLGRPMDDKGPLPVGPEARLFKADPPAAANRTRVGRRLETGVR 148

Query: 151 VIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYL 210
            +D+F PLC GQR+G+FAGSG+GKSTLLSM AR    D  +I L+GERGREV+EFIED L
Sbjct: 149 SLDLFAPLCRGQRLGLFAGSGVGKSTLLSMLARWVETDIAVIGLIGERGREVQEFIEDDL 208

Query: 211 G-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREI 269
           G + L +SVVVVATSD   ++R+ A  T + IAE+F   G +V+ ++DS+TRFA + REI
Sbjct: 209 GPEGLARSVVVVATSDSPALMRRQAAWTTLAIAEHFRDAGRDVMCLMDSVTRFAMAQREI 268

Query: 270 ATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVR 329
              +GE P  +GY  +VF+ELPRLLER GP    +G+IT + SVLVDGD+H++PIAD+VR
Sbjct: 269 GLANGEPPATKGYTPTVFAELPRLLERAGPGGPGQGSITGLFSVLVDGDDHDEPIADAVR 328

Query: 330 SILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKL-VSSLTHLIHRFEETRD 388
            ILDGHIV++R +AE GR+P +D L SVSR+       +E +L +++L HL + + +  +
Sbjct: 329 GILDGHIVMSRKIAERGRFPAIDILKSVSRMLPDCHEEEENRLRLAALRHLSN-YADMEE 387

Query: 389 IRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
           +  +G Y+ G D  +D+A+   P I D LKQ   D  S
Sbjct: 388 LVRLGAYKSGSDAEVDEAIRLAPAIEDLLKQRKDDRGS 425


>gi|85713633|ref|ZP_01044623.1| flagellum-specific ATP synthase [Nitrobacter sp. Nb-311A]
 gi|85699537|gb|EAQ37404.1| flagellum-specific ATP synthase [Nitrobacter sp. Nb-311A]
          Length = 441

 Score =  317 bits (811), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 157/350 (44%), Positives = 235/350 (67%), Gaps = 6/350 (1%)

Query: 94  RISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVID 153
           ++ P+A W GRV+NA+G+PIDG   L +G   +   +  PPA +R+RV +    G+R ++
Sbjct: 90  QVRPAASWLGRVLNAMGEPIDGKGPLPQGPAPVPYRNSPPPAHSRKRVGEPLDLGVRALN 149

Query: 154 IFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-D 212
            F   C GQR+G+FAGSG+GKS LLSM AR+   D  +I LVGERGREV+EF++D LG +
Sbjct: 150 TFLTCCRGQRLGIFAGSGVGKSVLLSMLARNADADISVIGLVGERGREVQEFLQDDLGEE 209

Query: 213 NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATN 272
            L +SVVVVATSDE  ++R+ A    + +AEYF  +G +V+ ++DS+TRFA + REI  +
Sbjct: 210 GLARSVVVVATSDEPALMRRQAAYLTLAVAEYFRDEGQDVMCMMDSVTRFAMAQREIGLS 269

Query: 273 SGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSIL 332
           +GE P  +GY  +VF+ELPRLLER GP   E G IT + +VLVDGD+HN+P+AD+VR IL
Sbjct: 270 TGEPPTTKGYTPTVFTELPRLLERAGPGSGE-GTITGIFTVLVDGDDHNEPVADAVRGIL 328

Query: 333 DGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLI 392
           DGHIV+ R +AE GRYP ++ L SVSR   K+       +++    ++  + +  ++  +
Sbjct: 329 DGHIVMERVIAERGRYPAINILKSVSRTMPKSADPAFLPVITRARQMMATYSDMEELIRL 388

Query: 393 GGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS-EDVF---QEITKKLQ 438
           G YR G +  +D+A+   P++ DFL+Q+  +++  E+ +   Q+I K L+
Sbjct: 389 GAYRAGSNAEVDEAIRLNPVLEDFLRQAKDEVTGIEEGYRRLQQIVKTLE 438


>gi|315497639|ref|YP_004086443.1| atpase, flii/yscn family [Asticcacaulis excentricus CB 48]
 gi|315415651|gb|ADU12292.1| ATPase, FliI/YscN family [Asticcacaulis excentricus CB 48]
          Length = 462

 Score =  316 bits (810), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 160/375 (42%), Positives = 236/375 (62%), Gaps = 7/375 (1%)

Query: 61  QVIRINLDIVYICPVGIGEEISLG-DLVFHWGRFRISPSACWCGRVINALGKPIDGDDSL 119
           +V+    D   + P G  E ++ G ++       ++ PS  W GR+I+A G PIDG   L
Sbjct: 75  EVVGFREDRALMMPFGPVEGVAPGAEIRISNEGAKVYPSTAWLGRIIDAFGDPIDGLGPL 134

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
            KG +   + +  PPA +R RV +    G+R +++FT  C GQR+GVFAGSG+GKS LLS
Sbjct: 135 PKGGIGYPLKAAPPPAHSRARVGERLDLGVRAMNVFTTCCRGQRLGVFAGSGVGKSVLLS 194

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTA 238
           M AR    D V++ L+GERGREVREF+E+ LG+  + +++VVVATSDE  + R+ A    
Sbjct: 195 MLAREAACDAVVVGLIGERGREVREFVEETLGEAGISRAIVVVATSDEPALKRRQAAYMT 254

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
           + ++E+   +G  VL ++DS+TRFA + REI   +GE P  +GY  + F+ELP+LLER G
Sbjct: 255 LALSEFLRDQGLEVLCLMDSVTRFAMAQREIGLATGEPPTTKGYTPTCFAELPKLLERAG 314

Query: 299 PSE-----KEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDP 353
           P        + G IT + +VLVDGD+HN+PIAD+VR ILDGHIV++RS+AE GR+P +D 
Sbjct: 315 PGPLLPDGTQTGPITGLFTVLVDGDDHNEPIADAVRGILDGHIVMSRSIAERGRFPAIDV 374

Query: 354 LASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPII 413
           L S+SR      +  E+++V +   ++  +    ++  IG YR G D ++D+A+   P I
Sbjct: 375 LKSISRTMPGCQTLAEREVVRNARAVMSAYTNMEELIRIGAYRTGADPLVDRAIQLNPSI 434

Query: 414 YDFLKQSPSDLSSED 428
             FL QSP + +S D
Sbjct: 435 EQFLSQSPDEATSLD 449


>gi|328542575|ref|YP_004302684.1| H+-transporting two-sector ATPase FliI [polymorphum gilvum
           SL003B-26A1]
 gi|326412321|gb|ADZ69384.1| H+-transporting two-sector ATPase FliI [Polymorphum gilvum
           SL003B-26A1]
          Length = 441

 Score =  315 bits (806), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 155/333 (46%), Positives = 221/333 (66%), Gaps = 1/333 (0%)

Query: 95  ISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDI 154
           + P+  W GRVINA+G+PIDG  +L  G+    + S  PPA  R RV      G+R ++ 
Sbjct: 92  VHPANAWLGRVINAMGEPIDGKGALPGGETPRRLRSAPPPASERARVGPPLDLGVRALNT 151

Query: 155 FTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD-N 213
           F   C GQR+G+FAGSG+GKS L+SM AR+   D  +I L+GERGREV+EFIED LG+  
Sbjct: 152 FVTCCEGQRMGIFAGSGVGKSVLMSMLARNTDCDVAVIGLIGERGREVQEFIEDDLGEAG 211

Query: 214 LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNS 273
           L +SVVVVATSDES ++R+ A   A+T+AE+F  +G  VL ++DS+TRFA + REI  + 
Sbjct: 212 LARSVVVVATSDESVLMRRQAAYLAMTVAEHFRDEGAKVLCMMDSVTRFAMAQREIGLSI 271

Query: 274 GELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILD 333
           GE P ++GY  +VF+ELPRLLER GP     G+IT + +VLV+GDNHN+P+AD+VR ILD
Sbjct: 272 GEPPTSKGYTPTVFTELPRLLERAGPGRVGSGSITGLFTVLVEGDNHNEPVADAVRGILD 331

Query: 334 GHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIG 393
           GH+V+ RS+AE GRYP ++ L SVSR   +        ++     L+  F +  ++  +G
Sbjct: 332 GHVVMERSIAERGRYPAINVLKSVSRTMPRCVPEPLVPVLRKARQLMATFSDMEELIRLG 391

Query: 394 GYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
            YR G D ++D+A+ +   +  FL Q+  + ++
Sbjct: 392 AYRRGSDPVVDEAIARHDALEGFLSQTKDEATA 424


>gi|75674724|ref|YP_317145.1| flagellum-specific ATP synthase [Nitrobacter winogradskyi Nb-255]
 gi|74419594|gb|ABA03793.1| ATPase FliI/YscN [Nitrobacter winogradskyi Nb-255]
          Length = 441

 Score =  313 bits (803), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 158/347 (45%), Positives = 234/347 (67%), Gaps = 11/347 (3%)

Query: 95  ISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDI 154
           + P+A W GRV+NALG+PIDG   L +G   +   +  P A +RQRV +     +R ++ 
Sbjct: 91  VRPAAAWLGRVLNALGEPIDGKGPLPQGPTPVPYRNSPPSAHSRQRVGQPLDLKVRALNT 150

Query: 155 FTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD-N 213
           F   C GQR+G+FAGSG+GKS LLSM AR+   D  +I L+GERGREV+EF++D LGD  
Sbjct: 151 FLTCCRGQRLGIFAGSGVGKSVLLSMLARNADADVSVIGLIGERGREVQEFLQDDLGDEG 210

Query: 214 LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNS 273
           L +SVVVVATSDE  ++R+ A    + IAE+F  +G +V+ ++DS+TRFA + REI  ++
Sbjct: 211 LARSVVVVATSDEPALMRRQAAYLTLAIAEFFRDEGRDVMCMMDSVTRFAMAQREIGLST 270

Query: 274 GELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILD 333
           GE P  +GY  +VF+ELPRLLER GP   +KG IT + +VLVDGD+HN+P+AD+VR ILD
Sbjct: 271 GEPPTTKGYTPTVFTELPRLLERAGPG-ADKGTITGIFTVLVDGDDHNEPVADAVRGILD 329

Query: 334 GHIVLNRSLAEEGRYPPVDPLASVSRL----ADKAWSADEKKLVSSLTHLIHRFEETRDI 389
           GHIV+ R++AE GRYP ++ L SVSR     AD A+  D    ++    ++  + +  ++
Sbjct: 330 GHIVMERAIAERGRYPAINILKSVSRTMPRSADPAFLPD----ITCARRMMATYSDMEEL 385

Query: 390 RLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS-EDVFQEITK 435
             +G YR G +  +D+A+   P++ DFL+Q+  +++S ED ++ + +
Sbjct: 386 IRLGAYRAGSNAEVDEAIRLNPVLEDFLRQAKDEVTSIEDGYRRLQQ 432


>gi|91978136|ref|YP_570795.1| flagellum-specific ATP synthase [Rhodopseudomonas palustris BisB5]
 gi|91684592|gb|ABE40894.1| ATPase FliI/YscN [Rhodopseudomonas palustris BisB5]
          Length = 441

 Score =  312 bits (800), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 155/334 (46%), Positives = 225/334 (67%), Gaps = 2/334 (0%)

Query: 94  RISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVID 153
           ++ PS  W GRVINALG+PIDG   L +G   M   +  PPA +R+RV      G+R ++
Sbjct: 90  QVRPSPAWLGRVINALGEPIDGKGPLPQGASPMPFRNSPPPAHSRKRVGAPLDLGVRALN 149

Query: 154 IFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-D 212
            F   C GQR+G+FAGSG+GKS LLSM AR+      +I L+GERGREV+EF++D LG +
Sbjct: 150 TFLTCCRGQRMGIFAGSGVGKSVLLSMLARNVDAAVSVIGLIGERGREVQEFLQDDLGEE 209

Query: 213 NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATN 272
            L +SVVVVATSDE  ++R+ A    ++IAEYF  +G +VL ++DS+TRFA + REI  +
Sbjct: 210 GLARSVVVVATSDEPALMRRQAAYLTLSIAEYFRDEGKDVLCLMDSVTRFAMAQREIGLS 269

Query: 273 SGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSIL 332
           +GE P A+GY  +VF+ELP+LLER GP  +E G I+ + +VLVDGD+HN+P+AD+VR IL
Sbjct: 270 AGEPPTAKGYTPTVFTELPKLLERAGPGLRE-GTISGIFTVLVDGDDHNEPVADAVRGIL 328

Query: 333 DGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLI 392
           DGHIV+ RS+AE GRYP ++ L SVSR   ++       ++     ++  + +  ++  +
Sbjct: 329 DGHIVMQRSIAERGRYPAINVLKSVSRTMPRSADPAYLPVIKRARQVMATYADMEELIRL 388

Query: 393 GGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
           G YRPG  + +D+AV     + +FL+Q+  + +S
Sbjct: 389 GAYRPGSSVEVDEAVRLHEPLEEFLRQAKDEATS 422


>gi|254473200|ref|ZP_05086598.1| flagellar-specific H(+)-transporting ATP synthase [Pseudovibrio sp.
           JE062]
 gi|211957921|gb|EEA93123.1| flagellar-specific H(+)-transporting ATP synthase [Pseudovibrio sp.
           JE062]
          Length = 373

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 155/340 (45%), Positives = 225/340 (66%), Gaps = 3/340 (0%)

Query: 95  ISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDI 154
           + PS+ W GRV+NALG+PIDG   L  G +  ++    PPA  R RV      G+R ++ 
Sbjct: 24  VHPSSGWLGRVVNALGEPIDGKGPLPFGSIPRKLRDSPPPAAERARVGGPIDLGVRSLNS 83

Query: 155 FTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD-N 213
           F   C GQR+G+FAGSG+GKS L+SM AR+   +  +I L+GERGREV+EFIED LG+  
Sbjct: 84  FVTCCQGQRLGIFAGSGVGKSVLMSMLARNAETEVSVIGLIGERGREVQEFIEDDLGEEG 143

Query: 214 LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNS 273
           L KSVVVVATSDES ++R+ A    +T++EYF  +G NVL ++DS+TRFA + REI  + 
Sbjct: 144 LAKSVVVVATSDESVLMRREAAYLTLTLSEYFRDEGKNVLCMMDSVTRFAMAQREIGLSV 203

Query: 274 GELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILD 333
           GE P ++GY  +VF+ELP+LLER GP    KG++TA+ +VLV+GDNHN+P+AD+VR ILD
Sbjct: 204 GEPPTSKGYTPTVFTELPKLLERAGPGAVGKGSVTALFTVLVEGDNHNEPVADAVRGILD 263

Query: 334 GHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIG 393
           GHIV+ R +AE GRYP ++ L SVSR   +    +   ++     L+  + +  ++  +G
Sbjct: 264 GHIVMERQIAERGRYPAINVLKSVSRTMPRCVPEEALPILRRAKQLMSAYADMEELIRLG 323

Query: 394 GYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS--EDVFQ 431
            Y+ G D ++D+A+ +   +  +L Q   + ++  E  FQ
Sbjct: 324 AYKEGADPLVDEAIAKYDALEAYLGQMKGEKTTIEEGYFQ 363


>gi|83955127|ref|ZP_00963783.1| Flagellum-specific ATP synthase [Sulfitobacter sp. NAS-14.1]
 gi|83840456|gb|EAP79629.1| Flagellum-specific ATP synthase [Sulfitobacter sp. NAS-14.1]
          Length = 434

 Score =  311 bits (796), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 162/365 (44%), Positives = 234/365 (64%), Gaps = 6/365 (1%)

Query: 60  GQVIRINLDIVYICPVGIGEEISLG---DLVFHWGRFRISPSACWCGRVINALGKPIDGD 116
           G+V+      + + P G  E +S+G   +L+ H     +SP   W G V++ALG+P+   
Sbjct: 29  GEVVSAQGSDLCVLPFGTWEGVSVGNTVELIEH--DDMVSPDDSWIGTVVDALGRPLTQY 86

Query: 117 DSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKST 176
               +        +  P A +R++V +  +T I+ IDIFTP+C GQR+GVFAGSG+GKST
Sbjct: 87  TRARRPRRKTRFRANPPGAFDRKKVGEKLETQIKCIDIFTPICRGQRMGVFAGSGVGKST 146

Query: 177 LLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAP 235
           +++M AR+   D ++I L+GERGREV++FI++ LG+  + ++VVVV+T DE+P+LRK A 
Sbjct: 147 MMAMLARNTDADVIVIGLIGERGREVQQFIQEDLGEEGMARAVVVVSTGDEAPLLRKQAA 206

Query: 236 LTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLE 295
           LT   IAEYF S G  VLL+LDS+TRFA + REI    GE P  RGYP SVFSELP LLE
Sbjct: 207 LTTTAIAEYFKSTGKQVLLLLDSVTRFAMAQREIGLARGEPPTLRGYPPSVFSELPHLLE 266

Query: 296 RIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLA 355
           R GP    +G+IT + +VLVDGD+ N+PIAD+VR I+DGH+VL+R +AE+GR+P +D   
Sbjct: 267 RAGPGMAAEGDITGLYTVLVDGDDMNEPIADAVRGIVDGHLVLDRRIAEQGRFPAIDLQK 326

Query: 356 SVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYD 415
           S+SR+     S +E ++       + R+ +  D+  +G Y+ G D   D+A+        
Sbjct: 327 SLSRMLPGCHSPEEYEISKVARKALGRYADMEDLIRLGAYKAGSDPETDQAITFFRAASP 386

Query: 416 FLKQS 420
           FL QS
Sbjct: 387 FLSQS 391


>gi|39934703|ref|NP_946979.1| flagellum-specific ATP synthase [Rhodopseudomonas palustris CGA009]
 gi|192290219|ref|YP_001990824.1| flagellum-specific ATP synthase [Rhodopseudomonas palustris TIE-1]
 gi|39648553|emb|CAE27074.1| flagellum-specific ATP synthase [Rhodopseudomonas palustris CGA009]
 gi|192283968|gb|ACF00349.1| flagellar protein export ATPase FliI [Rhodopseudomonas palustris
           TIE-1]
          Length = 441

 Score =  310 bits (794), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 165/381 (43%), Positives = 236/381 (61%), Gaps = 3/381 (0%)

Query: 48  FVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLG-DLVFHWGRFRISPSACWCGRVI 106
            VV  G N +   +VI    +   + P    E +  G   +      ++ PS  W GRV+
Sbjct: 43  IVVETGANREIPCEVIGFTGNNAIVMPFAGLEGVRRGCRAIIANSAAQVRPSPHWLGRVV 102

Query: 107 NALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGV 166
           NALG+PIDG   L +G   M+  ++ PPA +R+RV      G+R ++ F   C GQR+G+
Sbjct: 103 NALGEPIDGKGPLVQGPSPMQFRNQPPPAHSRKRVGMPLDLGVRALNTFLTCCRGQRMGI 162

Query: 167 FAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSD 225
           FAGSG+GKS LLSM AR+      +I L+GERGREV+EF++D LG + L +SVVVVATSD
Sbjct: 163 FAGSGVGKSVLLSMLARNVDAAVSVIGLIGERGREVQEFLQDDLGEEGLARSVVVVATSD 222

Query: 226 ESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTS 285
           E  ++R+ A    + IAEYF     +VL ++DS+TRFA + REI  ++GE P A+GY  +
Sbjct: 223 EPALMRRQAAYLTLAIAEYFRDNDKDVLCLMDSVTRFAMAQREIGLSAGEPPTAKGYTPT 282

Query: 286 VFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEE 345
           VF+ELP+LLER GP   E G IT + +VLVDGD+HN+P+AD+VR ILDGHIV+ RS+AE 
Sbjct: 283 VFTELPKLLERAGPGLGE-GTITGIFTVLVDGDDHNEPVADAVRGILDGHIVMQRSIAER 341

Query: 346 GRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDK 405
           GRYP ++ L SVSR   K+       ++     ++  + +  ++  +G YRPG    +D+
Sbjct: 342 GRYPAINVLKSVSRTMPKSADPVYLPMIKRARQIMATYADMEELIRLGAYRPGSSAEVDE 401

Query: 406 AVHQVPIIYDFLKQSPSDLSS 426
           AV     + DFL+Q   + +S
Sbjct: 402 AVRLHEPLEDFLRQGKDEATS 422


>gi|209965046|ref|YP_002297961.1| flagellum-specific ATP synthase [Rhodospirillum centenum SW]
 gi|209958512|gb|ACI99148.1| H+-transporting two-sector ATPase FliI [Rhodospirillum centenum SW]
          Length = 447

 Score =  310 bits (793), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 159/367 (43%), Positives = 231/367 (62%), Gaps = 3/367 (0%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLV-FHWGRFRISPSACWCGRVINALGKPIDGDDSL 119
           +V+        + P G  ++I LG       G+  I+P+  W GRV+NALG+PIDG   L
Sbjct: 60  EVVGFRAGKALLMPFGTLDDIGLGCRAEVAEGQPAITPTTGWLGRVVNALGEPIDGKGPL 119

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
            +G     I +  PPA  R+RV      G+R I+ F   C GQR+G+FAGSG+GKS L+S
Sbjct: 120 PQGPRPTPIRASPPPAHARRRVGGKIDLGVRAINTFLTCCKGQRMGIFAGSGVGKSVLMS 179

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTA 238
           M A+       +I L+GERGREV+EF+E  LG + L +SVVVVATSDE P++R+ A    
Sbjct: 180 MLAKYTAAQVSVIGLIGERGREVQEFLEADLGPEGLARSVVVVATSDEPPLMRRQAAYMT 239

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
           + +AE+F  +G +VL ++DS+TRFA + REI  ++GE P  +GYP +VF+ELPRLLER G
Sbjct: 240 MAVAEFFRDEGQDVLCLMDSVTRFAMAQREIGLSAGEPPTTKGYPPTVFAELPRLLERAG 299

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
           P   E G I+ + +VLV+G +  +PIAD+VR ILDGHIV+ R + E GRYP ++ L SVS
Sbjct: 300 PGTGE-GTISGLFTVLVEGGDMEEPIADAVRGILDGHIVMERRIGERGRYPAINILRSVS 358

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R      + ++  LV+    L+  + +  ++  +G YR G D ++D+A+H  P + +FL+
Sbjct: 359 RTMPGCNTEEQNLLVTRARRLMAAYADMEEMIRLGAYRRGSDSMVDEAIHFQPALENFLR 418

Query: 419 QSPSDLS 425
           Q   + S
Sbjct: 419 QGKDERS 425


>gi|220923531|ref|YP_002498833.1| flagellum-specific ATP synthase [Methylobacterium nodulans ORS
           2060]
 gi|219948138|gb|ACL58530.1| ATPase FliI/YscN [Methylobacterium nodulans ORS 2060]
          Length = 453

 Score =  309 bits (791), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 161/333 (48%), Positives = 219/333 (65%), Gaps = 2/333 (0%)

Query: 95  ISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDI 154
           I PS  W GRVI+ALG+PIDG   L  G ++  + +  PPA  R+RV      G+R I+ 
Sbjct: 107 IRPSRAWLGRVIDALGRPIDGLGPLPPGPVAYPLQTDPPPAHARRRVGPPLDLGVRCINT 166

Query: 155 FTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DN 213
           F  LC GQR+G+FAGSG+GKS LLSM ARS   D  +I LVGERGREV+EF++D LG + 
Sbjct: 167 FLTLCRGQRMGIFAGSGVGKSVLLSMLARSAASDVAVIGLVGERGREVQEFLQDDLGPEG 226

Query: 214 LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNS 273
           L +SVVVVATSDE  ++R+ A    + +AE+F  +G  VL ++DSITRFA + R++   +
Sbjct: 227 LARSVVVVATSDEPALMRRNAAYATLALAEHFRDEGAQVLCMIDSITRFAMAQRDVGLAA 286

Query: 274 GELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILD 333
           GE P A+GY  +VFSELPRLLER GP   E G I+ + +VLV+GD+HN+P+AD+VR ILD
Sbjct: 287 GEPPTAKGYTPTVFSELPRLLERAGPGTGE-GMISGLFTVLVEGDDHNEPVADAVRGILD 345

Query: 334 GHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIG 393
           GHIV+ R +AE GRYP ++ L SVSR   +A       +V    HL+    +  ++  +G
Sbjct: 346 GHIVMERRIAERGRYPAINVLRSVSRTMPRACDPAFLPVVQRARHLMSTHADMEELIRLG 405

Query: 394 GYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
            YR G    +D+AV  +P +  FL QS  + +S
Sbjct: 406 AYRAGSSPEVDEAVALMPDLEAFLGQSKEEATS 438


>gi|152965619|ref|YP_001361403.1| ATPase, FliI/YscN family [Kineococcus radiotolerans SRS30216]
 gi|151360136|gb|ABS03139.1| ATPase, FliI/YscN family [Kineococcus radiotolerans SRS30216]
          Length = 453

 Score =  308 bits (790), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 157/327 (48%), Positives = 218/327 (66%), Gaps = 4/327 (1%)

Query: 100 CWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLC 159
              GRV++ALG P+DG   L        + +  PPAM R RV+     G+R +D   P  
Sbjct: 110 ALLGRVVDALGNPLDGGPPLHTAPRG-PLHATPPPAMTRGRVDAPLSLGVRALDTLVPAG 168

Query: 160 HGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSV 218
            GQR G+FAGSG+GKS+LLSM AR    D  +++LVGERGREVREF+ED LG + L +SV
Sbjct: 169 RGQRFGIFAGSGVGKSSLLSMIARGTSADVSVLALVGERGREVREFLEDDLGPEGLARSV 228

Query: 219 VVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPV 278
           VV+ATSDE+P+LR  A LTA T+AE F   G + +L++DS+TR A + REI  + GE P 
Sbjct: 229 VVIATSDEAPVLRLRASLTATTVAESFRDMGADCVLMMDSLTRVAMAQREIGLSVGEPPA 288

Query: 279 ARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVL 338
            RGYP SVF+ +PRLLER GP     G+IT + +VLVDGD+HN+PIAD+ RSILDGH+VL
Sbjct: 289 TRGYPPSVFALMPRLLERAGPGVT--GSITGIYTVLVDGDDHNEPIADNARSILDGHVVL 346

Query: 339 NRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPG 398
           +R LA  G +P +D L SVSR+A +  + ++K   ++L  ++    + +++  +G Y+PG
Sbjct: 347 DRRLATAGHFPTIDVLESVSRVAGRVTTPEQKSAATALRRVMAAHRDAKELIDVGAYQPG 406

Query: 399 VDLILDKAVHQVPIIYDFLKQSPSDLS 425
            +  +D AV Q+P I  FL+Q   D++
Sbjct: 407 ANPEVDAAVAQLPAINAFLRQDIHDIT 433


>gi|90425705|ref|YP_534075.1| flagellum-specific ATP synthase [Rhodopseudomonas palustris BisB18]
 gi|90107719|gb|ABD89756.1| ATPase FliI/YscN [Rhodopseudomonas palustris BisB18]
          Length = 441

 Score =  308 bits (789), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 153/334 (45%), Positives = 220/334 (65%), Gaps = 2/334 (0%)

Query: 94  RISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVID 153
           ++ PS  W GRV+NA+G+PIDG   L +G   M   +  PPA +R+RV      G+R ++
Sbjct: 90  QVRPSPSWLGRVLNAMGEPIDGKGPLTQGTSPMTFRNAPPPAHSRKRVGAPLDLGVRALN 149

Query: 154 IFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD- 212
            F   C GQR+G+FAGSG+GKS LLSM AR+   D  +I LVGERGREV+EF++D LGD 
Sbjct: 150 TFLTCCRGQRLGIFAGSGVGKSVLLSMLARNVDADVSVIGLVGERGREVQEFLQDDLGDE 209

Query: 213 NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATN 272
            + +SVVVVATSDE  ++R+ A    + I+EYF   G +VL ++DS+TRFA + REI  +
Sbjct: 210 GMARSVVVVATSDEPALMRRQAAYLTLAISEYFRDDGKDVLCLMDSVTRFAMAQREIGLS 269

Query: 273 SGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSIL 332
           +GE P A+GY  +VF+ELP+LLER GP   E G IT + +VLVDGD+HN+P+AD+VR IL
Sbjct: 270 AGEPPTAKGYTPTVFTELPKLLERAGPGLNE-GTITGIFTVLVDGDDHNEPVADAVRGIL 328

Query: 333 DGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLI 392
           DGHIV+ R++AE GRYP ++ L SVSR   K+       ++     ++  + +  ++  +
Sbjct: 329 DGHIVMERAIAERGRYPAINILKSVSRTMPKSADPAYLPIIRRARQIMGTYADMEELIRL 388

Query: 393 GGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
           G YR G    +D+A+     + DFL+Q   + ++
Sbjct: 389 GAYRAGSSPEVDEAIRLHQPLEDFLRQGKEEATA 422


>gi|115526263|ref|YP_783174.1| flagellum-specific ATP synthase [Rhodopseudomonas palustris BisA53]
 gi|115520210|gb|ABJ08194.1| flagellar protein export ATPase FliI [Rhodopseudomonas palustris
           BisA53]
          Length = 441

 Score =  308 bits (789), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 152/334 (45%), Positives = 223/334 (66%), Gaps = 2/334 (0%)

Query: 94  RISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVID 153
           ++ PSA W GRV+NA+G+PIDG   L +G   M+  +  PPA +R+RV      G+R ++
Sbjct: 90  QVRPSAAWLGRVLNAMGEPIDGKGPLSQGPSPMQFRNAPPPAHSRKRVGAPLDLGVRALN 149

Query: 154 IFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-D 212
            F   C GQR+G+FAGSG+GKS LLSM AR+   D  +I LVGERGREV+EF++D LG +
Sbjct: 150 TFLTCCRGQRMGIFAGSGVGKSVLLSMLARNVDADVSVIGLVGERGREVQEFLQDDLGEE 209

Query: 213 NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATN 272
            L +SVVVVATSDE  ++R+ A    + IAEYF  +  +VL ++DS+TRFA + REI  +
Sbjct: 210 GLARSVVVVATSDEPALMRRQAAYLTLAIAEYFRDEEKDVLCLMDSVTRFAMAQREIGLS 269

Query: 273 SGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSIL 332
           +GE P A+GY  +VF+ELP+LLER GP  +E G IT + +VLVDGD+HN+P+AD+VR IL
Sbjct: 270 AGEPPTAKGYTPTVFTELPKLLERAGPGLRE-GTITGIFTVLVDGDDHNEPVADAVRGIL 328

Query: 333 DGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLI 392
           DGHIV+ R++AE GRYP ++ L SVSR   K+       ++     ++  + +  ++  +
Sbjct: 329 DGHIVMERAIAERGRYPAINILKSVSRTMPKSADPAYLPIIKRARQIMGTYSDMEELIRL 388

Query: 393 GGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
           G YR G    +D+++     + ++L+Q   + +S
Sbjct: 389 GAYRAGSSPEVDESIQLHEPLENYLRQGKGEATS 422


>gi|126730140|ref|ZP_01745952.1| H+-transporting two-sector ATPase, flagellum-specific [Sagittula
           stellata E-37]
 gi|126709520|gb|EBA08574.1| H+-transporting two-sector ATPase, flagellum-specific [Sagittula
           stellata E-37]
          Length = 458

 Score =  308 bits (789), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 174/412 (42%), Positives = 252/412 (61%), Gaps = 5/412 (1%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFV-VHQGKNSDNLGQVIRINLDIVYICPVGIGEEIS 82
           G ++++      V+ LS+   +GD + ++ G ++   G+V+RI  D+V + P  + E +S
Sbjct: 22  GRVTAVDGTTIWVSGLSEVASIGDRLRLYHGAHTLG-GEVLRIRNDLVAMLPDEVAEGVS 80

Query: 83  LGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVE 142
            GD V   G   ++P   W GRVI+A G+P+DG   LG G       +  PPA  R+R+ 
Sbjct: 81  KGDRVAVLGPPTLAPCDSWIGRVIDAYGQPLDGA-PLGPGLKRRPFRASPPPAAARRRLG 139

Query: 143 KGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREV 202
               TG+ V D   P+  GQRIG+FAGSG+GKS LL+  A+    D V+++LVGERGREV
Sbjct: 140 PRLSTGLSVFDTLLPIAQGQRIGLFAGSGVGKSRLLAQLAQGMQADVVVLALVGERGREV 199

Query: 203 REFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITR 261
            +F+   LG + +K+S+VV ATSD SP+ R+  PL A+TIAE+F  +G +VL + DSITR
Sbjct: 200 LDFVTKVLGPEGMKRSIVVAATSDRSPLERRRCPLAAMTIAEHFRDQGKHVLYMADSITR 259

Query: 262 FAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHN 321
           FA + RE+A  SGELP  RG+P SV  ++ RL ER G      G+ITAV+SVLV G +  
Sbjct: 260 FAEAHREVAIASGELPALRGHPPSVAHQIMRLAERAGCGVDGSGDITAVLSVLVAGSDME 319

Query: 322 DPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIH 381
           +PIAD +R +LDGH+VL+R +AE GR+P +D L SVSR   +A +  E  L+  +  L+ 
Sbjct: 320 EPIADILRGVLDGHVVLDRQIAERGRFPAIDLLRSVSRSLPEAATEPENVLIGDVRQLLG 379

Query: 382 RFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEI 433
            +  +  +   G YR G D ILD+AV     + DFL ++ S    +  FQ +
Sbjct: 380 SYARSETMIRAGLYREGEDPILDQAVRAWADLDDFLAEA-SPAGPQRAFQRL 430


>gi|316935199|ref|YP_004110181.1| ATPase, FliI/YscN family [Rhodopseudomonas palustris DX-1]
 gi|315602913|gb|ADU45448.1| ATPase, FliI/YscN family [Rhodopseudomonas palustris DX-1]
          Length = 441

 Score =  308 bits (789), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 156/334 (46%), Positives = 220/334 (65%), Gaps = 2/334 (0%)

Query: 94  RISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVID 153
           ++ PS  W GRV+NALG+PIDG   L +G   M   ++ PPA +R+RV      G+R ++
Sbjct: 90  QVRPSPHWLGRVVNALGEPIDGKGPLVQGPSPMPFRNQPPPAHSRKRVGAPLDLGVRALN 149

Query: 154 IFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-D 212
            F   C GQR+G+FAGSG+GKS LLSM AR+      +I L+GERGREV+EF++D LG +
Sbjct: 150 TFLTCCRGQRMGIFAGSGVGKSVLLSMLARNVDAAVSVIGLIGERGREVQEFLQDDLGEE 209

Query: 213 NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATN 272
            L +SVVVVATSDE  ++R+ A    + IAEYF     +VL ++DS+TRFA + REI  +
Sbjct: 210 GLARSVVVVATSDEPALMRRQAAYLTLAIAEYFRDNDKDVLCLMDSVTRFAMAQREIGLS 269

Query: 273 SGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSIL 332
           +GE P A+GY  +VF+ELP+LLER GP   E G IT + +VLVDGD+HN+P+AD+VR IL
Sbjct: 270 AGEPPTAKGYTPTVFTELPKLLERAGPGLGE-GTITGIFTVLVDGDDHNEPVADAVRGIL 328

Query: 333 DGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLI 392
           DGHIV+ R++AE GRYP ++ L SVSR   K+       L+     ++  + +  ++  +
Sbjct: 329 DGHIVMQRAIAERGRYPAINVLKSVSRTMPKSADPVYLPLIKRARQIMATYADMEELIRL 388

Query: 393 GGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
           G YRPG    +D+AV     + DFL+Q   + +S
Sbjct: 389 GAYRPGSSAEVDEAVRLHEPLEDFLRQGKDEATS 422


>gi|218288297|ref|ZP_03492596.1| flagellar protein export ATPase FliI [Alicyclobacillus
           acidocaldarius LAA1]
 gi|218241656|gb|EED08829.1| flagellar protein export ATPase FliI [Alicyclobacillus
           acidocaldarius LAA1]
          Length = 441

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 176/405 (43%), Positives = 245/405 (60%), Gaps = 7/405 (1%)

Query: 35  TVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLV-FHWGRF 93
           T+  +     LG+        S+ LG+VI  +   +Y+ P+G   E+S G  V F   +F
Sbjct: 34  TLEVVGPTASLGELCALGRDTSEGLGEVIGFHEGRLYVVPLGPLPEVSPGTPVRFLERQF 93

Query: 94  RISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVID 153
           RI       GRV+N LG+PID    L    +   + +     + R R+   + TG+R ID
Sbjct: 94  RIRCGPGLVGRVLNGLGEPIDDRGHLDGPLVWRTVDAPAISPLRRGRISSPYATGVRAID 153

Query: 154 IFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD- 212
               +  GQR+G+FAGSG+GKSTLLSM AR    D  +I+LVGERGREVREF+ED LG+ 
Sbjct: 154 ALLTIGRGQRVGLFAGSGVGKSTLLSMMARGGRADVHVIALVGERGREVREFLEDDLGEE 213

Query: 213 NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATN 272
            +++SVV+VATSDE   +R  A   A  IAEYF  +G +V L++DS+TRFA + RE+   
Sbjct: 214 GMRRSVVIVATSDEPAYVRSKASFVATAIAEYFRDEGMHVTLMMDSLTRFAMAEREVGLA 273

Query: 273 SGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSIL 332
            GE P +RGY  SVF++LP LLER GP     G ITAV +VLV+GD+ NDPIAD+VR IL
Sbjct: 274 MGEPPSSRGYTPSVFAKLPVLLERAGPGPV--GAITAVYTVLVEGDDLNDPIADAVRGIL 331

Query: 333 DGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLI 392
           DGHIVL+RSLA  G++P +D L S+SRL       D ++    +   + R+ E  D+  I
Sbjct: 332 DGHIVLSRSLANRGQFPAIDVLQSLSRLFPSIADEDHRRAAERVREWMARYGEIEDLFRI 391

Query: 393 GGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKL 437
           G YR G D  +D+A+ ++P I +FL+Q   +  +   F+E   +L
Sbjct: 392 GAYRQGTDPAVDEAIQRMPEILEFLRQKKGETVA---FEEAITQL 433


>gi|258511374|ref|YP_003184808.1| ATPase, FliI/YscN family [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|257478100|gb|ACV58419.1| ATPase, FliI/YscN family [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 441

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 178/423 (42%), Positives = 254/423 (60%), Gaps = 9/423 (2%)

Query: 17  KNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVG 76
           ++LV + G +  +  + + +        LG+        S+ LG+VI  +   +Y+ P+G
Sbjct: 18  RHLVRRAGRVMRV--IGHMLEVAGPTASLGELCALGRDASEGLGEVIGFHEGRLYVVPLG 75

Query: 77  IGEEISLGDLV-FHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPA 135
              E+S G  V F   +FRI       GRV+N LG+PID    L    +   + +     
Sbjct: 76  PLPEVSPGTPVRFLERQFRIRCGPGLVGRVLNGLGEPIDDRGPLEGPLVWRTVDAPAISP 135

Query: 136 MNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLV 195
           + R R+   + TG+R ID    +  GQR+G+FAGSG+GKSTLLSM AR    D  +I+LV
Sbjct: 136 LRRGRISSPYATGVRAIDALLTIGRGQRVGLFAGSGVGKSTLLSMMARGGRADVHVIALV 195

Query: 196 GERGREVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLL 254
           GERGREVREF+ED LG+  +++SVV+VATSDES  +R  A   A  IAE+F  +G +V L
Sbjct: 196 GERGREVREFLEDDLGEEGMRRSVVIVATSDESAYVRSKAAFVATAIAEHFRDEGMHVTL 255

Query: 255 ILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVL 314
           ++DS+TRFA + RE+    GE P +RGY  SVF++LP LLER GP     G ITAV +VL
Sbjct: 256 MMDSLTRFAMAEREVGLAMGEPPSSRGYTPSVFAKLPVLLERAGPGPV--GAITAVYTVL 313

Query: 315 VDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVS 374
           V+GD+ NDPIAD+VR ILDGHIVL+RSLA  G++P +D L S+SRL       D ++   
Sbjct: 314 VEGDDLNDPIADAVRGILDGHIVLSRSLANRGQFPAIDVLQSLSRLFPSIADEDHRRAAE 373

Query: 375 SLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEIT 434
            +   + R+ E  D+  IG YR G D  +D+A+ ++P I +FL+Q   +  +   F+E  
Sbjct: 374 RVREWMARYGEIEDLFRIGAYRQGTDPAVDEAIQRMPEILEFLRQKKGETVA---FEEAI 430

Query: 435 KKL 437
            +L
Sbjct: 431 TQL 433


>gi|295690883|ref|YP_003594576.1| ATPase, FliI/YscN family [Caulobacter segnis ATCC 21756]
 gi|295432786|gb|ADG11958.1| ATPase, FliI/YscN family [Caulobacter segnis ATCC 21756]
          Length = 467

 Score =  308 bits (788), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 153/351 (43%), Positives = 222/351 (63%), Gaps = 7/351 (1%)

Query: 95  ISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDI 154
           + P+  W GR+INA G+PIDG   L +G++   + +  PPA  R RV +    G+R +++
Sbjct: 114 VRPTKAWLGRIINAFGEPIDGLGPLPQGEVPYPLKTAPPPAHARGRVGERLDLGVRSMNV 173

Query: 155 FTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DN 213
           FT  C GQR+G+FAGSG+GKS LLSM A+    D V++ L+GERGREVREF+E+ LG + 
Sbjct: 174 FTTTCRGQRLGIFAGSGVGKSVLLSMLAKEATCDAVVVGLIGERGREVREFVEETLGEEG 233

Query: 214 LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNS 273
           L+++VVVVATSDE  + R+ A    + I+EY   +   VL ++DS+TRFA + REI   +
Sbjct: 234 LRRAVVVVATSDEPALTRRQAAYMTLAISEYMRDQDQEVLCLMDSVTRFAMAQREIGLAA 293

Query: 274 GELPVARGYPTSVFSELPRLLERIGPSE-----KEKGNITAVISVLVDGDNHNDPIADSV 328
           GE P  +GY  +VF+ELP+LLER GP            ITA+ +VLVDGD+HN+PIAD+ 
Sbjct: 294 GEPPTTKGYTPTVFTELPKLLERAGPGPIRADGTTAAPITALFTVLVDGDDHNEPIADAT 353

Query: 329 RSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRD 388
           R ILDGHIV+ R++AE GR+P ++ L S+SR         E+ +V     ++  +    +
Sbjct: 354 RGILDGHIVMERAIAERGRFPAINVLKSISRTMPGCQLPHERDIVKGARQVMAAYSNMEE 413

Query: 389 IRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS-EDVFQEITKKLQ 438
           +  IG YR G D ++D+A+   P I  FL Q   + +S +D F  + + LQ
Sbjct: 414 LIRIGAYRAGADPVVDRAIRLNPAIEAFLSQDKEEATSLDDSFGLLGQILQ 464


>gi|254294575|ref|YP_003060598.1| flagellum-specific ATP synthase [Hirschia baltica ATCC 49814]
 gi|254043106|gb|ACT59901.1| ATPase, FliI/YscN family [Hirschia baltica ATCC 49814]
          Length = 495

 Score =  307 bits (787), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 160/347 (46%), Positives = 224/347 (64%), Gaps = 7/347 (2%)

Query: 98  SACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTP 157
           S  W GRV++A G P+DG   L +G +S +I +  P A +R RV +    G+R +D F P
Sbjct: 108 SNSWLGRVVDAFGAPVDGGLPLAQGSISRQIKAVPPAAHSRARVSEPMSLGVRALDGFAP 167

Query: 158 LCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKK 216
              GQR+G+FAGSG+GKSTL+SM AR+   D V+I L+GERGREVREF+ED LG + L +
Sbjct: 168 CAVGQRMGLFAGSGVGKSTLMSMLARNAQADVVVIGLIGERGREVREFVEDTLGIEGLAR 227

Query: 217 SVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGEL 276
           SVVV ATSDE+   R+ A    + +AE+F  +G  VL +LDS+TRFA + REI   +GE 
Sbjct: 228 SVVVSATSDETAPRRRRAAWMTMAVAEHFRDQGYKVLCLLDSVTRFAMAQREIGLAAGEP 287

Query: 277 PVARGYPTSVFSELPRLLERIGPSE-----KEKGNITAVISVLVDGDNHNDPIADSVRSI 331
           P  +GY  SVFSELP+LLER GP +     + +G IT + +VLVDGD+HN+P+AD+VR I
Sbjct: 288 PTTKGYTPSVFSELPKLLERAGPGKIVPAGQPQGQITGLFTVLVDGDDHNEPVADAVRGI 347

Query: 332 LDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRL 391
           LDGHIV++R +AE GRYP +D L S+SRLA   ++ +  ++      L+  + +  ++  
Sbjct: 348 LDGHIVMDRKIAERGRYPAIDVLKSLSRLASHLYTPETAEIARQARRLMSLYSDMEELVR 407

Query: 392 IGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLS-SEDVFQEITKKL 437
           IG Y  G D  +D+AV   P I   L Q  ++ S  E+ F  + + L
Sbjct: 408 IGAYARGADPEVDRAVQLSPDIEKILTQHVNENSPPEETFAMLAQVL 454


>gi|299134364|ref|ZP_07027557.1| ATPase, FliI/YscN family [Afipia sp. 1NLS2]
 gi|298591111|gb|EFI51313.1| ATPase, FliI/YscN family [Afipia sp. 1NLS2]
          Length = 441

 Score =  306 bits (785), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 153/333 (45%), Positives = 223/333 (66%), Gaps = 2/333 (0%)

Query: 94  RISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVID 153
           ++ PS  W GRV+NA+G PIDG   + +G   M   +  PPA +R+RV +    G+R ++
Sbjct: 90  QVRPSPAWLGRVVNAMGDPIDGKGPIEQGASPMPFRNLPPPAHSRKRVGQPLDLGVRALN 149

Query: 154 IFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-D 212
            F   C GQR+G+FAGSG+GKS LLSM AR+   D  +I LVGERGREV+EF++D LG +
Sbjct: 150 TFLTCCSGQRMGIFAGSGVGKSVLLSMLARNVDADISVIGLVGERGREVQEFLQDDLGEE 209

Query: 213 NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATN 272
            L +SVVVVATSDE  ++R+ A    + I+EYF  +G NVL ++DS+TRFA + REI  +
Sbjct: 210 GLARSVVVVATSDEPALMRRQAAYLTLAISEYFRDEGQNVLCLMDSVTRFAMAQREIGLS 269

Query: 273 SGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSIL 332
           +GE P A+GY  +VF+ELP+LLER GP   E G IT + +VLVDGD+HN+P+AD+VR IL
Sbjct: 270 AGEPPTAKGYTPTVFTELPKLLERAGPGLGE-GTITGIFTVLVDGDDHNEPVADAVRGIL 328

Query: 333 DGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLI 392
           DGHIV+ RS+AE GRYP ++ L SVSR   K+   +   ++     ++  + +  ++  +
Sbjct: 329 DGHIVMERSIAERGRYPAINILKSVSRTMPKSADPEFLPVIMRGRQVMATYADMEELIRL 388

Query: 393 GGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLS 425
           G YR G    +D+A+     + +FL+Q+ ++ +
Sbjct: 389 GAYRAGSSAEVDEAIRLHEPLENFLRQAKNEAT 421


>gi|1938379|gb|AAC45616.1| FliI [Caulobacter crescentus CB15]
          Length = 444

 Score =  306 bits (783), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 152/351 (43%), Positives = 222/351 (63%), Gaps = 7/351 (1%)

Query: 95  ISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDI 154
           + P+  W GR+INA G+PIDG   L +G++   + +  PPA  R RV +    G+R +++
Sbjct: 91  VRPTKAWLGRIINAFGEPIDGLGPLPQGEVPYPLKTAPPPAHARGRVGERLDLGVRSMNV 150

Query: 155 FTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DN 213
           FT  C GQR+G+FAGSG+GKS LLSM A+    D V++ L+GERGREVREF+E+ LG + 
Sbjct: 151 FTTTCRGQRLGIFAGSGVGKSVLLSMLAKEATCDAVVVGLIGERGREVREFVEETLGEEG 210

Query: 214 LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNS 273
           L+++VVVVATSDE  + R+ A    + I+E+   +   VL ++DS+TRFA + REI   +
Sbjct: 211 LRRAVVVVATSDEPALTRRQAAYMTLAISEFMRDQDQEVLCLMDSVTRFAMAQREIGLAA 270

Query: 274 GELPVARGYPTSVFSELPRLLERIGPSE-----KEKGNITAVISVLVDGDNHNDPIADSV 328
           GE P  +GY  +VF+ELP+LLER GP            ITA+ +VLVDGD+HN+PIAD+ 
Sbjct: 271 GEPPTTKGYTPTVFTELPKLLERAGPGPIRPDGTTAAPITALFTVLVDGDDHNEPIADAT 330

Query: 329 RSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRD 388
           R ILDGHIV+ R++AE GR+P ++ L S+SR         E+ +V     ++  +    +
Sbjct: 331 RGILDGHIVMERAIAERGRFPAINVLKSISRTMPGCQHPHERDIVKGARQVMSAYSNMEE 390

Query: 389 IRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS-EDVFQEITKKLQ 438
           +  IG YR G D ++D+A+   P I  FL Q   + +S +D F  + + LQ
Sbjct: 391 LIRIGAYRAGADPVVDRAIRLNPAIEAFLSQDKEEATSLDDSFGMLGQILQ 441


>gi|162147452|ref|YP_001601913.1| flagellum-specific ATP synthase [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161786029|emb|CAP55611.1| Flagellum-specific ATP synthase [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 455

 Score =  306 bits (783), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 174/414 (42%), Positives = 251/414 (60%), Gaps = 20/414 (4%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVV---HQGKNSDNLGQVIRINLDIVYICPVGIGEE 80
           G ++ ++ +  +++ L  +  +GD V      G+ +D    ++  +++   I P G  E 
Sbjct: 19  GRVTGLSGLTVSLSGLRDFTGVGDRVTIFGLDGRETD--ADILPFHINTAIIMPYGSLEG 76

Query: 81  ISLG-----DLVFHWGRFRISPSA-----CWCGRVINALGKPIDGDDSLGKGDLSMEIMS 130
           I  G      L     R R +         W GRVI+ +G+PIDG   L    +  ++ +
Sbjct: 77  IGSGCRAMFQLFDPEQRRRRAGGTLVVNDAWQGRVIDPMGRPIDGKGPLPPDGVPQKLHA 136

Query: 131 KVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKV 190
             P A  R R+      G+RV+++F     GQR+G+FAGSG+GKSTL+ M AR+   D  
Sbjct: 137 PPPEAALRARLGPRIDLGVRVLNLFATCREGQRLGLFAGSGVGKSTLMGMLARNTDCDVA 196

Query: 191 IISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKG 249
           +I+LVGERGREVREF+ED LG + L KSVVVVATSD SP++R+ A   A   AE+F  +G
Sbjct: 197 VIALVGERGREVREFVEDDLGPEGLAKSVVVVATSDTSPLMRREAAYAATAAAEHFRDQG 256

Query: 250 DNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPS----EKEKG 305
            +VLL++DS+TRF  ++REI  +SGE P  RGYP SVF+ELPRLLER GP     + + G
Sbjct: 257 KSVLLLMDSVTRFCQALREIGLSSGEPPATRGYPPSVFAELPRLLERAGPGLPGPDGKAG 316

Query: 306 NITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAW 365
            ITA+ SVLV+GD+HN+P+AD+VR ILDGH+V+ R +AE GRYP ++ L S+SR      
Sbjct: 317 QITAMFSVLVEGDDHNEPVADAVRGILDGHVVMERRIAESGRYPAINVLRSLSRTVPGCN 376

Query: 366 SADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
           SA+E  L       +  +EE +D+  +G YR G D  +D+A+   P I + L+Q
Sbjct: 377 SAEENALTRDARADLSTWEEMQDMVRLGAYRAGNDPKVDQAIRIAPAIEEILRQ 430


>gi|126738584|ref|ZP_01754289.1| H+-transporting two-sector ATPase, flagellum-specific [Roseobacter
           sp. SK209-2-6]
 gi|126720383|gb|EBA17089.1| H+-transporting two-sector ATPase, flagellum-specific [Roseobacter
           sp. SK209-2-6]
          Length = 442

 Score =  306 bits (783), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 165/405 (40%), Positives = 252/405 (62%), Gaps = 3/405 (0%)

Query: 17  KNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNL-GQVIRINLDIVYICPV 75
           + LV Q G ++ IT     ++ L ++  +GD +V Q    D+L G+V++I++  + + P 
Sbjct: 15  RKLVTQMGRVTGITGGEIEISGLEKHARIGDRLVLQRGPKDHLHGEVLKIDVSKISMLPD 74

Query: 76  GIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPA 135
              + +++GD V        +PS  W GRVI+  G+P+DG   L +G  + ++M+  P A
Sbjct: 75  RAPDRVAIGDRVLLHPAADFAPSDNWVGRVIDPFGEPLDGRPML-RGSEARDLMAPPPKA 133

Query: 136 MNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLV 195
             R+++     TG+ V++   P+  GQR+G+FAGSG+GKSTLL+  A+S   D V+++L+
Sbjct: 134 AGRRQMGARLATGLSVLNTILPVVQGQRVGLFAGSGVGKSTLLAKLAQSMEADVVVMALI 193

Query: 196 GERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLL 254
           GERGREV  F+E+ LG + +K+++VV ATSD+S ++R+    +A+TIAE+F  +G NVL 
Sbjct: 194 GERGREVNHFVEEVLGPEGMKRAIVVAATSDQSALVRRRCAWSAMTIAEHFRDQGKNVLF 253

Query: 255 ILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVL 314
           + DS+TRFA + REIA  SGE P  RGYP SV   +  L ER GP  +  G+ITAV SVL
Sbjct: 254 MADSVTRFAEAHREIAAASGEAPALRGYPPSVTPLITGLCERAGPGAEGHGDITAVFSVL 313

Query: 315 VDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVS 374
           V G +  +PIAD +R +LDGHIVLNR +AE GR+P +D   SVSR    A + DE  ++ 
Sbjct: 314 VAGSDMEEPIADILRGVLDGHIVLNREIAERGRFPAIDVSRSVSRSLPAAATDDENAMIL 373

Query: 375 SLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
            +   +  +E++  +   G Y  G DL+LD+AV   P +  F  +
Sbjct: 374 EVRKYLGSYEQSEVMIRAGLYSEGNDLVLDQAVKLWPELDSFFGK 418


>gi|209545561|ref|YP_002277790.1| flagellum-specific ATP synthase [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209533238|gb|ACI53175.1| ATPase, FliI/YscN family [Gluconacetobacter diazotrophicus PAl 5]
          Length = 455

 Score =  305 bits (782), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 174/414 (42%), Positives = 249/414 (60%), Gaps = 20/414 (4%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVV---HQGKNSDNLGQVIRINLDIVYICPVGIGEE 80
           G ++ ++ +  +++ L  +  +GD V      G+ +D   +++    D     P G  E 
Sbjct: 19  GRVTGLSGLTVSLSGLRDFTGVGDRVAIFGLDGRETD--AEIVAFRGDTAIAMPYGSLEG 76

Query: 81  ISLG-----DLVFHWGRFRISPSA-----CWCGRVINALGKPIDGDDSLGKGDLSMEIMS 130
           I  G      L     R R +         W GRVI+ +G+PIDG   L    +  ++ +
Sbjct: 77  IGSGCRAMFQLFDPEQRRRRAGGTLVVNDAWQGRVIDPMGRPIDGKGPLPPDGVPQKLHA 136

Query: 131 KVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKV 190
             P A  R R+      G+RV+++F     GQR+G+FAGSG+GKSTL+ M AR+   D  
Sbjct: 137 PPPEAALRARLGPRIDLGVRVLNLFATCREGQRLGLFAGSGVGKSTLMGMLARNTDCDVA 196

Query: 191 IISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKG 249
           +I+LVGERGREVREF+ED LG + L KSVVVVATSD SP++R+ A   A   AE+F  +G
Sbjct: 197 VIALVGERGREVREFVEDDLGPEGLAKSVVVVATSDTSPLMRREAAYAATAAAEHFRDQG 256

Query: 250 DNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPS----EKEKG 305
            +VLL++DS+TRF  ++REI  +SGE P  RGYP SVF+ELPRLLER GP     + + G
Sbjct: 257 KSVLLLMDSVTRFCQALREIGLSSGEPPATRGYPPSVFAELPRLLERAGPGLPGPDGKAG 316

Query: 306 NITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAW 365
            ITA+ SVLV+GD+HN+P+AD+VR ILDGH+V+ R +AE GRYP ++ L S+SR      
Sbjct: 317 QITAMFSVLVEGDDHNEPVADAVRGILDGHVVMERRIAESGRYPAINVLRSLSRTVPGCN 376

Query: 366 SADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
           SA+E  L       +  +EE +D+  +G YR G D  +D+A+   P I + L+Q
Sbjct: 377 SAEENALTRDARADLSTWEEMQDMVRLGAYRAGNDPKVDQAIRIAPAIEEILRQ 430


>gi|86751019|ref|YP_487515.1| flagellum-specific ATP synthase [Rhodopseudomonas palustris HaA2]
 gi|86574047|gb|ABD08604.1| ATPase FliI/YscN [Rhodopseudomonas palustris HaA2]
          Length = 441

 Score =  305 bits (780), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 152/334 (45%), Positives = 221/334 (66%), Gaps = 2/334 (0%)

Query: 94  RISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVID 153
           ++ PS  W GRVINALG+PIDG   L +G   M   +  PPA +R+RV      G+R ++
Sbjct: 90  QVRPSQAWLGRVINALGEPIDGKGPLPQGPSPMRFRNTPPPAHSRKRVGAPLDLGVRALN 149

Query: 154 IFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-D 212
            F   C GQR+G+FAGSG+GKS LLSM AR+      +I L+GERGREV+EF++D LG +
Sbjct: 150 TFLTCCRGQRMGIFAGSGVGKSVLLSMLARNVDAAVSVIGLIGERGREVQEFLQDDLGEE 209

Query: 213 NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATN 272
            + +SVVVVATSDE  ++R+ A    ++IAEYF  +  +VL ++DS+TRFA + REI  +
Sbjct: 210 GMARSVVVVATSDEPALMRRQAAYLTLSIAEYFRDEDKDVLCLMDSVTRFAMAQREIGLS 269

Query: 273 SGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSIL 332
           +GE P A+GY  +VF+ELP+LLER GP   E G I+ + +VLVDGD+HN+P+AD+VR IL
Sbjct: 270 AGEPPTAKGYTPTVFTELPKLLERAGPGLGE-GTISGIFTVLVDGDDHNEPVADAVRGIL 328

Query: 333 DGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLI 392
           DGHIV+ RS+AE GR+P ++ L SVSR   ++       ++     ++  + +  ++  +
Sbjct: 329 DGHIVMQRSIAERGRFPAINVLKSVSRTMPRSADPAYLPVIKRARQVMATYADMEELIRL 388

Query: 393 GGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
           G YRPG    +D+AV     + +FL+Q   + +S
Sbjct: 389 GAYRPGSSAEVDEAVRLHEPLEEFLRQGKDEATS 422


>gi|163850256|ref|YP_001638299.1| flagellum-specific ATP synthase [Methylobacterium extorquens PA1]
 gi|254559506|ref|YP_003066601.1| flagellum-specific ATP synthase [Methylobacterium extorquens DM4]
 gi|163661861|gb|ABY29228.1| flagellar protein export ATPase FliI [Methylobacterium extorquens
           PA1]
 gi|254266784|emb|CAX22583.1| flagellum-specific ATP synthase [Methylobacterium extorquens DM4]
          Length = 451

 Score =  305 bits (780), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 157/333 (47%), Positives = 214/333 (64%), Gaps = 2/333 (0%)

Query: 95  ISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDI 154
           I PSA W GR ++ALG+PIDG   L +G     + +  PPA  R+RV      G+R I+ 
Sbjct: 105 IRPSAAWLGRTVDALGRPIDGLGPLAQGPAIYPLRADPPPAHGRRRVGPPLDLGVRCINT 164

Query: 155 FTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DN 213
           F  +C GQR+G+FAGSG+GKS LLSM AR    D  +I LVGERGREV+EF++D LG   
Sbjct: 165 FLTMCRGQRMGIFAGSGVGKSVLLSMLARYTAADVAVIGLVGERGREVQEFLQDDLGAAG 224

Query: 214 LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNS 273
           L +SVVVVATSDE  ++R+ A    + +AEYF  +G  VL ++DSITRFA + R+I    
Sbjct: 225 LARSVVVVATSDEPVLMRRNAAYVTLAVAEYFRDQGAQVLCMIDSITRFAMAQRDIGLAG 284

Query: 274 GELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILD 333
           GE P A+GY  +VFSELPRLLER GP   E G I+ + +VLV+GD+HN+P+AD+VR ILD
Sbjct: 285 GEPPTAKGYTPTVFSELPRLLERAGPGVGE-GAISGLFTVLVEGDDHNEPVADAVRGILD 343

Query: 334 GHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIG 393
           GHIV+ R +AE+GRYP ++ L SVSR   +A        V     ++  + +  ++  +G
Sbjct: 344 GHIVMERRIAEQGRYPAINVLRSVSRTMPRACDPARLPTVRRARKVLATYADMEELIRLG 403

Query: 394 GYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
            YR G    +D+AV  +P +  FL Q   + +S
Sbjct: 404 AYRAGSSPEVDEAVALMPDLTAFLGQGKEEATS 436


>gi|167644988|ref|YP_001682651.1| flagellum-specific ATP synthase [Caulobacter sp. K31]
 gi|167347418|gb|ABZ70153.1| ATPase, FliI/YscN family [Caulobacter sp. K31]
          Length = 445

 Score =  304 bits (779), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 153/340 (45%), Positives = 219/340 (64%), Gaps = 6/340 (1%)

Query: 95  ISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDI 154
           + P+  W GR+INA G+PIDG   L +G++   + +  PPA  R RV +    G+R +++
Sbjct: 91  VRPTKAWLGRIINAFGEPIDGLGPLPQGEVPYPLKTPPPPAHARGRVGERLDLGVRSMNV 150

Query: 155 FTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DN 213
           FT  C GQR+G+FAGSG+GKS LLSM A+    D V++ L+GERGREVREFIE+ LG + 
Sbjct: 151 FTTTCRGQRLGIFAGSGVGKSVLLSMLAKEATCDAVVVGLIGERGREVREFIEETLGEEG 210

Query: 214 LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNS 273
           LK+++VVVATSDE  + R+ A    + I EY   +   VL ++DS+TRFA + REI   +
Sbjct: 211 LKRAIVVVATSDEPALTRRQAAYMTLAICEYLRDQDQEVLCLMDSVTRFAMAQREIGLAA 270

Query: 274 GELPVARGYPTSVFSELPRLLERIGPSE-----KEKGNITAVISVLVDGDNHNDPIADSV 328
           GE P  +GY  +VF+ELP+LLER GP          G ITA+ +VLVDGD+HN+PIAD+ 
Sbjct: 271 GEPPTTKGYTPTVFTELPKLLERAGPGPIRADGTTAGPITALFTVLVDGDDHNEPIADAT 330

Query: 329 RSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRD 388
           R ILDGHIV+ R++AE GR+P ++ L S+SR      + +E+++V +    +  +    +
Sbjct: 331 RGILDGHIVMERAIAERGRFPAINVLKSISRTMPGCQTPEEREVVKAARQTMAAYSNMEE 390

Query: 389 IRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSED 428
           +  IG YR G D I+D+A+   P I  FL Q   + +S D
Sbjct: 391 LIRIGAYRAGADPIIDRAIRLNPAIEAFLGQDKDEATSLD 430


>gi|209886224|ref|YP_002290081.1| flagellar protein export ATPase FliI [Oligotropha carboxidovorans
           OM5]
 gi|209874420|gb|ACI94216.1| flagellar protein export ATPase FliI [Oligotropha carboxidovorans
           OM5]
          Length = 441

 Score =  304 bits (779), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 152/328 (46%), Positives = 220/328 (67%), Gaps = 2/328 (0%)

Query: 94  RISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVID 153
           ++ P A W GRV+NA+G+PIDG   L +G + +   +  PPA  R+RV +    G+R ++
Sbjct: 90  QVRPCAAWLGRVVNAMGEPIDGKGPLPQGSVPVSFRNLPPPAHARKRVGEPLDLGVRALN 149

Query: 154 IFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-D 212
            F   C GQR+G+FAGSG+GKS LLSM AR+   D  +I LVGERGREV+EF++D LG +
Sbjct: 150 TFLTCCRGQRMGIFAGSGVGKSVLLSMLARNVDADISVIGLVGERGREVQEFLQDDLGEE 209

Query: 213 NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATN 272
            L +SVVVVATSDE  ++R+ A    + IAEYF  +  +VL ++DS+TRFA + REI  +
Sbjct: 210 GLARSVVVVATSDEPALMRRQAAYLTLAIAEYFRDQDQSVLCLMDSVTRFAMAQREIGLS 269

Query: 273 SGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSIL 332
           +GE P A+GY  +VF+ELP+LLER GP   E G IT + +VLVDGD+HN+P+AD+VR IL
Sbjct: 270 AGEPPTAKGYTPTVFTELPKLLERAGPGLGE-GTITGIFTVLVDGDDHNEPVADAVRGIL 328

Query: 333 DGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLI 392
           DGHIV+ R++AE GRYP ++ L SVSR   K+   +   ++     ++  + +  ++  +
Sbjct: 329 DGHIVMERAIAERGRYPAINILKSVSRTMPKSADPEFLPVIMRGRQVMATYADMEELIRL 388

Query: 393 GGYRPGVDLILDKAVHQVPIIYDFLKQS 420
           G YR G    +D+A+     + DFL+Q+
Sbjct: 389 GAYRAGSSPEVDEAIRLHEPLEDFLRQA 416


>gi|188580014|ref|YP_001923459.1| flagellum-specific ATP synthase [Methylobacterium populi BJ001]
 gi|179343512|gb|ACB78924.1| flagellar protein export ATPase FliI [Methylobacterium populi
           BJ001]
          Length = 452

 Score =  304 bits (779), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 176/412 (42%), Positives = 240/412 (58%), Gaps = 10/412 (2%)

Query: 24  GYISSITSVYYTVTCLSQYVCLG---DFVVHQGKNSDNLG---QVIRINLDIVYICPVGI 77
           G +++I  +   V      + LG   D VV  G  +       +VI    D     P G 
Sbjct: 27  GRVTAIRGLLVEVAGPVSAMRLGGRIDVVVEGGHGAATATVPCEVIGFAGDRALAMPFGS 86

Query: 78  GEEISLG--DLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPA 135
            E +  G   LV       I PSA W GR ++ALG+PIDG   L +G     + +  PPA
Sbjct: 87  LEGVRRGCPALVRDEAAGAIRPSAAWLGRTVDALGRPIDGLGPLPQGPAIYPLRADPPPA 146

Query: 136 MNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLV 195
             R+RV      G+R I+ F  +C GQR+G+FAGSG+GKS LLSM AR    D  +I LV
Sbjct: 147 HGRRRVGPPLDLGVRCINTFLTMCRGQRMGIFAGSGVGKSVLLSMLARYTAADVAVIGLV 206

Query: 196 GERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLL 254
           GERGREV+EF++D LG   L +SVVVVATSDE  ++R+ A    + IAEYF  +G  VL 
Sbjct: 207 GERGREVQEFLQDDLGAAGLARSVVVVATSDEPVLMRRNAAYVTLAIAEYFRDQGAQVLC 266

Query: 255 ILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVL 314
           ++DSITRFA + R+I    GE P A+GY  +VFSELPRLLER GP   E G I+ + +VL
Sbjct: 267 MIDSITRFAMAQRDIGLAGGEPPTAKGYTPTVFSELPRLLERAGPGVGE-GAISGLFTVL 325

Query: 315 VDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVS 374
           V+GD+HN+P+AD+VR ILDGHIV+ R +AE+GRYP ++ L SVSR   +A        V 
Sbjct: 326 VEGDDHNEPVADAVRGILDGHIVMERRIAEQGRYPAINVLRSVSRTMPRACDPAHLPTVR 385

Query: 375 SLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
               ++  + +  ++  +G YR G    +D+AV  +P +  FL Q   + +S
Sbjct: 386 RARKVLATYADMEELIRLGAYRAGSSPEVDEAVALMPDLTAFLGQGKEEATS 437


>gi|218528814|ref|YP_002419630.1| flagellum-specific ATP synthase [Methylobacterium chloromethanicum
           CM4]
 gi|218521117|gb|ACK81702.1| ATPase FliI/YscN [Methylobacterium chloromethanicum CM4]
          Length = 451

 Score =  304 bits (778), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 157/333 (47%), Positives = 214/333 (64%), Gaps = 2/333 (0%)

Query: 95  ISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDI 154
           I PSA W GR ++ALG+PIDG   L +G     + +  PPA  R+RV      G+R I+ 
Sbjct: 105 IRPSAAWLGRTVDALGRPIDGLGPLAQGPAIYPLRADPPPAHGRRRVGPPLDLGVRCINT 164

Query: 155 FTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DN 213
           F  +C GQR+G+FAGSG+GKS LLSM AR    D  +I LVGERGREV+EF++D LG   
Sbjct: 165 FLTMCRGQRMGIFAGSGVGKSVLLSMLARYTAADVAVIGLVGERGREVQEFLQDDLGAAG 224

Query: 214 LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNS 273
           L +SVVVVATSDE  ++R+ A    + +AEYF  +G  VL ++DSITRFA + R+I    
Sbjct: 225 LARSVVVVATSDEPVLMRRNAAYVTLAVAEYFRDQGAQVLCMIDSITRFAMAQRDIGLAG 284

Query: 274 GELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILD 333
           GE P A+GY  +VFSELPRLLER GP   E G I+ + +VLV+GD+HN+P+AD+VR ILD
Sbjct: 285 GEPPTAKGYTPTVFSELPRLLERAGPGVGE-GAISGLFTVLVEGDDHNEPVADAVRGILD 343

Query: 334 GHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIG 393
           GHIV+ R +AE+GRYP ++ L SVSR   +A        V     ++  + +  ++  +G
Sbjct: 344 GHIVMERRIAEQGRYPAINVLRSVSRTMPRACDPAHLPTVRRARKVLATYADMEELIRLG 403

Query: 394 GYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
            YR G    +D+AV  +P +  FL Q   + +S
Sbjct: 404 AYRAGSAPEVDEAVALMPDLTAFLGQGKEEATS 436


>gi|329849943|ref|ZP_08264789.1| flagellar protein export ATPase FliI [Asticcacaulis biprosthecum
           C19]
 gi|328841854|gb|EGF91424.1| flagellar protein export ATPase FliI [Asticcacaulis biprosthecum
           C19]
          Length = 443

 Score =  303 bits (777), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 154/375 (41%), Positives = 231/375 (61%), Gaps = 7/375 (1%)

Query: 61  QVIRINLDIVYICPVGIGEEISLG-DLVFHWGRFRISPSACWCGRVINALGKPIDGDDSL 119
           +V+    D   + P G  E ++ G ++       ++ P+  W GR++++ G  ID    L
Sbjct: 56  EVVGFREDRALMMPFGPVEGVTPGAEIRISAEGSKVFPTTAWLGRIVDSFGNAIDSHGPL 115

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
            +G     + +  P A  R RV +    G+R +D+FT  C GQR+GVFAGSG+GKS LLS
Sbjct: 116 PQGPEGYLLKAAPPAAHTRARVGERLNLGVRAMDVFTTCCRGQRLGVFAGSGVGKSVLLS 175

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTA 238
           M AR    D V++ L+GERGREVREFIE+ LG + LK+++VVVATSDE  + R+ A    
Sbjct: 176 MLAREATCDAVVVGLIGERGREVREFIEETLGPEGLKRAIVVVATSDEPALKRRQAAYMT 235

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
           + +AE+   +G  VL ++DS+TRFA + REI   +GE P  +GY  + F+ELP+LLER G
Sbjct: 236 LALAEFLRDQGLEVLCLMDSVTRFAMAQREIGLATGEPPTTKGYTPTCFAELPKLLERAG 295

Query: 299 PSE-----KEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDP 353
           P        + G ITA+ +VLVDGD+HN+PIAD+VR ILDGHIV++R++AE GR+P +D 
Sbjct: 296 PGPVLADGTQAGPITALFTVLVDGDDHNEPIADAVRGILDGHIVMSRNIAERGRFPAIDV 355

Query: 354 LASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPII 413
           L S+SR   +  +  E+++V     ++  +    ++  IG YR G D  +D+A+   P +
Sbjct: 356 LKSISRTMPECQTIPEREVVRQARKVLSAYSNMEELIRIGAYRTGADPDVDRAIQLNPAV 415

Query: 414 YDFLKQSPSDLSSED 428
            +FL+Q   + +  D
Sbjct: 416 EEFLRQGKDEYTPLD 430


>gi|27377312|ref|NP_768841.1| flagellum-specific ATP synthase [Bradyrhizobium japonicum USDA 110]
 gi|27350455|dbj|BAC47466.1| flagellum-specific ATP synthase [Bradyrhizobium japonicum USDA 110]
          Length = 441

 Score =  303 bits (776), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 156/346 (45%), Positives = 226/346 (65%), Gaps = 3/346 (0%)

Query: 94  RISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVID 153
           ++ PS  W GRV+NALG+PIDG   L +G   M   +  PPA +R+RV      G+R ++
Sbjct: 90  QVRPSTAWLGRVVNALGEPIDGKGPLPQGSSPMPFRNTPPPAHSRKRVGSPLDLGVRAMN 149

Query: 154 IFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-D 212
            F   C GQR+G+FAGSG+GKS LLSM AR+      +I L+GERGREV+EF++D LG +
Sbjct: 150 TFLTCCRGQRMGIFAGSGVGKSVLLSMLARNVDAAVSVIGLIGERGREVQEFLQDDLGEE 209

Query: 213 NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATN 272
            L +SVVVVATSDE  ++R+ A    + +AEYF  +  +VL ++DS+TRFA + REI  +
Sbjct: 210 GLARSVVVVATSDEPALMRRQAAYLTLAVAEYFRDEDKDVLCLMDSVTRFAMAQREIGLS 269

Query: 273 SGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSIL 332
           +GE P A+GY  +VF+ELP+LLER GP   E G ITA+ +VLVDGD+HN+PIAD+VR IL
Sbjct: 270 AGEPPTAKGYTPTVFTELPKLLERAGPGLGE-GAITAIFTVLVDGDDHNEPIADAVRGIL 328

Query: 333 DGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLI 392
           DGHIV+ RS+AE GRYP ++ L SVSR   K+   +    +     ++  + +  ++  +
Sbjct: 329 DGHIVMQRSIAERGRYPAINILKSVSRTMPKSADPEFWPTIQKARQVMATYADMEELIRL 388

Query: 393 GGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS-EDVFQEITKKL 437
           G YR G    +D+A+     +  FL+Q   + +S  D ++++ + L
Sbjct: 389 GAYRAGSSPEVDEAIRLHEPLEGFLRQRKDENASLADGYRQLAQIL 434


>gi|240137327|ref|YP_002961796.1| flagellum-specific ATP synthase [Methylobacterium extorquens AM1]
 gi|240007293|gb|ACS38519.1| flagellum-specific ATP synthase [Methylobacterium extorquens AM1]
          Length = 451

 Score =  303 bits (776), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 157/333 (47%), Positives = 213/333 (63%), Gaps = 2/333 (0%)

Query: 95  ISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDI 154
           I PSA W GR ++ALG+PIDG   L +G     + +  PPA  R+RV      G+R I+ 
Sbjct: 105 IRPSAAWLGRTVDALGRPIDGLGPLAQGPAIYPLRADPPPAHGRRRVGPPLDLGVRCINT 164

Query: 155 FTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DN 213
           F  +C GQR+G+FAGSG+GKS LLSM AR    D  +I LVGERGREV+EF++D LG   
Sbjct: 165 FLTMCRGQRMGIFAGSGVGKSVLLSMLARYTAADVAVIGLVGERGREVQEFLQDDLGAAG 224

Query: 214 LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNS 273
           L  SVVVVATSDE  ++R+ A    + +AEYF  +G  VL ++DSITRFA + R+I    
Sbjct: 225 LAHSVVVVATSDEPVLMRRNAAYVTLAVAEYFRDQGAQVLCMIDSITRFAMAQRDIGLAG 284

Query: 274 GELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILD 333
           GE P A+GY  +VFSELPRLLER GP   E G I+ + +VLV+GD+HN+P+AD+VR ILD
Sbjct: 285 GEPPTAKGYTPTVFSELPRLLERAGPGVGE-GAISGLFTVLVEGDDHNEPVADAVRGILD 343

Query: 334 GHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIG 393
           GHIV+ R +AE+GRYP ++ L SVSR   +A        V     ++  + +  ++  +G
Sbjct: 344 GHIVMERRIAEQGRYPAINVLRSVSRTMPRACDPAHLPTVRRARKVLATYADMEELIRLG 403

Query: 394 GYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
            YR G    +D+AV  +P +  FL Q   + +S
Sbjct: 404 AYRAGSSPEVDEAVALMPDLTAFLGQGKEEATS 436


>gi|170751942|ref|YP_001758202.1| flagellum-specific ATP synthase [Methylobacterium radiotolerans JCM
           2831]
 gi|170658464|gb|ACB27519.1| flagellar protein export ATPase FliI [Methylobacterium
           radiotolerans JCM 2831]
          Length = 450

 Score =  303 bits (776), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 173/408 (42%), Positives = 241/408 (59%), Gaps = 6/408 (1%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNL--GQVIRINLDIVYICPVGIGEEI 81
           G + +I  +   V      + LG  V  +G N   L   +VI    D     P G  E +
Sbjct: 29  GRVVAIRGLLVEVAGPVAAMRLGGRVDVEGANGHGLVPCEVIGFQGDRALAMPFGSLEGV 88

Query: 82  SLG--DLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQ 139
             G    V       I PS  W GRVI+ALG+P+DG   L +G     + +  PPA  R 
Sbjct: 89  RRGCPAYVRDESAGAIRPSGAWLGRVIDALGRPVDGLGPLAQGPDVYPLRADPPPAHART 148

Query: 140 RVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERG 199
           RV      G+R I+ F  +C GQR+G+FAGSG+GKS LLSM AR    D  +I LVGERG
Sbjct: 149 RVGGPLDLGVRCINTFLTMCAGQRMGIFAGSGVGKSVLLSMLARYTAADVAVIGLVGERG 208

Query: 200 REVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDS 258
           REV+EF++D LG   L +SVVVVATSDE  ++R+ A    +++AE+F  +G  VL ++DS
Sbjct: 209 REVQEFLQDDLGAAGLARSVVVVATSDEPALMRRNAAYVTLSVAEHFRDQGAKVLCMIDS 268

Query: 259 ITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGD 318
           ITRFA + R+I   +GE P A+GY  +VFSELPRLLER GP   + G I+A+ +VLV+GD
Sbjct: 269 ITRFAMAQRDIGLAAGEPPTAKGYTPTVFSELPRLLERAGPGVGQ-GTISALFTVLVEGD 327

Query: 319 NHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTH 378
           +HN+P+AD+VR ILDGHIV+ R++AE GRYP ++ L SVSR   ++       +V     
Sbjct: 328 DHNEPVADAVRGILDGHIVMERAIAERGRYPAINVLRSVSRTMPRSCDPAYLPVVRRARR 387

Query: 379 LIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
           L+  + +  ++  +G YR G    +D+AV  +P +  FL Q   + +S
Sbjct: 388 LLSTYADMEELIRLGAYRAGSSQEVDEAVALMPHLEAFLGQGKEEATS 435


>gi|332295033|ref|YP_004436956.1| ATPase, FliI/YscN family [Thermodesulfobium narugense DSM 14796]
 gi|332178136|gb|AEE13825.1| ATPase, FliI/YscN family [Thermodesulfobium narugense DSM 14796]
          Length = 435

 Score =  301 bits (772), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 186/435 (42%), Positives = 258/435 (59%), Gaps = 21/435 (4%)

Query: 3   KNLETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQV 62
           KNL+ L    EDY  N +   G I  I+   Y +  +   V +G+ V      S     V
Sbjct: 2   KNLKVLKDFIEDY--NYLPWNGTIDKISG--YVIESIGPKVSIGEIVYIDSGKSQIPCLV 57

Query: 63  IRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGR-----VINALGKPIDGDD 117
           I  + + VY+ P    E I  G +V   G+        W G+     V++ LG+P+  D+
Sbjct: 58  IGFSSNKVYLTPFDAIEGIEPGSIVKKTGK----QLGLWVGKHLLGQVLDGLGRPLS-DE 112

Query: 118 SLGKGDLSM--EIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKS 175
            + + D+S    I +K P  + R R+ +   TGIR ID    L  GQR+G+FAGSGIGK+
Sbjct: 113 YIQRDDMSQYRSIENKSPHPLKRGRIREPISTGIRAIDGLLTLGKGQRVGIFAGSGIGKT 172

Query: 176 TLLSMFARSDCFDKV-IISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKM 233
           TLL M +R  C  +V II+LVGERGREVREF+E+ LG D L KSVV+V+TSD  P  R +
Sbjct: 173 TLLGMISRF-CNAQVNIIALVGERGREVREFLEESLGEDGLAKSVVIVSTSDNPPSQRVL 231

Query: 234 APLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRL 293
           +  TA  IAEYF   G +VL+++DS+TR   + RE+  + GE P  RGYP SVF+ + RL
Sbjct: 232 SAFTATVIAEYFRDLGMDVLMVMDSLTRVCMAQRELGLSIGEPPTTRGYPPSVFTMMARL 291

Query: 294 LERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDP 353
           LER G S+K  G+IT + +VLV+GD+  +PIAD  RSILDGHIVL+R LAE G YPP+D 
Sbjct: 292 LERAGTSDK--GSITGIYTVLVEGDDLAEPIADHARSILDGHIVLSRDLAERGYYPPIDI 349

Query: 354 LASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPII 413
             SVSRL +     D   L   +  LI  ++E  D+  IG Y+ G +  +D+++ ++  I
Sbjct: 350 SQSVSRLMNSITDKDHLNLSYRIKELIASYKEAYDLINIGAYQKGSNSKIDESIEKISKI 409

Query: 414 YDFLKQSPSDLSSED 428
            +FLKQ+P D+SS D
Sbjct: 410 EEFLKQTPEDISSFD 424


>gi|78043388|ref|YP_359843.1| flagellum-specific ATP synthase [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|77995503|gb|ABB14402.1| flagellum-specific ATP synthase [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 434

 Score =  301 bits (771), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 170/404 (42%), Positives = 246/404 (60%), Gaps = 6/404 (1%)

Query: 35  TVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-F 93
           TV      V +G+ V     N+  L +V+    +   + P+G    ISLG LV    R  
Sbjct: 32  TVEAHGLKVSVGETVEILAGNARVLAEVVGFKEENAILMPLGEINGISLGSLVRPLRRQL 91

Query: 94  RISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVID 153
           +I+      G+V++ LG+P++ D   G+      +  K P  ++R+R++K F TGI+ ID
Sbjct: 92  QITVGKSLLGKVLDGLGRPLNADKIYGR---HFSLDRKPPKPLHRRRIKKPFATGIKAID 148

Query: 154 IFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN 213
                  GQR+G+FAGSG+GKSTLL M AR    D  +I+L+GERGREV +FIE+ LG+ 
Sbjct: 149 GPLTCGEGQRLGIFAGSGVGKSTLLGMIARYAEADVNVIALIGERGREVLDFIENDLGEG 208

Query: 214 LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNS 273
           +KKSV+VVATS++  + R      A  IAEYF  +G  VLL++DS+TRFA + REI   +
Sbjct: 209 IKKSVLVVATSEQPALFRVKGAFVATAIAEYFREQGKKVLLMMDSLTRFAMAQREIGLAA 268

Query: 274 GELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILD 333
           GE P +RGY  SVF+ LP+L+ER G    +KG+ITA  +VLV+GD+ N+PIAD+VR +LD
Sbjct: 269 GEPPSSRGYTPSVFALLPKLVERAG--NDDKGSITAFYTVLVEGDDFNEPIADAVRGLLD 326

Query: 334 GHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIG 393
           GHIVL+R LA +G YP +D LAS SRL  +        L   +  ++  + +  D+ LIG
Sbjct: 327 GHIVLSRQLAGKGHYPAIDLLASNSRLMPELVDEQHLALTLKMREILDIYRQNEDLILIG 386

Query: 394 GYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKL 437
            Y+PG + +LD+A+  VP I  FL+Q  ++       +E+ K L
Sbjct: 387 AYKPGTNPLLDRAIQLVPKINQFLQQKQNEKVDFTTTKEMLKTL 430


>gi|163738066|ref|ZP_02145482.1| ATP synthase FliI/YscN [Phaeobacter gallaeciensis BS107]
 gi|163742538|ref|ZP_02149924.1| H+-transporting two-sector ATPase, flagellum-specific [Phaeobacter
           gallaeciensis 2.10]
 gi|161384123|gb|EDQ08506.1| H+-transporting two-sector ATPase, flagellum-specific [Phaeobacter
           gallaeciensis 2.10]
 gi|161388682|gb|EDQ13035.1| ATP synthase FliI/YscN [Phaeobacter gallaeciensis BS107]
          Length = 442

 Score =  300 bits (769), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 167/419 (39%), Positives = 257/419 (61%), Gaps = 4/419 (0%)

Query: 5   LETLAQLAEDYS-KNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNL-GQV 62
           +  +  L +D + K L    G +S I+    TV+ L+    +GD ++ +   SD L G+V
Sbjct: 2   ISAINALTQDLANKKLSSAVGRVSEISGGAITVSGLNGQARIGDRLILRRAGSDPLEGEV 61

Query: 63  IRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKG 122
           +RI+   V + P    + +++GD V        +P+  W GRVI+  G P+DG   + +G
Sbjct: 62  MRISGSEVSMLPDTAPDRVAVGDAVLLHPTPDFAPADSWIGRVIDPFGAPLDGRPMM-RG 120

Query: 123 DLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFA 182
           + + ++M+  P A +R+ + +   TG+ V +   P+  GQR+G+FAGSG+GKSTLL+  A
Sbjct: 121 EATRDLMAAPPKAASRRPMGERLATGLAVFNTILPIVKGQRVGLFAGSGVGKSTLLATLA 180

Query: 183 RSDCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTI 241
           ++   D V+I+L+GERGREV  F++D LGD  ++++VVV ATSD+S ++R+    +A+ +
Sbjct: 181 QNMEADVVVIALIGERGREVNHFVKDVLGDEGMQRAVVVAATSDQSALVRRRCAWSAMAV 240

Query: 242 AEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSE 301
           AE+F  +G NVL + DS+TRFA + REIA +SGE P  RGYP SV   +  L ER GP  
Sbjct: 241 AEHFRDQGKNVLFLADSVTRFAEAHREIAVSSGEAPALRGYPPSVTPLITGLCERAGPGS 300

Query: 302 KEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLA 361
            ++G+ITA+ SVLV G + ++PIAD +R +LDGHIVLNR +AE GR+P VD   SVSR  
Sbjct: 301 GDQGDITAIFSVLVAGSDMDEPIADILRGVLDGHIVLNREIAERGRFPAVDVSRSVSRSL 360

Query: 362 DKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQS 420
             A +ADE   +  +   +  +E++  +   G Y  G D+ LD+AV   P +  F  +S
Sbjct: 361 PAAATADENSAILDVRKYLGAYEQSEVMIRAGLYSEGNDVTLDQAVKLWPELDSFFGRS 419


>gi|259417146|ref|ZP_05741065.1| flagellum-specific ATP synthase [Silicibacter sp. TrichCH4B]
 gi|259346052|gb|EEW57866.1| flagellum-specific ATP synthase [Silicibacter sp. TrichCH4B]
          Length = 447

 Score =  300 bits (769), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 167/425 (39%), Positives = 259/425 (60%), Gaps = 5/425 (1%)

Query: 1   MQKNLETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGD-FVVHQGKNSDNL 59
           M K+++ L+Q  E  +  L    G ++ I+     V+ L     +GD  V+ +GK  D  
Sbjct: 6   MMKSIQALSQ--ELANTRLAAPMGRVTGISGGEIEVSGLETQARIGDRLVLRRGKKDDLH 63

Query: 60  GQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSL 119
           G+V+ I  + + + P    E  S+GD V  +     +P   W GRVI+  G+P+DG   L
Sbjct: 64  GEVLAIGANHIRMLPDTAPERASIGDAVLLFETPEFAPDNSWIGRVIDPFGEPLDGKPML 123

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
            +G  S ++M   P A  R+ + K   TG+ +++   P+  GQRIG+FAGSG+GKSTL++
Sbjct: 124 -RGVESRDLMESPPKAAARRGLGKRLSTGLAILNTVLPIVTGQRIGLFAGSGVGKSTLMA 182

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTA 238
             A++   D V+++L+GERGREV  F+++ LG + +K++VVV ATSD+S ++R+    +A
Sbjct: 183 QLAQNMEADVVVMALIGERGREVNHFVKEVLGPEGMKRAVVVAATSDQSALVRRRCAWSA 242

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
           +++AE+F  +G NVL + DSITRFA + REIA  SGE P  RG+P SV   +  L ER G
Sbjct: 243 MSVAEHFRDQGLNVLFMADSITRFAEAHREIAVASGEAPALRGFPPSVTPLITGLCERAG 302

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
           P  + +G+ITAV SVLV G + ++PIAD +R +LDGHIVLNR +AE GR+P +D   SVS
Sbjct: 303 PGLEGQGDITAVFSVLVAGSDMDEPIADILRGVLDGHIVLNREIAERGRFPAIDVSRSVS 362

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R    A + +E +++ ++   +  +E++  +   G Y  G DL+LD+AV   P +  F  
Sbjct: 363 RSLPAAATKEENEMILAVRKFLGAYEQSEVMIRAGLYSEGNDLVLDQAVKIWPELDSFFG 422

Query: 419 QSPSD 423
           +  +D
Sbjct: 423 RDETD 427


>gi|20807886|ref|NP_623057.1| flagellar biosynthesis/type III secretory pathway ATPase
           [Thermoanaerobacter tengcongensis MB4]
 gi|254478883|ref|ZP_05092247.1| flagellar protein export ATPase FliI [Carboxydibrachium pacificum
           DSM 12653]
 gi|20516451|gb|AAM24661.1| Flagellar biosynthesis/type III secretory pathway ATPase
           [Thermoanaerobacter tengcongensis MB4]
 gi|214035196|gb|EEB75906.1| flagellar protein export ATPase FliI [Carboxydibrachium pacificum
           DSM 12653]
          Length = 437

 Score =  300 bits (768), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 169/363 (46%), Positives = 235/363 (64%), Gaps = 5/363 (1%)

Query: 59  LGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDD 117
           L +V+    + VY+ P+G  E I  G  V   G+  +++      GRV++ LG PIDG  
Sbjct: 57  LAEVVGFKEEKVYLMPLGNMEGIGPGSKVIATGQTLKVNVGKSLLGRVLDGLGNPIDGKG 116

Query: 118 SLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
            L K + S+ + +  P  + R+R+ +    GI+ ID       GQRIG+FAGSG+GKSTL
Sbjct: 117 PL-KYEKSIPVNNTPPDPLERKRIREVMPLGIKAIDGLLTCGKGQRIGIFAGSGVGKSTL 175

Query: 178 LSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPL 236
           L M AR+   D  +I+L+GERGREV EFIE  LG+  LK+SVVVVATSD   ++R    +
Sbjct: 176 LGMMARNAKADLNVIALIGERGREVNEFIEKDLGEEGLKRSVVVVATSDTPALVRVKGAM 235

Query: 237 TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLER 296
           TA  IAEYF  +G +VLL++DSITRFA + REI  + GE PV+RGY  SVFS LP+LLER
Sbjct: 236 TATAIAEYFRDQGLDVLLMMDSITRFAMAQREIGLSIGEAPVSRGYTPSVFSVLPKLLER 295

Query: 297 IGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLAS 356
            G S+K  G+ITA+ +VLVDGD+ N+PIAD+VR ILDGHIVL+R LA +  YP +D LAS
Sbjct: 296 SGSSQK--GSITALYTVLVDGDDLNEPIADAVRGILDGHIVLSRKLANKNHYPAIDVLAS 353

Query: 357 VSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDF 416
           VSR+ +   + + K+LV+   +++  + E  D+  IG Y  G +  +D+A+     +  F
Sbjct: 354 VSRVINDIITDEHKELVAKFKNILATYAEAEDLINIGAYNFGTNPKIDEAIELNEKMNSF 413

Query: 417 LKQ 419
           L+Q
Sbjct: 414 LRQ 416


>gi|302382319|ref|YP_003818142.1| ATPase, FliI/YscN family [Brevundimonas subvibrioides ATCC 15264]
 gi|302192947|gb|ADL00519.1| ATPase, FliI/YscN family [Brevundimonas subvibrioides ATCC 15264]
          Length = 446

 Score =  299 bits (765), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 151/337 (44%), Positives = 212/337 (62%), Gaps = 6/337 (1%)

Query: 95  ISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDI 154
           + P+  W GR+I+A G+PIDG   L +G     + +  P A +R RV +    G+R +D+
Sbjct: 91  VYPTTAWLGRIIDAFGQPIDGKGPLPQGPAPYPLRAAPPAAHSRGRVGERLDLGVRSMDV 150

Query: 155 FTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DN 213
           FT  C GQR+G+FAGSG+GKS LLSM AR    D V++ L+GERGREVREFIE+ LG + 
Sbjct: 151 FTTTCRGQRLGIFAGSGVGKSVLLSMLARQATCDAVVVGLIGERGREVREFIEETLGEEG 210

Query: 214 LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNS 273
           L++++VVVATSDE  + R+ A    + I+EY   +   VL ++DS+TRFA + REI   +
Sbjct: 211 LRRAIVVVATSDEPALKRRQAAYMTMAISEYLRDQDLEVLCLMDSVTRFAMAQREIGLAA 270

Query: 274 GELPVARGYPTSVFSELPRLLERIGPSE-----KEKGNITAVISVLVDGDNHNDPIADSV 328
           GE P  +GY  +VFSELP+LLER GP            ITA+ +VLVDG +H++PIAD+V
Sbjct: 271 GEPPTTKGYTPTVFSELPKLLERAGPGPIRPDGTTAAPITAMFTVLVDGGDHDEPIADAV 330

Query: 329 RSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRD 388
           R ILDGHIV++R +AE GR+P +D L SVSR      +  E++L       +  +    +
Sbjct: 331 RGILDGHIVMDRKIAERGRFPAIDVLKSVSRTLPGCQTPPERELNRRARQCLSAYSSMEE 390

Query: 389 IRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLS 425
           +  IG YR G D I D+A+   P +  FL Q   D++
Sbjct: 391 LIKIGAYRAGADPITDRAIALNPALEAFLGQDKDDVT 427


>gi|99082806|ref|YP_614960.1| ATP synthase FliI/YscN [Ruegeria sp. TM1040]
 gi|99039086|gb|ABF65698.1| flagellum-specific ATP synthase [Ruegeria sp. TM1040]
          Length = 442

 Score =  299 bits (765), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 167/425 (39%), Positives = 257/425 (60%), Gaps = 5/425 (1%)

Query: 1   MQKNLETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGD-FVVHQGKNSDNL 59
           M K+++ L+Q  E  +  L    G ++ I+     V+ L     +GD   + +GK  D  
Sbjct: 1   MMKSIQALSQ--ELANTRLAAPMGRVTGISGGEIEVSGLESQARIGDRLTLRRGKKDDLH 58

Query: 60  GQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSL 119
           G+V+ I  D + + P    E  S+GD V  +     +P   W GRVI+  G+P+DG   L
Sbjct: 59  GEVLAIGSDHIRMLPDTAPERASIGDAVLLFQTPEFAPDDSWVGRVIDPFGEPLDGKPML 118

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
            +G  S ++M   P A  R+ + K   TG+ +++   P+  GQRIG+FAGSG+GKSTL++
Sbjct: 119 -RGVESRDLMESPPKAAARRGLGKRLSTGLAILNTVLPIVTGQRIGLFAGSGVGKSTLMA 177

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTA 238
             A++   D V+++L+GERGREV  F+++ LG + +K++VVV ATSD+S ++R+     A
Sbjct: 178 QLAQNMEADVVVMALIGERGREVNHFVKEVLGPEGMKRAVVVAATSDQSALVRRRCAWAA 237

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
           +++AE+F  +G NVL + DSITRFA + REIA  SGE P  RG+P SV   +  L ER G
Sbjct: 238 MSVAEHFRDQGLNVLFMADSITRFAEAHREIAVASGEAPALRGFPPSVTPLITGLCERAG 297

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
           P  + +G+ITAV SVLV G + ++PIAD +R +LDGHIVLNR +AE GR+P +D   SVS
Sbjct: 298 PGLEGQGDITAVFSVLVAGSDMDEPIADILRGVLDGHIVLNREIAERGRFPAIDVSRSVS 357

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R    A + +E +++ ++   +  +E++  +   G Y  G DL+LD+AV   P +  F  
Sbjct: 358 RSLPAAATKEENEMILAVRKFLGAYEQSEVMIRAGLYSEGNDLVLDQAVKIWPELDSFFG 417

Query: 419 QSPSD 423
           ++  D
Sbjct: 418 RNELD 422


>gi|148257762|ref|YP_001242347.1| flagellum-specific ATP synthase [Bradyrhizobium sp. BTAi1]
 gi|146409935|gb|ABQ38441.1| flagellum-specific ATP synthase [Bradyrhizobium sp. BTAi1]
          Length = 440

 Score =  299 bits (765), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 150/327 (45%), Positives = 215/327 (65%), Gaps = 2/327 (0%)

Query: 94  RISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVID 153
           ++ PS  W GRVINA+G+PIDG   L +G   +   +  PPA +R+RV      G+R ++
Sbjct: 89  QVRPSPAWLGRVINAMGEPIDGKGPLPQGAAPVPYRNNPPPAHSRKRVGSPLDLGVRALN 148

Query: 154 IFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-D 212
            F   C GQR+G+FAGSG+GKS LLSM AR+      +I L+GERGREV+EF++D LG +
Sbjct: 149 TFLTCCRGQRLGIFAGSGVGKSVLLSMLARNVDAAVSVIGLIGERGREVQEFLQDDLGEE 208

Query: 213 NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATN 272
            L +SVVVVATSDE  ++R+ A    + I+EYF  +G +VL ++DS+TRFA + REI  +
Sbjct: 209 GLARSVVVVATSDEPALMRRQAAYLTLAISEYFRDEGKDVLCLMDSVTRFAMAQREIGLS 268

Query: 273 SGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSIL 332
           +GE P A+GY  +VF+ELP+LLER GP   E G IT + +VLVDGD+HN+P+AD+VR IL
Sbjct: 269 AGEPPTAKGYTPTVFTELPKLLERAGPGSGE-GTITGIFTVLVDGDDHNEPVADAVRGIL 327

Query: 333 DGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLI 392
           DGH+V+ RS+AE GRYP ++ L SVSR   K+        +     ++  + +  ++  +
Sbjct: 328 DGHVVMQRSIAERGRYPAINILKSVSRTMPKSADPVFLPTIMRARQVMATYADMEELIRL 387

Query: 393 GGYRPGVDLILDKAVHQVPIIYDFLKQ 419
           G YR G    +D+A+     +  FL+Q
Sbjct: 388 GAYRAGSSPEVDEAIRLHEPLEAFLRQ 414


>gi|16127270|ref|NP_421834.1| flagellum-specific ATP synthase [Caulobacter crescentus CB15]
 gi|221236071|ref|YP_002518508.1| flagellum-specific ATP synthase [Caulobacter crescentus NA1000]
 gi|239977229|sp|B8H363|FLII_CAUCN RecName: Full=Flagellum-specific ATP synthase
 gi|239977230|sp|P0CAT8|FLII_CAUCR RecName: Full=Flagellum-specific ATP synthase
 gi|13424682|gb|AAK25002.1| flagellum-specific ATP synthase FliI [Caulobacter crescentus CB15]
 gi|220965244|gb|ACL96600.1| flagellum-specific ATP synthase fliL [Caulobacter crescentus
           NA1000]
          Length = 444

 Score =  298 bits (763), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 152/351 (43%), Positives = 222/351 (63%), Gaps = 7/351 (1%)

Query: 95  ISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDI 154
           + P+  W GR+INA G+PIDG   L +G++   + +  PPA  R RV +    G+R +++
Sbjct: 91  VRPTKAWLGRIINAFGEPIDGLGPLPQGEVPYPLKTPPPPAHARGRVGERLDLGVRSMNV 150

Query: 155 FTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DN 213
           FT  C GQR+G+FAGSG+GKS LLSM A+    D V++ L+GERGREVREF+E+ LG + 
Sbjct: 151 FTTTCRGQRLGIFAGSGVGKSVLLSMLAKEATCDAVVVGLIGERGREVREFVEETLGEEG 210

Query: 214 LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNS 273
           L+++VVVVATSDE  + R+ A    + I+E+   +   VL ++DS+TRFA + REI   +
Sbjct: 211 LRRAVVVVATSDEPALTRRQAAYMTLAISEFMRDQDQEVLCLMDSVTRFAMAQREIGLAA 270

Query: 274 GELPVARGYPTSVFSELPRLLERIGPSE-----KEKGNITAVISVLVDGDNHNDPIADSV 328
           GE P  +GY  +VF+ELP+LLER GP            ITA+ +VLVDGD+HN+PIAD+ 
Sbjct: 271 GEPPTTKGYTPTVFTELPKLLERAGPGPIRPDGTTAAPITALFTVLVDGDDHNEPIADAT 330

Query: 329 RSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRD 388
           R ILDGHIV+ R++AE GR+P ++ L S+SR         E+ +V     ++  +    +
Sbjct: 331 RGILDGHIVMERAIAERGRFPAINVLKSISRTMPGCQHPHERDIVKGARQVMSAYSNMEE 390

Query: 389 IRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS-EDVFQEITKKLQ 438
           +  IG YR G D ++D+A+   P I  FL Q   + +S +D F  + + LQ
Sbjct: 391 LIRIGAYRAGADPVVDRAIRLNPAIEAFLSQDKEEATSLDDSFGMLGQILQ 441


>gi|157738148|ref|YP_001490832.1| flagellum-specific ATP synthase [Arcobacter butzleri RM4018]
 gi|315636291|ref|ZP_07891541.1| flagellum-specific ATP synthase FliI [Arcobacter butzleri JV22]
 gi|157700002|gb|ABV68162.1| flagellum-specific ATP synthase FliI [Arcobacter butzleri RM4018]
 gi|315479380|gb|EFU70063.1| flagellum-specific ATP synthase FliI [Arcobacter butzleri JV22]
          Length = 435

 Score =  298 bits (762), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 176/428 (41%), Positives = 255/428 (59%), Gaps = 10/428 (2%)

Query: 16  SKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNS--DNLGQVIRINLDIVYIC 73
           S +L +  G I++I+++  T+T +   V +GD V  + +      LG V  IN     I 
Sbjct: 13  SASLPIAFGRITNISAI--TLTAIGLEVAVGDIVRIESEQRLYSVLGMVTTINDSSFIIV 70

Query: 74  PVGIGEEISLGDLVF-HWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKV 132
           P    E   + D VF       +       GRV+NALG+PID    +   D +  I    
Sbjct: 71  PFSFIEGFKINDKVFLQRDGLTVKCGNGLLGRVVNALGEPIDNKGKIRDLDENSAINKIS 130

Query: 133 PPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKV-I 191
              + R  +++ F TG++ ID       GQ++G+FAGSG+GKSTL+ M  +  C  +V +
Sbjct: 131 MSPLERGIIDQKFSTGVKAIDSMLTCGKGQKVGIFAGSGVGKSTLMGMIVKG-CEAQVKV 189

Query: 192 ISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDN 251
           ++LVGERGRE+ EFI   L D+L+ +V+V ATSDES ++RK    TA++IAEYF  KG +
Sbjct: 190 VALVGERGREIPEFIHYNLNDDLENTVIVAATSDESALMRKYGAFTAMSIAEYFRDKGLD 249

Query: 252 VLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVI 311
           VLL++DS+TRFA + REI  ++GE PV+RGYP SVF+ LP+L+ER G    +KG+ITA  
Sbjct: 250 VLLMMDSVTRFAMAQREIGLSTGEPPVSRGYPPSVFALLPQLMERAG--NNQKGSITAFF 307

Query: 312 SVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKK 371
           +VLVDGD+ NDPIAD  RSILDGHIVL R L E+G YPP++ L S SR+ DK  + +   
Sbjct: 308 TVLVDGDDMNDPIADQSRSILDGHIVLTRELTEQGFYPPINLLKSASRVMDKVVTKEHYN 367

Query: 372 LVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSD-LSSEDVF 430
               L  ++   +E   +  +G Y+ G+D  LD A+ +   I +FL QS  + +S +++ 
Sbjct: 368 DFLKLKRVLSLIKENEVLVRVGAYKKGMDPELDNAMARKERIREFLTQSTQENVSFDEII 427

Query: 431 QEITKKLQ 438
               K LQ
Sbjct: 428 TNFRKVLQ 435


>gi|329888160|ref|ZP_08266758.1| flagellum-specific ATP synthase [Brevundimonas diminuta ATCC 11568]
 gi|328846716|gb|EGF96278.1| flagellum-specific ATP synthase [Brevundimonas diminuta ATCC 11568]
          Length = 357

 Score =  298 bits (762), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 155/337 (45%), Positives = 217/337 (64%), Gaps = 6/337 (1%)

Query: 95  ISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDI 154
           + P+  W GR+I++ G+PIDG   L  G +   + +  PPA +R RV +    G+R +D+
Sbjct: 1   MRPTTAWLGRIIDSFGEPIDGLGPLTPGLVPYPLRAPPPPAHSRGRVGERLDLGVRAMDV 60

Query: 155 FTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DN 213
           FT    GQR+G+FAGSG+GKS LLSM AR    D V++ L+GERGREVREFIE+ LG + 
Sbjct: 61  FTTTSRGQRLGIFAGSGVGKSVLLSMLARQATCDVVVVGLIGERGREVREFIEETLGEEG 120

Query: 214 LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNS 273
           LK++VVVVATSDE  + R+ A    + +AE+F  +G  VL ++DS+TRFA + REI   +
Sbjct: 121 LKRAVVVVATSDEPALKRRQAAYMTMAVAEFFRDQGLEVLCLMDSVTRFAMAQREIGLAA 180

Query: 274 GELPVARGYPTSVFSELPRLLERIGPSE-----KEKGNITAVISVLVDGDNHNDPIADSV 328
           GE P  +GY  +VF+ELP+LLER GP        E G ITA+ +VLVDG +H++PIAD+V
Sbjct: 181 GEPPTTKGYTPTVFTELPKLLERAGPGPIRPDGTEAGPITALFTVLVDGGDHDEPIADAV 240

Query: 329 RSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRD 388
           R ILDGHIV++R +AE GR+P +D L SVSR      S  E++L       +  +    +
Sbjct: 241 RGILDGHIVMDRKIAERGRFPAIDVLKSVSRTMPGNQSPPERELNRRARQCLSAYSNMEE 300

Query: 389 IRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLS 425
           +  IG YR G D I+D+A+   P +  FL Q   D++
Sbjct: 301 LIRIGAYRTGADPIVDRAIALNPALEGFLTQDKDDVT 337


>gi|146338576|ref|YP_001203624.1| flagellum-specific ATP synthase [Bradyrhizobium sp. ORS278]
 gi|146191382|emb|CAL75387.1| flagellum-specific ATP synthase [Bradyrhizobium sp. ORS278]
          Length = 441

 Score =  298 bits (762), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 149/327 (45%), Positives = 214/327 (65%), Gaps = 2/327 (0%)

Query: 94  RISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVID 153
           ++ PS  W GRV+NA+G+PIDG   L  G   +   +  PPA +R+RV      G+R ++
Sbjct: 90  QVRPSPAWLGRVVNAMGEPIDGKGPLPSGAAPVPYRNNPPPAHSRKRVGAPLDLGVRALN 149

Query: 154 IFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-D 212
            F   C GQR+G+FAGSG+GKS LLSM AR+      +I L+GERGREV+EF++D LG +
Sbjct: 150 TFLTCCRGQRLGIFAGSGVGKSVLLSMLARNVDAAVSVIGLIGERGREVQEFLQDDLGEE 209

Query: 213 NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATN 272
            L +SVVVVATSDE  ++R+ A    + I+EYF  +G +VL ++DS+TRFA + REI  +
Sbjct: 210 GLARSVVVVATSDEPALMRRQAAYLTLAISEYFRDEGKDVLCLMDSVTRFAMAQREIGLS 269

Query: 273 SGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSIL 332
           +GE P A+GY  +VF+ELP+LLER GP   E G IT + +VLVDGD+HN+P+AD+VR IL
Sbjct: 270 AGEPPTAKGYTPTVFTELPKLLERAGPGSGE-GTITGIFTVLVDGDDHNEPVADAVRGIL 328

Query: 333 DGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLI 392
           DGH+V+ RS+AE GRYP ++ L SVSR   K+        +     ++  + +  ++  +
Sbjct: 329 DGHVVMQRSIAERGRYPAINILKSVSRTMPKSADPVFLPTIMRARQVMATYADMEELIRL 388

Query: 393 GGYRPGVDLILDKAVHQVPIIYDFLKQ 419
           G YR G    +D+A+     +  FL+Q
Sbjct: 389 GAYRAGSSPEVDEAIRLHEPLETFLRQ 415


>gi|332297612|ref|YP_004439534.1| ATPase, FliI/YscN family [Treponema brennaborense DSM 12168]
 gi|332180715|gb|AEE16403.1| ATPase, FliI/YscN family [Treponema brennaborense DSM 12168]
          Length = 452

 Score =  298 bits (762), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 168/371 (45%), Positives = 230/371 (61%), Gaps = 8/371 (2%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSL 119
           +V+ +N   V +   G  + I +G  V   G   R++      GRVI+A+GKP DG   L
Sbjct: 59  EVVGLNGTTVQLMAYGETKGIEIGCEVVATGHVLRVAVGNGLLGRVIDAVGKPYDGKGEL 118

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
             G L    ++  P  + R+ V +   TG+R ID    +  GQR+G+FAGSG+GKSTLLS
Sbjct: 119 ASG-LYYPALASPPAPLERRPVSQRMVTGVRAIDAMLAVAKGQRLGIFAGSGVGKSTLLS 177

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTA 238
           M AR+   D  +I+LVGERGREV +FI+  LG+  LK+SVVVVATSD+  I R  A  TA
Sbjct: 178 MIARNTKADVNVIALVGERGREVVDFIDRDLGEEGLKRSVVVVATSDQPSIARLRAAYTA 237

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
             +AEYF  +G +V+L+ DS+TRFAH+ REI   SGE P  RGYP SVF  LP+LLER G
Sbjct: 238 TAVAEYFRDQGKDVMLMFDSVTRFAHAQREIGLASGEPPAQRGYPPSVFDLLPKLLERSG 297

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
               + G+ITA  +VLVDGD+ ++PIAD VR  LDGHIVLNR LA+   +P +D LAS+S
Sbjct: 298 --TNQTGSITAFYTVLVDGDDMDEPIADKVRGTLDGHIVLNRKLAQAAHFPAIDVLASIS 355

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           RL+ +      ++ V+++  L+  + E  D+  +G Y+ G +  +DKA+   P I  FL 
Sbjct: 356 RLSKRVSGPATQQAVTTVRRLMASYAENEDMITVGAYQKGSNAAIDKAIDVHPDIEAFLM 415

Query: 419 Q---SPSDLSS 426
           Q    P+ L S
Sbjct: 416 QDEYEPAPLES 426


>gi|291278940|ref|YP_003495775.1| flagellar-specific ATP synthase FliI [Deferribacter desulfuricans
           SSM1]
 gi|290753642|dbj|BAI80019.1| flagellar-specific ATP synthase FliI [Deferribacter desulfuricans
           SSM1]
          Length = 436

 Score =  297 bits (760), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 180/439 (41%), Positives = 262/439 (59%), Gaps = 15/439 (3%)

Query: 3   KNLETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDN-LGQ 61
           K L+ L  +  D   N VV  G ++ I  V  T+      + +G     +G    N L +
Sbjct: 2   KKLKLLKNINFD---NSVVVTGKVTKI--VGLTIEADGPLLSIGTRCEIEGVGGKNILAE 56

Query: 62  VIRINLDIVYICPVGIGEEISLGDLVFH--WGRFRISPSACWCGRVINALGKPIDGDDSL 119
           ++    D V + P    E I+ G +V +  +G   +  S    GRV++ LG+PID +  +
Sbjct: 57  IVGFKDDRVILMPYAESEGIAPGSIVRNVAYGNV-VKVSEELLGRVLDGLGRPIDSNRVI 115

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
              +L   + ++ P  + R+ ++    TG++ ID    +  GQR+G+FAGSG+GKS LL 
Sbjct: 116 TNYELK-SVYTEPPSPLEREIIKDAIHTGVKAIDALITIGKGQRVGIFAGSGVGKSVLLG 174

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPLTA 238
           M AR+   D  +I+L+GERGREVREFIE  LG+  LKKSVVVVATSD+SP++RKM    A
Sbjct: 175 MIARNSSADVNVIALIGERGREVREFIERDLGEEGLKKSVVVVATSDQSPLVRKMGAFVA 234

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
            TIAEYF S G +V+ ++DS+TRFA + REI    GE P  +GY  SVF+ LP+LLER G
Sbjct: 235 TTIAEYFRSLGKDVMFMMDSVTRFAMAQREIGLTVGEPPTTKGYTPSVFALLPKLLERAG 294

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
            ++K +G IT + +VLV+GD+ NDPIADSVRSI+DGHIVL+R+LA +  +P +D + S S
Sbjct: 295 -TKKGEGTITGLYTVLVEGDDLNDPIADSVRSIIDGHIVLDRNLAAKNHFPAIDVMMSAS 353

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           RL  +       +    L  LI  + E  D+  IG Y  G +  +D+A+ ++ +I +FLK
Sbjct: 354 RLMKEIVDERHFEAAGRLRDLIATYREAEDLINIGAYVKGSNKKIDEAILKIDLINNFLK 413

Query: 419 QSPSDLSSEDVFQEITKKL 437
           Q   + S    F+E  K+L
Sbjct: 414 QKIDETSP---FEETKKQL 429


>gi|254418613|ref|ZP_05032337.1| ATPase FliI/YscN family [Brevundimonas sp. BAL3]
 gi|196184790|gb|EDX79766.1| ATPase FliI/YscN family [Brevundimonas sp. BAL3]
          Length = 447

 Score =  297 bits (760), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 151/337 (44%), Positives = 214/337 (63%), Gaps = 6/337 (1%)

Query: 95  ISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDI 154
           + P+  W GR+I+A G PIDG   L +G +   + +  PPA +R RV +    G+R +D+
Sbjct: 91  VRPTTAWLGRIIDAFGNPIDGKGPLPQGPVPYPLRAPPPPAHSRGRVGERLDLGVRAMDV 150

Query: 155 FTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DN 213
           FT  C GQR+G+FAGSG+GKS LLSM A+    D V++ L+GERGREVREF+E+ LG + 
Sbjct: 151 FTTTCRGQRLGIFAGSGVGKSVLLSMLAKQATCDAVVVGLIGERGREVREFVEETLGEEG 210

Query: 214 LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNS 273
           L+++VVVVATSDE  + R+ +    + IAEY   +   VL ++DS+TRFA + REI   +
Sbjct: 211 LRRAVVVVATSDEPALKRRQSAYMTMAIAEYLRDQDLEVLCLMDSVTRFAMAQREIGLAA 270

Query: 274 GELPVARGYPTSVFSELPRLLERIGPSE-----KEKGNITAVISVLVDGDNHNDPIADSV 328
           GE P  +GY  +VF+ELP+LLER GP            ITA+ +VLVDG +H++PIAD+V
Sbjct: 271 GEPPTTKGYTPTVFTELPKLLERAGPGPVRPDGTTAAPITALFTVLVDGGDHDEPIADAV 330

Query: 329 RSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRD 388
           R ILDGHIV++R +AE GR+P +D L SVSR      +  E++L       +  +    +
Sbjct: 331 RGILDGHIVMDRKIAERGRFPAIDVLKSVSRTMPACQTPPERELNKRARQCLSAYANMEE 390

Query: 389 IRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLS 425
           +  IG YR G D I+D+A+   P + DFL Q   D +
Sbjct: 391 LIKIGAYRTGADPIVDRAIALNPALEDFLSQDKDDAT 427


>gi|256750743|ref|ZP_05491628.1| ATPase, FliI/YscN family [Thermoanaerobacter ethanolicus CCSD1]
 gi|300914411|ref|ZP_07131727.1| flagellar protein export ATPase FliI [Thermoanaerobacter sp. X561]
 gi|307724353|ref|YP_003904104.1| ATPase, FliI/YscN family [Thermoanaerobacter sp. X513]
 gi|320116081|ref|YP_004186240.1| FliI/YscN family ATPase [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|256750326|gb|EEU63345.1| ATPase, FliI/YscN family [Thermoanaerobacter ethanolicus CCSD1]
 gi|300889346|gb|EFK84492.1| flagellar protein export ATPase FliI [Thermoanaerobacter sp. X561]
 gi|307581414|gb|ADN54813.1| ATPase, FliI/YscN family [Thermoanaerobacter sp. X513]
 gi|319929172|gb|ADV79857.1| ATPase, FliI/YscN family [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
          Length = 432

 Score =  297 bits (760), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 167/363 (46%), Positives = 235/363 (64%), Gaps = 5/363 (1%)

Query: 59  LGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDD 117
           L +V+    + VY+ P+G  E I  G  V   G+  R++      GRV++ LG PIDG  
Sbjct: 52  LAEVVGFKEEKVYLMPLGNMEGIGAGSKVIATGQTLRVNVGNELLGRVLDGLGNPIDGKG 111

Query: 118 SLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
            + K + S+ I +  P  + R+R+ +    GI+ ID       GQRIG+FAGSG+GKSTL
Sbjct: 112 PI-KFEKSIPINNVPPDPLERKRIREVMSLGIKAIDGLLTCGKGQRIGIFAGSGVGKSTL 170

Query: 178 LSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPL 236
           L M AR+   D  +I+L+GERGREV EF+E  LG+  LKKSVVVVATSD   ++R    +
Sbjct: 171 LGMMARNAKADLNVIALIGERGREVNEFLEKDLGEEGLKKSVVVVATSDTPALIRVKGAM 230

Query: 237 TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLER 296
           TA  IAEYF  +G +VLL++DS+TRFA + RE+  + GE PV+RGY  SVFS LP+LLER
Sbjct: 231 TATAIAEYFRDQGLDVLLMMDSVTRFAMAQREVGLSIGEAPVSRGYTPSVFSVLPKLLER 290

Query: 297 IGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLAS 356
            G S+K  G+ITA+ +VLVDGD+ N+PIAD+VR ILDGHIVL+R LA +  YP +D LAS
Sbjct: 291 SGCSKK--GSITALYTVLVDGDDLNEPIADAVRGILDGHIVLSRKLANKNHYPAIDVLAS 348

Query: 357 VSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDF 416
           VSR+ +   + + K+L++    ++  + E  D+  IG Y  G +  +D+A+     + +F
Sbjct: 349 VSRVINDIITEEHKELIARFKDILATYTEAEDLINIGAYNFGSNPKIDEAIELNDKMNNF 408

Query: 417 LKQ 419
           L+Q
Sbjct: 409 LRQ 411


>gi|167037666|ref|YP_001665244.1| flagellar protein export ATPase FliI [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|167040327|ref|YP_001663312.1| flagellar protein export ATPase FliI [Thermoanaerobacter sp. X514]
 gi|166854567|gb|ABY92976.1| flagellar protein export ATPase FliI [Thermoanaerobacter sp. X514]
 gi|166856500|gb|ABY94908.1| flagellar protein export ATPase FliI [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
          Length = 437

 Score =  296 bits (759), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 167/363 (46%), Positives = 235/363 (64%), Gaps = 5/363 (1%)

Query: 59  LGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDD 117
           L +V+    + VY+ P+G  E I  G  V   G+  R++      GRV++ LG PIDG  
Sbjct: 57  LAEVVGFKEEKVYLMPLGNMEGIGAGSKVIATGQTLRVNVGNELLGRVLDGLGNPIDGKG 116

Query: 118 SLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
            + K + S+ I +  P  + R+R+ +    GI+ ID       GQRIG+FAGSG+GKSTL
Sbjct: 117 PI-KFEKSIPINNVPPDPLERKRIREVMSLGIKAIDGLLTCGKGQRIGIFAGSGVGKSTL 175

Query: 178 LSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPL 236
           L M AR+   D  +I+L+GERGREV EF+E  LG+  LKKSVVVVATSD   ++R    +
Sbjct: 176 LGMMARNAKADLNVIALIGERGREVNEFLEKDLGEEGLKKSVVVVATSDTPALIRVKGAM 235

Query: 237 TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLER 296
           TA  IAEYF  +G +VLL++DS+TRFA + RE+  + GE PV+RGY  SVFS LP+LLER
Sbjct: 236 TATAIAEYFRDQGLDVLLMMDSVTRFAMAQREVGLSIGEAPVSRGYTPSVFSVLPKLLER 295

Query: 297 IGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLAS 356
            G S+K  G+ITA+ +VLVDGD+ N+PIAD+VR ILDGHIVL+R LA +  YP +D LAS
Sbjct: 296 SGCSKK--GSITALYTVLVDGDDLNEPIADAVRGILDGHIVLSRKLANKNHYPAIDVLAS 353

Query: 357 VSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDF 416
           VSR+ +   + + K+L++    ++  + E  D+  IG Y  G +  +D+A+     + +F
Sbjct: 354 VSRVINDIITEEHKELIARFKDILATYTEAEDLINIGAYNFGSNPKIDEAIELNDKMNNF 413

Query: 417 LKQ 419
           L+Q
Sbjct: 414 LRQ 416


>gi|114569221|ref|YP_755901.1| flagellum-specific ATP synthase [Maricaulis maris MCS10]
 gi|114339683|gb|ABI64963.1| flagellar protein export ATPase FliI [Maricaulis maris MCS10]
          Length = 448

 Score =  296 bits (758), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 160/409 (39%), Positives = 238/409 (58%), Gaps = 7/409 (1%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISL 83
           G ++++  +          + LG     +  N     +V+    +   + P G  E I  
Sbjct: 19  GRVTALNGLLVEAEGPKAGLSLGAHAKIETGNGIAECEVVGFRGETALMMPFGPLEGIRP 78

Query: 84  G-DLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVE 142
           G   +      R+ PS  W GRV++  G+P+D    L +G     +    P A  R R+ 
Sbjct: 79  GARALLQPEAARVRPSRAWLGRVLDGFGRPLDDGVPLTEGGTPYPLKGNPPSAHARARLG 138

Query: 143 KGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREV 202
           +    G+RV++ F P+  GQR+G+FAGSG+GKS L+SM AR+   D ++I L+GERGRE 
Sbjct: 139 ERMDMGVRVLNSFVPMRRGQRLGIFAGSGVGKSVLMSMLARACDADVIVIGLIGERGREA 198

Query: 203 REFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITR 261
           REF++D LG +  K+SVV+  TSD   + R+ A    +T AEYF  +G +VL ++DS+TR
Sbjct: 199 REFVDDVLGPEGRKRSVVITETSDAPALARRQAAHLTLTAAEYFRDQGLDVLCLMDSVTR 258

Query: 262 FAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEK-----GNITAVISVLVD 316
           FA + REI   +GE P  RGY  SVF+ELPRLLER GP  + K     G+IT + +VLVD
Sbjct: 259 FALAQREIGLAAGEPPTTRGYTPSVFAELPRLLERAGPGPQRKDGKKSGSITGLFTVLVD 318

Query: 317 GDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSL 376
           GD+HN+PIAD+VR ILDGH+V++R++AE GRYP +D L SVSR A + + A E+ LV+  
Sbjct: 319 GDDHNEPIADAVRGILDGHVVMSRAIAERGRYPAIDVLKSVSRTAPEVYDAAERPLVAEA 378

Query: 377 THLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLS 425
              +  + +  ++  +G Y  G +  +D+A+     +  FL QS  D +
Sbjct: 379 RKHLSAYADMEELIRLGAYTQGSNPAVDRAIELNEPLEAFLGQSKDDAA 427


>gi|260893872|ref|YP_003239969.1| flagellar protein export ATPase FliI [Ammonifex degensii KC4]
 gi|260866013|gb|ACX53119.1| flagellar protein export ATPase FliI [Ammonifex degensii KC4]
          Length = 436

 Score =  296 bits (758), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 184/431 (42%), Positives = 247/431 (57%), Gaps = 26/431 (6%)

Query: 18  NLVVQGGYISSITSVYYTVTCLSQYV---CL-----GDFVVHQGKNSDNLGQVIRINLDI 69
            L  Q G +S +  +   V  +  +V   CL     G +VV +               D+
Sbjct: 15  TLCQQVGVVSKVVGLTLEVKGIKPFVGEVCLVELSPGKYVVAEAAG---------FREDV 65

Query: 70  VYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEI 128
           V + P G    I  G  V+   R F +       GRV+N LG+PIDG   L  G + + +
Sbjct: 66  VLLMPFGELTGIRPGCRVYPRRRPFTVRVGEHLLGRVLNGLGEPIDGK-PLPSG-IPLPV 123

Query: 129 MSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFD 188
            ++ P  + R+R+E+ F TG+R ID F     GQRIG+FAGSG+GKSTLL M AR    D
Sbjct: 124 NNRPPSPLARRRIEEVFVTGVRAIDAFITCGRGQRIGIFAGSGVGKSTLLGMIARFGNAD 183

Query: 189 KVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSS 247
             +I+LVGERGREV EFIE  LG+  L KSVVVVATSDE  +LR  A   A TIAEYF  
Sbjct: 184 VNVIALVGERGREVLEFIEKDLGEEGLAKSVVVVATSDEPALLRLRAAFVATTIAEYFRD 243

Query: 248 KGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNI 307
            G +VLL++DS+TRFA + RE+    GE P  RGY  SVF+ LPRLLER G     KG+I
Sbjct: 244 TGRHVLLLMDSLTRFALAQREVGLAVGEPPTTRGYTPSVFALLPRLLERAG--NAAKGSI 301

Query: 308 TAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSA 367
           T   +VLV+GD+ N+PI D+ RSILDGHIVL+R LA+   YP +D LASVSRL     + 
Sbjct: 302 TGFYTVLVEGDDLNEPITDAARSILDGHIVLSRQLAQANHYPAIDVLASVSRLMSAVVTP 361

Query: 368 DEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSE 427
           + ++    L  L+  + +  D+  IG Y  G +  +D+A+   P +  FL+Q P + +S 
Sbjct: 362 EHREAADLLRSLLAAYRQNEDLINIGAYVSGSNPTVDRAIALYPELVAFLRQKPEEYTS- 420

Query: 428 DVFQEITKKLQ 438
             F E   +L+
Sbjct: 421 --FPECVARLK 429


>gi|83859268|ref|ZP_00952789.1| flagellum-specific ATP synthase [Oceanicaulis alexandrii HTCC2633]
 gi|83852715|gb|EAP90568.1| flagellum-specific ATP synthase [Oceanicaulis alexandrii HTCC2633]
          Length = 436

 Score =  296 bits (758), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 151/333 (45%), Positives = 213/333 (63%), Gaps = 1/333 (0%)

Query: 95  ISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDI 154
           I P   W GRV+++  +P D    L +GD+   +  + P A +RQR+ +    G+R +++
Sbjct: 89  IRPHKAWLGRVMDSFCRPQDSLGFLPEGDVEYALKGRPPGAHSRQRLGERLDLGVRAMNV 148

Query: 155 FTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DN 213
           FTP+  GQR+GVFAGSG+GKS LLSM AR    D ++I L+GERGRE REF+ED LG + 
Sbjct: 149 FTPMRLGQRLGVFAGSGVGKSVLLSMLARGSEADVIVIGLIGERGREAREFVEDVLGPEG 208

Query: 214 LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNS 273
             +SVV+  TSD   + R+ A  T +  AEYF  +G NVL ++DSITRFA + REI   +
Sbjct: 209 RARSVVITETSDAPALARRRACYTTMATAEYFRDQGLNVLCLMDSITRFALAQREIGLAA 268

Query: 274 GELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILD 333
           GE P  RGY  SVF+ELP LLER GP  +  G IT + +VLVDGD+HN+PIAD+VR ILD
Sbjct: 269 GEPPTTRGYTPSVFAELPGLLERAGPGPQGTGTITGLFTVLVDGDDHNEPIADAVRGILD 328

Query: 334 GHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIG 393
           GHIV++RS+AE GR+P +D L S+SR A + ++ +E  L      L+  + +  ++  +G
Sbjct: 329 GHIVMSRSIAERGRFPAIDVLKSISRSAPEVYAPEEAPLAREARKLLAAYADMEELIRLG 388

Query: 394 GYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
            Y  G +  +D+A+     +  FL Q   + SS
Sbjct: 389 AYSSGSNPEVDRAIAVNEPLEAFLGQGKDETSS 421


>gi|307264870|ref|ZP_07546432.1| flagellar protein export ATPase FliI [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|326389480|ref|ZP_08211047.1| ATPase, FliI/YscN family [Thermoanaerobacter ethanolicus JW 200]
 gi|306920128|gb|EFN50340.1| flagellar protein export ATPase FliI [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|325994485|gb|EGD52910.1| ATPase, FliI/YscN family [Thermoanaerobacter ethanolicus JW 200]
          Length = 436

 Score =  296 bits (758), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 168/363 (46%), Positives = 234/363 (64%), Gaps = 5/363 (1%)

Query: 59  LGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDD 117
           L +V+    + VY+ P+G  E I  G  V   G+  RI+      GRV++ LG PIDG  
Sbjct: 56  LAEVVGFKEEKVYLMPLGNMEGIGAGSKVIATGQTLRINVGNELLGRVLDGLGNPIDGKG 115

Query: 118 SLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
            + K + S+ I +  P  + R+R+ +    GI+ ID       GQRIG+FAGSG+GKSTL
Sbjct: 116 PI-KFEKSIPINNVPPDPLERKRIREVIPLGIKAIDGLLTCGKGQRIGIFAGSGVGKSTL 174

Query: 178 LSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPL 236
           L M AR+   D  +I+L+GERGREV EF+E  LG+  LKKSVVVVATSD   ++R    +
Sbjct: 175 LGMMARNAKADLNVIALIGERGREVNEFLEKDLGEEGLKKSVVVVATSDTPALIRVKGAM 234

Query: 237 TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLER 296
           TA  IAEYF  +G +VLL++DS+TRFA + RE+  + GE PV+RGY  SVFS LP+LLER
Sbjct: 235 TATAIAEYFRDQGLDVLLMMDSVTRFAMAQREVGLSIGEAPVSRGYTPSVFSVLPKLLER 294

Query: 297 IGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLAS 356
            G S  +KG+ITA+ +VLVDGD+ N+PIAD+VR ILDGHIVL+R LA +  YP +D LAS
Sbjct: 295 SGCS--KKGSITALYTVLVDGDDLNEPIADAVRGILDGHIVLSRKLANKNHYPAIDVLAS 352

Query: 357 VSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDF 416
           VSR+ +   + + K+L++    ++  + E  D+  IG Y  G +  +D+A+     +  F
Sbjct: 353 VSRVINDIITEEHKELIARFKDILATYTEAEDLINIGAYNFGSNPKIDEAIELNEKMNSF 412

Query: 417 LKQ 419
           L+Q
Sbjct: 413 LRQ 415


>gi|150021149|ref|YP_001306503.1| flagellar protein export ATPase FliI [Thermosipho melanesiensis
           BI429]
 gi|149793670|gb|ABR31118.1| flagellar protein export ATPase FliI [Thermosipho melanesiensis
           BI429]
          Length = 434

 Score =  296 bits (758), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 165/348 (47%), Positives = 229/348 (65%), Gaps = 9/348 (2%)

Query: 95  ISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDI 154
           I  S    GRV++ALG+P+DG   L K  +   I+ + P  + R+R+      GIR ID 
Sbjct: 91  IPVSEELLGRVVDALGRPLDGKKILSKEKIP--IVREAPNPLIRKRITTPISVGIRAIDG 148

Query: 155 FTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIE-DYLGDN 213
           F  L +GQRIG+FAGSG+GKSTLL M AR+   D  +ISL+GERGREVREFIE D   + 
Sbjct: 149 FLTLGYGQRIGIFAGSGVGKSTLLGMIARNTSADINVISLIGERGREVREFIEKDLKKEG 208

Query: 214 LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNS 273
           LK+S+VVV+TSD+  +LR  A LTA +IAEYF  KG NVLL++DS+TR+A + RE+   +
Sbjct: 209 LKRSIVVVSTSDQPALLRVKALLTATSIAEYFRDKGYNVLLMVDSLTRWAMAQREVGLAT 268

Query: 274 GELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILD 333
           GE P  RGYP SVF+ LP++LER G S  +KG+IT + +VLV+ D+ N+PI+D+VR I+D
Sbjct: 269 GEPPTTRGYPPSVFAGLPKILERAGNS--DKGSITGIYTVLVEADDFNEPISDTVRGIVD 326

Query: 334 GHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIG 393
           GHI+L+R LAE   YP +D L SVSRL +   + + K     L  LI  + + +D+  +G
Sbjct: 327 GHIILSRKLAESAHYPAIDVLMSVSRLMNDIVTKEHKISAMKLKDLIATYYDAKDLIDVG 386

Query: 394 GYRPGVDLILDKAVHQVPIIYDFLKQSPSD-LSSEDVFQ---EITKKL 437
            Y+ G +  +DK++  +  I  FLKQS  + +S +D  Q    I KK+
Sbjct: 387 AYKKGTNPKIDKSIELIDEINKFLKQSIDESMSFDDTVQYLISIAKKI 434


>gi|260429606|ref|ZP_05783583.1| flagellum-specific ATP synthase [Citreicella sp. SE45]
 gi|260420229|gb|EEX13482.1| flagellum-specific ATP synthase [Citreicella sp. SE45]
          Length = 454

 Score =  296 bits (757), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 163/398 (40%), Positives = 235/398 (59%), Gaps = 4/398 (1%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNL-GQVIRINLDIVYICPVGIGEEIS 82
           G + S+      V  L+   C+GD +    +  D L G+V+RI  D+V + P    E +S
Sbjct: 23  GRVRSVDGTVIWVRGLAHVACIGDRL-RLFRGGDTLDGEVLRIRDDLVAMLPDEGAEGVS 81

Query: 83  LGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVE 142
            GD V   G   ++PS  W GRVI+  G+P+D D  L  G       +  PPA  R+ + 
Sbjct: 82  QGDRVAVLGAPTLAPSDSWIGRVIDPYGQPLD-DMPLNPGPQRRPFRASPPPAARRRGLG 140

Query: 143 KGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREV 202
               TG+   D   P+  GQR+G+FAGSG+GKS LL+  A+    D V+++LVGERGREV
Sbjct: 141 ARLPTGLSAFDTLLPIVRGQRVGLFAGSGVGKSRLLASLAQGMAADVVVLALVGERGREV 200

Query: 203 REFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITR 261
            +F+   LG D + +SVVV ATSD SP+ R+  PL A+TIAE+F   G +VL + DSITR
Sbjct: 201 HDFVHTVLGEDGMARSVVVAATSDRSPLERRRCPLAAMTIAEHFRDNGRHVLFLADSITR 260

Query: 262 FAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHN 321
           FA + RE+A  +GE P  RG+P S   ++ RL ER GP    +G+IT V SVLV G +  
Sbjct: 261 FAEAHREVAVAAGETPALRGFPPSTAHQIMRLAERAGPGLPGQGDITGVFSVLVAGSDME 320

Query: 322 DPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIH 381
           +PIAD +R +LDGH+VL+R ++E GR+P +D L SVSR   +A + +E  ++    HL+ 
Sbjct: 321 EPIADILRGVLDGHVVLSREISERGRFPAIDVLRSVSRSLPEAATEEENAVLLQARHLLG 380

Query: 382 RFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
            +  +  +   G YR G D +LD+A+   P +  F+ +
Sbjct: 381 AYARSETMIRAGLYREGEDPVLDQAIRAWPELDAFVGE 418


>gi|284989553|ref|YP_003408107.1| flagellar protein export ATPase FliI [Geodermatophilus obscurus DSM
           43160]
 gi|284062798|gb|ADB73736.1| flagellar protein export ATPase FliI [Geodermatophilus obscurus DSM
           43160]
          Length = 435

 Score =  296 bits (757), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 159/402 (39%), Positives = 244/402 (60%), Gaps = 5/402 (1%)

Query: 27  SSITSVYYTVTCLSQYVCLGDFV-VHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGD 85
           S + ++  T++       +GD V ++   +   L +V+ ++ + +   P+G    +  G 
Sbjct: 20  SVVGAMGLTLSVEGAVAAVGDLVEINPSPSGGLLAEVVAVSRERLTCMPLGELSGVHAGA 79

Query: 86  LVFHWGR-FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKG 144
            V   G   ++       GRV++ LG+P+DG   L +    +++ S+ P A+ R RVE+ 
Sbjct: 80  RVRATGMPLQVPVGEALLGRVLDGLGRPVDGGPPLDQSLEFVDLASETPHALARTRVEEP 139

Query: 145 FKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVRE 204
             +G+RV+D   PL  GQR+G+FAGSG+GKSTLL+   R    D  +I L+GERGREVRE
Sbjct: 140 LASGVRVLDTMVPLGKGQRLGIFAGSGVGKSTLLAQITRGTDADVRVIGLIGERGREVRE 199

Query: 205 FIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFA 263
           F+E+ LG + + ++VVVVATSDE P++R  A   A  IAE F  +G +VLL++DSITR A
Sbjct: 200 FLEENLGAEGMARTVVVVATSDEPPLVRLKAAFVATRIAEGFRDQGRDVLLMMDSITRTA 259

Query: 264 HSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDP 323
            + RE+  ++GE P  RGYP SVF+ +P+LLE+ G +    G+IT + +VLVDGD+HN+P
Sbjct: 260 MAQREVGLSAGEPPATRGYPPSVFAMMPKLLEKAGTA--AVGSITGLYTVLVDGDDHNEP 317

Query: 324 IADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRF 383
           IAD+ RSILDGH+VL R LA  G +P +D L S+SR+A       +      +  L+   
Sbjct: 318 IADTARSILDGHVVLTRKLATAGHFPAIDVLESISRVATAVVPPAQMADAREVRRLMGAL 377

Query: 384 EETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLS 425
            + +++  IG Y+ G D ++D+A    P I  FL+Q   +L+
Sbjct: 378 RDVKELIEIGAYQAGTDPLVDRARQLAPAIESFLQQPTGELT 419


>gi|225159028|ref|ZP_03725338.1| Sodium-transporting two-sector ATPase [Opitutaceae bacterium TAV2]
 gi|224802407|gb|EEG20669.1| Sodium-transporting two-sector ATPase [Opitutaceae bacterium TAV2]
          Length = 461

 Score =  295 bits (756), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 179/417 (42%), Positives = 246/417 (58%), Gaps = 10/417 (2%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNS--DNLGQVIRINLDIVYICPVGIGEEI 81
           G ++++T +   +      V LGD  V + +    + + +V+    + V + P+G    +
Sbjct: 38  GRVAAVTGLI--IESEGPNVGLGDICVIRSERDAFEVMAEVVGFRGERVLLMPLGETTGL 95

Query: 82  SLGDLVFHWGRFRISPS-ACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQR 140
             G  V    R  I  S A   GRV++ALG+P DG   +    +   + S+ P  + RQR
Sbjct: 96  HAGCSVSAGDRPPIPVSGAQLLGRVLDALGRPFDGAGPVPTRRVDA-VHSRPPHPLRRQR 154

Query: 141 VEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGR 200
           + +   TG+R +D FTPL  GQR+G+FAGSG+GKSTLL M AR    D V+I LVGERGR
Sbjct: 155 IREALPTGVRALDAFTPLGRGQRLGLFAGSGVGKSTLLGMIARGSAADVVVIGLVGERGR 214

Query: 201 EVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSI 259
           EVREF+E  LG + L +SVVVVATSD    LR  A  TA  IAE +  +G NVLL++DS+
Sbjct: 215 EVREFLEKDLGAEGLARSVVVVATSDSPAPLRLRAAFTATAIAESYRDQGKNVLLLMDSV 274

Query: 260 TRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDN 319
           TRFA + REI    GE P  RGY  SVF+ LPRLLER G    E G ITA+ +VLV+GD+
Sbjct: 275 TRFAMAQREIGLAIGEPPATRGYTPSVFALLPRLLERAGAG--ETGAITALYTVLVEGDD 332

Query: 320 HNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHL 379
            N+PIAD+VR ILDGH+VL+R+LA    YP +D L SVSRL     SA E +  +    L
Sbjct: 333 MNEPIADAVRGILDGHLVLSRALAHANHYPAIDVLESVSRLTRDICSATEVESAARAREL 392

Query: 380 IHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDL-SSEDVFQEITK 435
           +  ++   D+  IG Y+ G    LD+AV     +  FL+Q   ++ +  DVF  + +
Sbjct: 393 LAIYKRNEDLITIGAYQKGASAALDRAVTLHEPLKQFLRQRVDEIVARADVFNRLAE 449


>gi|169827123|ref|YP_001697281.1| flagellum-specific ATP synthase [Lysinibacillus sphaericus C3-41]
 gi|168991611|gb|ACA39151.1| Flagellum-specific ATP synthase [Lysinibacillus sphaericus C3-41]
          Length = 441

 Score =  295 bits (756), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 162/365 (44%), Positives = 236/365 (64%), Gaps = 9/365 (2%)

Query: 59  LGQVIRINLDIVYICPVGIGEEISLGDLVFHWG---RFRISPSACWCGRVINALGKPIDG 115
           L +V+    +IV + P     EIS+G LV   G     ++ P     G+V++++G PIDG
Sbjct: 58  LAEVVGFKDEIVVLMPFTSLREISIGCLVEGTGAPLEVKVGPE--LIGKVLDSMGNPIDG 115

Query: 116 DDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKS 175
              L KG +++      P  + R  + +  + G++ ID    + +GQR+G+FAGSG+GKS
Sbjct: 116 T-LLPKGLMTVPTEQDPPNPLTRPPINERLEVGVKAIDGMLTVGNGQRVGIFAGSGVGKS 174

Query: 176 TLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMA 234
           TLL M AR+   D  +I+L+GERGREVREFIE  LG + L +S+VV ATSD+  ++R   
Sbjct: 175 TLLGMIARNTQADLNVIALIGERGREVREFIERDLGPEGLSRSIVVAATSDQPALMRIKG 234

Query: 235 PLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLL 294
             TA  IAEYF ++G NV+L++DS+TR A + REI   +GE P  +GY  SVF+ LP+LL
Sbjct: 235 AFTATAIAEYFRNRGLNVMLMMDSVTRVAMAQREIGLATGEPPAQKGYTPSVFAILPKLL 294

Query: 295 ERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPL 354
           ER G +EK  G+ITA  +VLVDGD+ N+PIAD+VR ILDGHIVL+R+LA +G+YP ++ L
Sbjct: 295 ERTGTNEK--GSITAFYTVLVDGDDMNEPIADTVRGILDGHIVLDRNLANKGQYPAINVL 352

Query: 355 ASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIY 414
            SVSRL +   + + KK    L  L + ++++ D+  IG Y+ G    +D+A+H  P+I 
Sbjct: 353 KSVSRLMNHVAAPEHKKAAERLRELYYTYDKSEDLINIGAYKRGTSREIDEAIHYEPLIT 412

Query: 415 DFLKQ 419
            +LKQ
Sbjct: 413 TYLKQ 417


>gi|284041512|ref|YP_003391852.1| flagellar protein export ATPase FliI [Conexibacter woesei DSM
           14684]
 gi|283945733|gb|ADB48477.1| flagellar protein export ATPase FliI [Conexibacter woesei DSM
           14684]
          Length = 489

 Score =  295 bits (755), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 158/334 (47%), Positives = 214/334 (64%), Gaps = 3/334 (0%)

Query: 93  FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVI 152
           FRI       GRVI+ LGKPIDG      G       +  P  ++R R+++    G+R +
Sbjct: 107 FRIRVGQDLLGRVIDGLGKPIDGMPRATNGH-PRSTNASPPDPLDRPRIDQRVDLGVRAL 165

Query: 153 DIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD 212
           D   P   GQR+G+FAGSG+GKS+LL M ARS   D  +I+LVGERGREV+EF+E  LGD
Sbjct: 166 DALVPCGRGQRLGIFAGSGVGKSSLLGMIARSTTADVNVIALVGERGREVKEFVERDLGD 225

Query: 213 NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATN 272
            L +SVVVVATSD+  ++R  A  TA  IAE+F  +G++V+L++DS+TRFA + RE+   
Sbjct: 226 ALSRSVVVVATSDQPALVRIKAAFTATAIAEHFRDQGNDVMLMMDSVTRFAMAQREVGLA 285

Query: 273 SGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSIL 332
            GE P  RGY  SVF++LPRLLER G +    G+IT + +VLVDGD+ N+PIAD+VRSIL
Sbjct: 286 IGEPPATRGYTPSVFAQLPRLLERSGTA--RTGSITGLYTVLVDGDDMNEPIADAVRSIL 343

Query: 333 DGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLI 392
           DGH+VL R LA    YP +D L SVSRL  +  S + +    ++  L+  ++E  D+  I
Sbjct: 344 DGHVVLTRELAHASHYPAIDVLQSVSRLVGEIVSPEVRAAGQAVRQLMASYKEKEDLIAI 403

Query: 393 GGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
           G Y+ G D  +D A+   P +  FLKQ P + SS
Sbjct: 404 GAYQGGTDPTVDAAIALRPQLDRFLKQRPDEKSS 437


>gi|126653746|ref|ZP_01725664.1| flagellum-specific ATP synthase [Bacillus sp. B14905]
 gi|126589710|gb|EAZ83846.1| flagellum-specific ATP synthase [Bacillus sp. B14905]
          Length = 441

 Score =  295 bits (754), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 162/365 (44%), Positives = 235/365 (64%), Gaps = 9/365 (2%)

Query: 59  LGQVIRINLDIVYICPVGIGEEISLGDLVFHWG---RFRISPSACWCGRVINALGKPIDG 115
           L +V+    +IV + P     EIS+G LV   G     ++ P     G+V++++G PIDG
Sbjct: 58  LAEVVGFKDEIVVLMPFTSLREISIGCLVEGTGAPLEVKVGPE--LIGKVLDSMGNPIDG 115

Query: 116 DDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKS 175
              L KG +++      P  + R  + +  + G++ ID    + +GQR+G+FAGSG+GKS
Sbjct: 116 T-LLPKGLMTVPTEQDPPNPLTRPPINERLEVGVKAIDGMLTVGNGQRVGIFAGSGVGKS 174

Query: 176 TLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMA 234
           TLL M AR+   D  +I+L+GERGREVREFIE  LG + L +S+VV ATSD+  ++R   
Sbjct: 175 TLLGMIARNTQADLNVIALIGERGREVREFIERDLGPEGLSRSIVVAATSDQPALMRIKG 234

Query: 235 PLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLL 294
             TA  IAEYF ++G NV+L++DS+TR A + REI   +GE P  +GY  SVF+ LP+LL
Sbjct: 235 AFTATAIAEYFRNRGLNVMLMMDSVTRVAMAQREIGLATGEPPAQKGYTPSVFAILPKLL 294

Query: 295 ERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPL 354
           ER G +EK  G+ITA  +VLVDGD+ N+PIAD+VR ILDGHIVL+R+LA +G+YP ++ L
Sbjct: 295 ERTGTNEK--GSITAFYTVLVDGDDMNEPIADTVRGILDGHIVLDRNLANKGQYPAINVL 352

Query: 355 ASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIY 414
            SVSRL +     + KK    L  L + ++++ D+  IG Y+ G    +D+A+H  P+I 
Sbjct: 353 KSVSRLMNHVAEPEHKKAAERLRELYYTYDKSEDLINIGAYKRGTSREIDEAIHYEPLIT 412

Query: 415 DFLKQ 419
            +LKQ
Sbjct: 413 TYLKQ 417


>gi|114762158|ref|ZP_01441626.1| H+-transporting two-sector ATPase, alpha/beta subunit [Pelagibaca
           bermudensis HTCC2601]
 gi|114545182|gb|EAU48185.1| H+-transporting two-sector ATPase, alpha/beta subunit [Roseovarius
           sp. HTCC2601]
          Length = 453

 Score =  295 bits (754), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 162/414 (39%), Positives = 244/414 (58%), Gaps = 5/414 (1%)

Query: 8   LAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINL 67
           LAQ+ +      V   G + S+      V  L+   C+GD +     + +  G+V+RI  
Sbjct: 10  LAQITQIRPARAV---GRVRSVDGTVIWVRGLAHLACIGDRLRLYHADGELGGEVLRIRD 66

Query: 68  DIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSME 127
           D+V + P    E +S  D V   G   ++PS  W GRVI+  G+P+DG  SL  G L   
Sbjct: 67  DLVAMLPDEGPEGVSQDDRVAVLGPPVLAPSNDWVGRVIDPYGQPLDGR-SLSSGSLRRP 125

Query: 128 IMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCF 187
             +  PPA  R+ +    ++G+   D F P+  GQR+G+FAGSG+GKS LL+  AR    
Sbjct: 126 FRASPPPAAQRRGLGGRLRSGLAAFDTFLPIVRGQRVGLFAGSGVGKSRLLASLARGVEA 185

Query: 188 DKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFS 246
           D V+++L+GERGREV +F+ D LG + + +SVV+ A+SD SP+ R+   L A+T+AE+F 
Sbjct: 186 DVVVLALIGERGREVHDFVHDVLGPEGMARSVVIAASSDRSPLERRRCALAAMTVAEHFR 245

Query: 247 SKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGN 306
             G  VL + DSITRFA + RE+A  +GE+P  RG+P S  +++ RL ER GP     G+
Sbjct: 246 DTGRQVLFLADSITRFAEAHREVAVAAGEMPALRGFPPSTANQIMRLAERAGPGLAGSGD 305

Query: 307 ITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWS 366
           ITA+ SVLV G +  +PIAD +R +LDGH+VL+R +AE GR+P ++ L SVSR   +A +
Sbjct: 306 ITAIFSVLVAGSDMEEPIADILRGVLDGHVVLSREIAERGRFPAINVLRSVSRSLPEAAT 365

Query: 367 ADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQS 420
            +E  ++    HL+  +  +  +   G YR G D +LD+A+   P +  F  ++
Sbjct: 366 EEENDVLLQARHLLGAYARSETMIRAGLYREGEDPLLDQAIRAWPDLDTFFSEA 419


>gi|325921919|ref|ZP_08183730.1| Type III secretion system ATPase HrcN protein [Xanthomonas gardneri
           ATCC 19865]
 gi|325547621|gb|EGD18664.1| Type III secretion system ATPase HrcN protein [Xanthomonas gardneri
           ATCC 19865]
          Length = 438

 Score =  295 bits (754), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 162/374 (43%), Positives = 227/374 (60%), Gaps = 5/374 (1%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISP-SACWCGRVINALGKPIDGDDSL 119
           +V+  +  +  + P G    +S    V   GR    P      GRV++ LG+P DG   +
Sbjct: 59  EVVGFSRHLALLAPFGELVGLSRETRVIGSGRPLAVPVGEALLGRVLDGLGEPADGQGPV 118

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
             GD  ++I ++ P  M R+ +E+   TG+R++D    L  GQR+G+FA +G+GKSTL+ 
Sbjct: 119 -AGDGWVQIQAQAPDPMRRRLIEQPLPTGVRIVDGLMTLGEGQRMGIFAAAGVGKSTLMG 177

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTA 238
           MFAR    D  +I L+GERGREVREFIE  LG D L +SVVV ATSD S I R  A    
Sbjct: 178 MFARGTQCDVNVIVLIGERGREVREFIEMILGPDGLARSVVVCATSDRSSIERAKAAYVG 237

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
             IAEYF  +G  VLL++DS+TRFA + REI   +GE P  RG+P SVF+ELPRLLER G
Sbjct: 238 TAIAEYFRDQGMRVLLMMDSLTRFARAQREIGLAAGEPPTRRGFPPSVFAELPRLLERAG 297

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
             E   G+ITA  +VL + D  +DPIA+ VR ILDGH++L+R +A + +YP +D L S+S
Sbjct: 298 MGET--GSITAFYTVLAEDDTGSDPIAEEVRGILDGHLILSREIAAKNQYPAIDVLGSLS 355

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+  +  SA++++    L  L+ ++ E   +  +G YR G D + D+A+ ++  I DFL 
Sbjct: 356 RVMSQIVSAEQRQYAGQLRRLLAKYNEVETLLQVGEYRQGSDAVADEAIARIDAIRDFLS 415

Query: 419 QSPSDLSSEDVFQE 432
           QS   LS  D   E
Sbjct: 416 QSTDQLSDYDATLE 429


>gi|224419099|ref|ZP_03657105.1| flagellum-specific ATP synthase [Helicobacter canadensis MIT
           98-5491]
 gi|253828036|ref|ZP_04870921.1| flagellum-specific ATP synthase [Helicobacter canadensis MIT
           98-5491]
 gi|313142608|ref|ZP_07804801.1| flagellum-specific ATP synthase [Helicobacter canadensis MIT
           98-5491]
 gi|253511442|gb|EES90101.1| flagellum-specific ATP synthase [Helicobacter canadensis MIT
           98-5491]
 gi|313131639|gb|EFR49256.1| flagellum-specific ATP synthase [Helicobacter canadensis MIT
           98-5491]
          Length = 432

 Score =  295 bits (754), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 178/437 (40%), Positives = 256/437 (58%), Gaps = 17/437 (3%)

Query: 7   TLAQLAEDYSK-NLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRI 65
           +LA L E  +  NL    G I+ +   + +   LS    LGD V    +NS+ +G V  +
Sbjct: 2   SLANLRERLNHLNLSPTFGLITKVEQGFLSANGLSP--SLGDIVRIVSENSNTIGMVTTL 59

Query: 66  NLDIVYICPVGIGEEISLGDLVF-HWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDL 124
                 I P    E   +GD V+ +    +I       GRVIN LG+PIDG     KGDL
Sbjct: 60  EGGSFKITPFSFVEGTKVGDKVYLNTKGLQIPVGLELLGRVINPLGEPIDG-----KGDL 114

Query: 125 S----MEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSM 180
                M I+ +   AM R  +++ F  G++ ID       GQ++G+FAGSG+GKSTL+ M
Sbjct: 115 RAEGVMPIIRQPIAAMKRGMIDEVFSVGVKSIDGLLTCGKGQKLGIFAGSGVGKSTLMGM 174

Query: 181 FARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVT 240
             R       +I+L+GERGREV EF+E  LG +L  +V++VATSD+SP++RK     A++
Sbjct: 175 IVRGAQAKIKVIALIGERGREVPEFVEKNLGGDLTNTVLIVATSDDSPLMRKYGAFAAMS 234

Query: 241 IAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPS 300
           +AEYF +KG++VL ++DS+TRFA + REI    GE P ++GYP SV + LP+L+ER G  
Sbjct: 235 VAEYFKAKGEDVLFMMDSVTRFAMAQREIGLALGEPPTSKGYPPSVLTLLPQLMERAG-K 293

Query: 301 EKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRL 360
           E+ KG+ITA  +VLV+GD+ +DPIAD  RSILDGHIVL+RSL + G YPP++ L S SRL
Sbjct: 294 EEGKGSITAYFTVLVEGDDMSDPIADQSRSILDGHIVLDRSLTDFGIYPPINILNSASRL 353

Query: 361 ADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQS 420
            +     +          L    +E   +  IG Y+ G D  +D+A+ +   + D+L+QS
Sbjct: 354 MNDIAQKEHILAARKFRRLYSILKENEVLIRIGAYQAGSDKEMDEAIAKKEDMEDYLRQS 413

Query: 421 PSDLSSEDVFQEITKKL 437
             ++     +QE TKKL
Sbjct: 414 YDEVWD---YQESTKKL 427


>gi|117928052|ref|YP_872603.1| flagellar protein export ATPase FliI [Acidothermus cellulolyticus
           11B]
 gi|117648515|gb|ABK52617.1| type III secretion system ATPase, FliI/YscN [Acidothermus
           cellulolyticus 11B]
          Length = 439

 Score =  294 bits (753), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 174/403 (43%), Positives = 245/403 (60%), Gaps = 19/403 (4%)

Query: 32  VYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWG 91
           V  ++T       +GD V+ +G+    L +V+ ++ + +   P+G    +++G LV   G
Sbjct: 33  VGLSITAAGIRAAIGDVVIVEGRQP-TLAEVVALHDESLACMPLGDVSGVAVGALVTPTG 91

Query: 92  RFRISPSA-CWCGRVINALGKPIDGDDSLGKGDLSMEI---MSKVPP-AMNRQRVEKGFK 146
                P      GRV++ LG+PIDG     KG+L   I   +   PP  + R R+ +   
Sbjct: 92  GPLTVPVGDALLGRVLDGLGRPIDG-----KGELRDTIRVGLDATPPHPLRRTRISEQLS 146

Query: 147 TGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFI 206
            G+RV+D  TP   GQR+G+FAGSG+GKS+LLSM AR    D  +I+LVGERGREVREF+
Sbjct: 147 LGVRVLDTMTPCGRGQRLGIFAGSGVGKSSLLSMIARGTEADVSVIALVGERGREVREFL 206

Query: 207 EDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHS 265
           E+ LG + L +SVVVVATSDE  +LR  A   A  IAE+F   G +V+L++DSITRFA +
Sbjct: 207 ENDLGEEGLARSVVVVATSDEPALLRLRAAFVATRIAEWFRDLGRHVILMMDSITRFAMA 266

Query: 266 IREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIA 325
            REI  + GE    RGYP SVF+ LP+LLER G    E G+IT + +VLV+GD+ N+PIA
Sbjct: 267 QREIGLSVGEPAATRGYPPSVFALLPKLLERAGAG--EHGSITGLYTVLVEGDDMNEPIA 324

Query: 326 DSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEE 385
           D+ RSILDGH+ L+R LA  G YP VD L S+SRL     +A ++   + L  ++    +
Sbjct: 325 DTARSILDGHVTLSRRLATSGHYPAVDVLESISRLTGAITTAQQRDDATFLRRILAAHRD 384

Query: 386 TRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ-----SPSD 423
            R++  IG Y PG +  +D A+   P I DFL+Q     +P+D
Sbjct: 385 ARELIDIGAYVPGSNPDVDTALRLQPRITDFLRQDIRAVTPAD 427


>gi|108762697|ref|YP_630662.1| FliI/YscN family ATPase [Myxococcus xanthus DK 1622]
 gi|108466577|gb|ABF91762.1| ATPase, FliI/YscN family [Myxococcus xanthus DK 1622]
          Length = 437

 Score =  294 bits (752), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 167/398 (41%), Positives = 236/398 (59%), Gaps = 8/398 (2%)

Query: 43  VCLGDFVVHQGKNSDNL-GQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSAC 100
           V +G+ V+ + +N   +  +V+    D V + P+G    I     V   G+   I     
Sbjct: 39  VRVGELVLIKSRNRGAVKAEVVGFQGDEVMLMPLGELHGIGPDSEVIPTGKPLSIKCGEA 98

Query: 101 WCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCH 160
             GRV+N +G+P+DG     +G +   +    P    RQR+E+    G+R ID    +  
Sbjct: 99  LLGRVLNGIGEPMDGHPLPEEGLIDWSVDRDCPDPFTRQRIERPLPLGVRCIDGLLTVGE 158

Query: 161 GQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVV 219
           GQR+G+FAGSG+GKSTL+   AR+   D  +++L+GERGREVREFIED +G + +K+SV+
Sbjct: 159 GQRVGLFAGSGVGKSTLMGQIARNTKADLCVVALIGERGREVREFIEDAMGEEGMKRSVL 218

Query: 220 VVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVA 279
           V ATSD+  ++R  A   A  IAEYF  +G NVL +LD++TR A + REI    GE P  
Sbjct: 219 VCATSDQPSLVRLRAAYVATAIAEYFRERGGNVLFMLDTVTRLARAQREIGLAVGEPPAR 278

Query: 280 RGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLN 339
           +GYP SVFS LPR+LER G S  EKG  TA+ + LV G +  +PIAD VR ILDGH +LN
Sbjct: 279 QGYPPSVFSMLPRILERTGNS--EKGKCTAIYTCLVAGGDMEEPIADEVRGILDGHFILN 336

Query: 340 RSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGV 399
           R+L E  ++P +D LAS+SR+     S D KK    L  L+  +E+ RD+ L+G Y+ G 
Sbjct: 337 RALGERNQWPAMDVLASLSRVMSGIVSKDHKKAAGRLRELLSTYEKQRDLILLGAYQYGT 396

Query: 400 DLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKL 437
           D   D+A+ +   I DFLKQ   D  S   F+E  ++L
Sbjct: 397 DPRTDQAIDKYDAIIDFLKQ---DTHSNSGFEETVEQL 431


>gi|296274002|ref|YP_003656633.1| FliI/YscN family ATPase [Arcobacter nitrofigilis DSM 7299]
 gi|296098176|gb|ADG94126.1| ATPase, FliI/YscN family [Arcobacter nitrofigilis DSM 7299]
          Length = 435

 Score =  293 bits (751), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 167/409 (40%), Positives = 242/409 (59%), Gaps = 7/409 (1%)

Query: 18  NLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNS--DNLGQVIRINLDIVYICPV 75
           NL++  G I+ I+S   T+  +   V +GD V  + ++     LG +  +  D   I P 
Sbjct: 15  NLIIPFGRITHISST--TIKAVGIEVAVGDIVKIESQHHLYTVLGMIASVESDGFKIVPF 72

Query: 76  GIGEEISLGDLVF-HWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPP 134
              E   + D VF       +       GRV+NALG+PID    +   + +  I     P
Sbjct: 73  SFIEGFRINDKVFLQKDGLTVKSGYGLLGRVVNALGEPIDKKGKVKDLEQNSAINKLSIP 132

Query: 135 AMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISL 194
           A+ R  +++ F TG++ ID       GQ++G+FAGSG+GKSTL+ M  +       +++L
Sbjct: 133 ALERGIIDERFSTGVKAIDSMLTSGKGQKVGIFAGSGVGKSTLMGMIVKGCEAQIKVVAL 192

Query: 195 VGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLL 254
           +GERGRE+ EFI   L +NL+ ++++ ATSDES ++RK    TA+ IAE+F  KG +VLL
Sbjct: 193 IGERGREIPEFIHYNLNNNLENTIIIAATSDESALMRKYGAFTAMAIAEFFRDKGHDVLL 252

Query: 255 ILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVL 314
           ++DS+TRFA + REI  + GE PV+RGYP SVF+ LP+L+ER G +  E G+ITA  +VL
Sbjct: 253 MMDSVTRFAMAQREIGLSIGEPPVSRGYPPSVFALLPQLMERAGNT--ELGSITAFFTVL 310

Query: 315 VDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVS 374
           VDGD+ NDPIAD  RSILDGHIVL R L E+G+YPP+D L S SR+ DK  S +      
Sbjct: 311 VDGDDMNDPIADQSRSILDGHIVLTRELTEQGQYPPIDLLRSASRVMDKVVSPEHYNGFL 370

Query: 375 SLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSD 423
            L  ++   +E   +  +G Y+ G+D  LD A+ +   I  FL Q  S+
Sbjct: 371 KLKRVLSLIKENEILIRVGAYKQGMDKELDDALAKREKIKTFLFQGTSE 419


>gi|304316905|ref|YP_003852050.1| ATPase, FliI/YscN family [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302778407|gb|ADL68966.1| ATPase, FliI/YscN family [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 438

 Score =  293 bits (750), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 173/411 (42%), Positives = 255/411 (62%), Gaps = 16/411 (3%)

Query: 17  KNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNL-GQVIRINLDIVYICPV 75
           K+ +   G +S +  +  T+  +     +GD    +  N + +  +V+    D VY+ P+
Sbjct: 17  KSFIKYYGKVSQVVGL--TIESIGPISNVGDVCEIKSINGNTIYAEVMGFKDDKVYLMPL 74

Query: 76  GIGEEISLGDLVFHWG-RFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIM---SK 131
           G  + I  G+ V   G + +I       GRVI+ALG PIDG     KG +  + +   + 
Sbjct: 75  GDMDGIGPGNSVISTGQKLKIGVGEELLGRVIDALGNPIDG-----KGPIKFKKLVSTNN 129

Query: 132 VPP-AMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKV 190
           VPP  + R+R+ +    GI+ ID       GQRIG+FAGSG+GKSTLL M AR+   D  
Sbjct: 130 VPPNPIERKRIREAMPLGIKAIDGLLTCGKGQRIGIFAGSGVGKSTLLGMIARNAKSDIN 189

Query: 191 IISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKG 249
           +I+L+GERGREV EFIE  LG D LK+S++VV+TSD   ++R    +TA +IAEYF  +G
Sbjct: 190 VIALIGERGREVNEFIEKDLGEDGLKRSILVVSTSDTPALMRVKGAMTATSIAEYFRDQG 249

Query: 250 DNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITA 309
            +VL ++DS+TRFA + REI  + GE PV+RGY  SVFS LP+LLER G ++   G+ITA
Sbjct: 250 LDVLFMMDSVTRFAMAQREIGLSIGEAPVSRGYTPSVFSVLPKLLERAGSAKN--GSITA 307

Query: 310 VISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADE 369
           + +VLVDGD+ N+PI D+VR ILDGHIVL+R LA +G+YP +D LAS+SR+ +   S + 
Sbjct: 308 LYTVLVDGDDLNEPITDAVRGILDGHIVLSRKLANKGQYPAIDILASISRVMNDIVSDEH 367

Query: 370 KKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQS 420
           K L S    ++  +EE+ D+  IG Y  G +  +D+A+     + +++KQ+
Sbjct: 368 KNLSSKFKSILSVYEESEDLINIGAYAKGSNPKIDEAILLHDDMINYIKQT 418


>gi|83647858|ref|YP_436293.1| flagellum-specific ATP synthase [Hahella chejuensis KCTC 2396]
 gi|83635901|gb|ABC31868.1| flagellum-specific ATP synthase [Hahella chejuensis KCTC 2396]
          Length = 456

 Score =  293 bits (750), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 156/362 (43%), Positives = 226/362 (62%), Gaps = 3/362 (0%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHW-GRFRISPSACWCGRVINALGKPIDGDDSL 119
           +V+  + + VY+ P+   E +  G  V    G  RI   AC  GRV++  G+P+DG   L
Sbjct: 60  EVVGFSDERVYLMPLAAVEGLQPGAKVKPMSGVGRIGVGACLLGRVLDGAGEPLDGRGPL 119

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
            + +  +E+       ++R  + +    GIR I+    +  GQR+G+FAGSG+GKS LL 
Sbjct: 120 -QAEHHVELFGAPINPLHRAPIREKLDVGIRAINSLLTVGIGQRLGLFAGSGVGKSMLLG 178

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTA 238
           M  R    D +++ LVGERGREV+EFIED LG+  L+++VVV + +D+SP++R  A +  
Sbjct: 179 MMTRFTTADIIVVGLVGERGREVKEFIEDILGEEGLRRAVVVASPADDSPLMRLRAAVLT 238

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
             IAEYF   G NVLL++DS+TR+A + REIA   GE P  +GYP SVF++LP+L+ER G
Sbjct: 239 TRIAEYFRDLGKNVLLLMDSLTRYAQAQREIALAVGEPPATKGYPPSVFAKLPQLVERAG 298

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
             +   G+ITA  +VL +GD+  DPIAD+ R+ILDGHIVLNR LAEEG YP +D  AS+S
Sbjct: 299 NGKPGGGSITAFYTVLTEGDDQQDPIADAARAILDGHIVLNRRLAEEGHYPAIDVEASIS 358

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+  +  + D  +       L  R+++TRD+  +G Y PG D   D A+ + P +  FL+
Sbjct: 359 RVMPQVTTPDYLQRAQRFKQLYARYQQTRDLISVGAYAPGSDKETDYAIERFPHMRKFLQ 418

Query: 419 QS 420
           QS
Sbjct: 419 QS 420


>gi|227873550|ref|ZP_03991793.1| H(+)-transporting two-sector ATPase [Oribacterium sinus F0268]
 gi|227840596|gb|EEJ50983.1| H(+)-transporting two-sector ATPase [Oribacterium sinus F0268]
          Length = 436

 Score =  293 bits (750), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 158/344 (45%), Positives = 224/344 (65%), Gaps = 5/344 (1%)

Query: 92  RFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRV 151
           R R+       GR+I+A G P+DG +   + D      S + P ++R  + +    GI+ 
Sbjct: 89  RLRVPVGDFLKGRIIDAQGNPMDGGEPFPESDFYTVNNSYMNP-LDRPPIRERLHFGIKA 147

Query: 152 IDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG 211
           ID    +  GQRIG+FAGSG+GKSTL+ M AR+   D  +I+LVGERGRE+ EF+E  +G
Sbjct: 148 IDGLNTVGKGQRIGIFAGSGVGKSTLMGMIARNVKTDINVIALVGERGREILEFVEKDMG 207

Query: 212 D-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIA 270
           +  +K++V+VVATSD+  +LR  APL A TIAEYF  +G +VLL++DS+TRFA + REI 
Sbjct: 208 EEGMKRTVLVVATSDQPAMLRLKAPLVATTIAEYFRDRGMDVLLMMDSLTRFAMAQREIG 267

Query: 271 TNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRS 330
             +GE P+ARGY  S+++E PRLLER G  +K  G+IT V +VLV+GD+ N+PIAD+VR 
Sbjct: 268 LATGEPPIARGYTPSIYAEFPRLLERAGAFKK--GSITGVYTVLVEGDDTNEPIADTVRG 325

Query: 331 ILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIR 390
           ILDGHIVL+R+LA E  YP +D   S+SRL  +  S + KK  S + + +  +++  D+ 
Sbjct: 326 ILDGHIVLSRALAAENHYPAIDIGMSISRLMAELVSQEHKKYASRMRNTLGLYQKNADLI 385

Query: 391 LIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSD-LSSEDVFQEI 433
            IG Y+ G D  LD+AV + P I DFL Q   +  S ED   ++
Sbjct: 386 AIGAYKKGTDPKLDEAVDKYPAINDFLMQGTGEAFSYEDTVMQM 429


>gi|188992464|ref|YP_001904474.1| type III secretion system ATPase [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167734224|emb|CAP52432.1| type III secretion system ATPase [Xanthomonas campestris pv.
           campestris]
          Length = 438

 Score =  293 bits (749), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 162/374 (43%), Positives = 225/374 (60%), Gaps = 5/374 (1%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISP-SACWCGRVINALGKPIDGDDSL 119
           +V+  +  +  + P G    +S    V   GR    P  +   GRV++ LG+P DG   L
Sbjct: 59  EVVGFSRTLALLAPFGELVGLSRQTRVIGLGRPLAVPVGSALLGRVLDGLGEPADGQGPL 118

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
             GD  ++I ++ P  M R+ +E+   TG+R++D    L  GQR+G+FA +G+GKSTL+ 
Sbjct: 119 -AGDDWVQIQAQAPDPMRRRLIEQPLPTGVRIVDGLMTLGEGQRMGIFAAAGVGKSTLMG 177

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTA 238
           MFAR    D  +I L+GERGREVREFIE  LG D L +SVVV ATSD S I R  A    
Sbjct: 178 MFARGTQCDVNVIVLIGERGREVREFIEMILGPDGLARSVVVCATSDRSSIERAKAAYVG 237

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
             IAEYF  +G  VLL++DS+TRFA + REI   +GE P  RG+P SVF+ELPRLLER G
Sbjct: 238 TAIAEYFRDRGMRVLLMMDSLTRFARAQREIGLAAGEPPTRRGFPPSVFAELPRLLERAG 297

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
             E   G+ITA  +VL + D  +DPIA+ VR ILDGH++L+R +A   +YP +D L S+S
Sbjct: 298 MGET--GSITAFYTVLAEDDTGSDPIAEEVRGILDGHLILSREIAARNQYPAIDVLGSLS 355

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+  +  SA++++    L  L+ +  E   +  +G YR G D + D+A+ ++  I DFL 
Sbjct: 356 RVMSQIVSAEQRQYAGQLRRLLAKHNEVETLLQVGEYRHGSDAVADEAIARIDAIRDFLS 415

Query: 419 QSPSDLSSEDVFQE 432
           Q    LS  D   E
Sbjct: 416 QPTDQLSDYDTILE 429


>gi|289578431|ref|YP_003477058.1| flagellar protein export ATPase FliI [Thermoanaerobacter italicus
           Ab9]
 gi|297544707|ref|YP_003677009.1| flagellar protein export ATPase FliI [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
 gi|289528144|gb|ADD02496.1| flagellar protein export ATPase FliI [Thermoanaerobacter italicus
           Ab9]
 gi|296842482|gb|ADH60998.1| flagellar protein export ATPase FliI [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
          Length = 437

 Score =  293 bits (749), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 165/361 (45%), Positives = 233/361 (64%), Gaps = 5/361 (1%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSL 119
           +V+    + VY+ P+G  E I  G  V   G+  R+S      GR+++ LG PID    +
Sbjct: 59  EVVGFKEEKVYLMPLGNMEGIGAGSKVIATGQTLRVSVGKELLGRILDGLGNPIDSKGPV 118

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
            K + S+ I +  P  + R+R+ +    GI+ ID       GQRIG+FAGSG+GKSTLL 
Sbjct: 119 -KFEKSIPINNVPPDPLERKRIREVMPLGIKAIDGLLTCGKGQRIGIFAGSGVGKSTLLG 177

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPLTA 238
           M AR+   D  +I+L+GERGREV EF+E  LG+  LKKSVVVVATSD   ++R    +TA
Sbjct: 178 MMARNAKADLNVIALIGERGREVNEFLEKDLGEEGLKKSVVVVATSDTPALIRVKGAMTA 237

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
             IAEYF  +G +VLL++DS+TRFA + RE+  + GE PV+RGY  SVFS LP+LLER G
Sbjct: 238 TAIAEYFRDQGLDVLLMMDSVTRFAMAQREVGLSIGEAPVSRGYTPSVFSVLPKLLERSG 297

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
            S+K  G+ITA+ +VLVDGD+ N+PIAD+VR ILDGHIVL+R LA +  YP +D LASVS
Sbjct: 298 CSKK--GSITALYTVLVDGDDLNEPIADAVRGILDGHIVLSRKLANKNHYPAIDVLASVS 355

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+ +   + + K+L++    ++  + E  D+  IG Y  G +  +D+A+     + +FL+
Sbjct: 356 RVMNDIITEEHKELIARFKDILASYTEAEDLINIGAYNFGSNPKIDEAIELNDKMNNFLR 415

Query: 419 Q 419
           Q
Sbjct: 416 Q 416


>gi|299534784|ref|ZP_07048114.1| flagellum-specific ATP synthase [Lysinibacillus fusiformis ZC1]
 gi|298729872|gb|EFI70417.1| flagellum-specific ATP synthase [Lysinibacillus fusiformis ZC1]
          Length = 444

 Score =  293 bits (749), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 161/365 (44%), Positives = 234/365 (64%), Gaps = 9/365 (2%)

Query: 59  LGQVIRINLDIVYICPVGIGEEISLGDLVFHWG---RFRISPSACWCGRVINALGKPIDG 115
           L +V+    +IV + P     EIS+G LV   G     ++ P     G+V++++G PIDG
Sbjct: 61  LAEVVGFKDEIVVLMPFTSLREISIGCLVEGTGAPLEVKVGPE--LIGKVLDSMGNPIDG 118

Query: 116 DDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKS 175
              L +G +++      P  + R  + +  + G++ ID    + +GQR+G+FAGSG+GKS
Sbjct: 119 T-LLPRGLMTVPTEQDPPNPLTRPPINERLEVGVKAIDGMLTVGNGQRVGIFAGSGVGKS 177

Query: 176 TLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMA 234
           TLL M AR+   D  +I+L+GERGREVREFIE  LG + L +S+VV ATSD+  ++R   
Sbjct: 178 TLLGMIARNTQADLNVIALIGERGREVREFIERDLGAEGLSRSIVVAATSDQPALMRIKG 237

Query: 235 PLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLL 294
             TA  IAEYF ++G NV+L++DS+TR A + REI   +GE P  +GY  SVF+ LP+LL
Sbjct: 238 AFTATAIAEYFRNRGLNVMLMMDSVTRVAMAQREIGLATGEPPAQKGYTPSVFAILPKLL 297

Query: 295 ERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPL 354
           ER G +EK  G+ITA  +VLVDGD+ N+PIAD+VR ILDGHIVL+R+LA +G+YP ++ L
Sbjct: 298 ERTGTNEK--GSITAFYTVLVDGDDMNEPIADTVRGILDGHIVLDRNLANKGQYPAINVL 355

Query: 355 ASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIY 414
            SVSRL +       KK    L  L + ++++ D+  IG Y+ G    +D+A+H  P+I 
Sbjct: 356 KSVSRLMNHVAEPTHKKAAERLRELYYTYDKSEDLINIGAYKRGTSKEIDEAIHYEPLIT 415

Query: 415 DFLKQ 419
            +LKQ
Sbjct: 416 AYLKQ 420


>gi|254509752|ref|ZP_05121819.1| H+-transporting two-sector ATPase, flagellum-specific
           [Rhodobacteraceae bacterium KLH11]
 gi|221533463|gb|EEE36451.1| H+-transporting two-sector ATPase, flagellum-specific
           [Rhodobacteraceae bacterium KLH11]
          Length = 454

 Score =  293 bits (749), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 158/387 (40%), Positives = 237/387 (61%), Gaps = 3/387 (0%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGD-FVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEIS 82
           G +S +T     +  L+Q   +GD   + +    D  G+V+ ++ D +++ P    + +S
Sbjct: 24  GRVSGVTGGVIRIDGLAQRARIGDHLTLRRNSGPDLQGEVLHVDADQIHMLPGAAPDGVS 83

Query: 83  LGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVE 142
           LGD V        +P   W GRVI+  G P+DG   L  G    ++M   P A++R+ + 
Sbjct: 84  LGDPVSLDQLPAFAPGMHWLGRVIDPFGAPLDGKPLL-PGTQECDLMQTPPAAVSRKPLG 142

Query: 143 KGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREV 202
              +TG+ +++   P+  GQRIG+FAGSG+GKSTLL+  AR+   D V+++LVGERGREV
Sbjct: 143 ARMETGLAILNTMLPIVQGQRIGLFAGSGVGKSTLLATLARTMQADAVVVALVGERGREV 202

Query: 203 REFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITR 261
            EF+E  LG D +++SVVV ATSD+S + R+    +A+++AEY   +G NVL + DS+TR
Sbjct: 203 NEFVETALGADGMRRSVVVAATSDQSALARRRCAWSAMSVAEYLRDQGLNVLFLADSVTR 262

Query: 262 FAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHN 321
           FA + REIA  +GE    RG+P SV   +  L ER GP   ++G+ITAV SVLV G + +
Sbjct: 263 FAEAHREIAVATGESASLRGFPPSVTPLIANLCERAGPGTAQQGDITAVFSVLVAGSDMD 322

Query: 322 DPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIH 381
           +PIAD +R +LDGHIVL+R +AE GRYP +D   SVSR    A + DE ++++    L+ 
Sbjct: 323 EPIADILRGVLDGHIVLSRDIAERGRYPAIDLSKSVSRSLPGAATEDENQVITDARKLVG 382

Query: 382 RFEETRDIRLIGGYRPGVDLILDKAVH 408
            +E++  +   G Y  G D +LD+AV 
Sbjct: 383 SYEQSEVMIKAGLYAEGADPLLDRAVR 409


>gi|21230693|ref|NP_636610.1| type III secretion system ATPase [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66769312|ref|YP_244074.1| type III secretion system ATPase [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|21112282|gb|AAM40534.1| HrpB6 protein [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66574644|gb|AAY50054.1| HrpB6 protein [Xanthomonas campestris pv. campestris str. 8004]
          Length = 442

 Score =  293 bits (749), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 162/374 (43%), Positives = 225/374 (60%), Gaps = 5/374 (1%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISP-SACWCGRVINALGKPIDGDDSL 119
           +V+  +  +  + P G    +S    V   GR    P  +   GRV++ LG+P DG   L
Sbjct: 63  EVVGFSRTLALLAPFGELVGLSRQTRVIGLGRPLAVPVGSALLGRVLDGLGEPADGQGPL 122

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
             GD  ++I ++ P  M R+ +E+   TG+R++D    L  GQR+G+FA +G+GKSTL+ 
Sbjct: 123 A-GDDWVQIQAQAPDPMRRRLIEQPLPTGVRIVDGLMTLGEGQRMGIFAAAGVGKSTLIG 181

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTA 238
           MFAR    D  +I L+GERGREVREFIE  LG D L +SVVV ATSD S I R  A    
Sbjct: 182 MFARGTQCDVNVIVLIGERGREVREFIEMILGPDGLARSVVVCATSDRSSIERAKAAYVG 241

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
             IAEYF  +G  VLL++DS+TRFA + REI   +GE P  RG+P SVF+ELPRLLER G
Sbjct: 242 TAIAEYFRDRGMRVLLMMDSLTRFARAQREIGLAAGEPPTRRGFPPSVFAELPRLLERAG 301

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
             E   G+ITA  +VL + D  +DPIA+ VR ILDGH++L+R +A   +YP +D L S+S
Sbjct: 302 MGET--GSITAFYTVLAEDDTGSDPIAEEVRGILDGHLILSREIAARNQYPAIDVLGSLS 359

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+  +  SA++++    L  L+ +  E   +  +G YR G D + D+A+ ++  I DFL 
Sbjct: 360 RVMSQIVSAEQRQYAGQLRRLLAKHNEVETLLQVGEYRHGSDAVADEAIARIDAIRDFLS 419

Query: 419 QSPSDLSSEDVFQE 432
           Q    LS  D   E
Sbjct: 420 QPTDQLSDYDTILE 433


>gi|226225734|ref|YP_002759840.1| flagellum-specific ATP synthase [Gemmatimonas aurantiaca T-27]
 gi|226088925|dbj|BAH37370.1| flagellum-specific ATP synthase [Gemmatimonas aurantiaca T-27]
          Length = 457

 Score =  293 bits (749), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 166/419 (39%), Positives = 250/419 (59%), Gaps = 16/419 (3%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDF--VVHQGKNSDNLGQVIRINLDIVYICPVGIGEEI 81
           G ++ +  +    T +   V LG    V +  ++   L +V+  N   V + P+G  + +
Sbjct: 34  GRVTRVVGLVVEATGID--VGLGSLCRVTNHARDRSVLAEVVGFNERNVLLMPLGELDGL 91

Query: 82  SLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGD---DSLGKGDLSMEIMSKVPPAMN 137
             G  V   GR F +       GRV+N LG PIDG    D++ +  LS E     P  + 
Sbjct: 92  HAGASVQPLGRSFGVDVGPGLLGRVLNGLGHPIDGKGKLDTIERVSLSAE----PPNPLQ 147

Query: 138 RQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGE 197
           R+ +++  +TG+R ID    +  GQR+G+FAGSG+GKST+L M ARS   D  +I+L+GE
Sbjct: 148 RETIDRPMETGVRAIDGLLTIGRGQRVGIFAGSGVGKSTMLGMVARSAKADVNVIALLGE 207

Query: 198 RGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLIL 256
           RGREVREF+E+ LG + L +SVV+VAT D++ ++R    L A  IAEYF  +G  VLL++
Sbjct: 208 RGREVREFLENSLGAEGLARSVVIVATGDQAALVRARGALVATAIAEYFRDQGKEVLLMV 267

Query: 257 DSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVD 316
           DS+TR A + REI   +GE P  +GYP SVF+ LPRLLER G    E+G IT + +VLVD
Sbjct: 268 DSVTRVAMAWREIGLATGEPPTTKGYPPSVFANLPRLLERAG--NGERGGITGIYTVLVD 325

Query: 317 GDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSL 376
           GD+ N+P+AD+ RSILDGHIVL R LA +  +P +D L S SR+ D   +  +++  +++
Sbjct: 326 GDDFNEPVADAARSILDGHIVLTRRLAAQNHFPAIDVLDSKSRVKDHITNEAQRRSGAAM 385

Query: 377 THLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS-EDVFQEIT 434
             L   + E  D+ ++G Y+ G D  +D A+     + +FL+Q P +++   D +Q + 
Sbjct: 386 LRLEAAYREKEDLIMVGAYQKGSDPYVDAAIAYRHRVLEFLQQRPDEITPYGDTYQALN 444


>gi|219670156|ref|YP_002460591.1| peptidase C14, ICE, catalytic subunit p20, active site
           [Desulfitobacterium hafniense DCB-2]
 gi|219540416|gb|ACL22155.1| Peptidase C14, ICE, catalytic subunit p20, active site
           [Desulfitobacterium hafniense DCB-2]
          Length = 433

 Score =  292 bits (748), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 167/424 (39%), Positives = 253/424 (59%), Gaps = 12/424 (2%)

Query: 18  NLVVQGGYISSITSVYYTVTCLSQYVCLGDFV-VHQGKNSDNLGQVIRINLDIVYICPVG 76
           +L+V  G ++ I  V   +      V +G++  +H  +  +   +V+        + P+ 
Sbjct: 15  DLIVSHGRVAKI--VGLMIESDGPRVSVGEYCRIHTQQGKEIPAEVVGFRNSTTLLMPLA 72

Query: 77  IGEEISLGD-LVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPA 135
             E I+ GD +V    +  +       GR+++ LG+P+DG   + + D  ++  +  P A
Sbjct: 73  ELEGIAPGDRVVPQQHKLEVGVGQALLGRILDGLGRPLDGRPMVTQRDYPLQ--NAPPSA 130

Query: 136 MNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLV 195
             R R+      G+R +D    +  GQRIG+FAGSG+GKSTLL M AR+      +I+LV
Sbjct: 131 FLRPRIRDPLSVGVRTVDGILTIGRGQRIGIFAGSGVGKSTLLGMMARNTTAGVNVIALV 190

Query: 196 GERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLL 254
           GERGRE+R+FIE  LG+  L++SV+VVATSD+  ++R  A  TA  IAEYF  +G +VLL
Sbjct: 191 GERGRELRDFIEKDLGEEGLERSVLVVATSDQPALVRLKAAFTATAIAEYFRDQGQDVLL 250

Query: 255 ILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVL 314
           ++DS+TRFA + RE+   +GE P  RGYP SVF+ LP+LLER G SE   G+IT + +VL
Sbjct: 251 MMDSVTRFAMAQREVGLTAGEPPATRGYPPSVFAMLPKLLERSGMSEI--GSITGIYTVL 308

Query: 315 VDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVS 374
           VDGD+HN+PIAD+VR ILDGHIVL R LA +  YP +D L SVSR+ +   + + K+L  
Sbjct: 309 VDGDDHNEPIADTVRGILDGHIVLTRELAMQNHYPAIDTLQSVSRVMNDIIAPEHKELAG 368

Query: 375 SLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEIT 434
            L   +  + + +D+  IG Y  G +  +D A+  +  I  FL+Q   D+  +  F ++ 
Sbjct: 369 KLREHLAVYHDAKDLIDIGAYVTGSNPRIDAAIRHIEGINGFLRQ---DVEEKVSFDQML 425

Query: 435 KKLQ 438
           ++LQ
Sbjct: 426 RQLQ 429


>gi|197104319|ref|YP_002129696.1| flagellum-specific ATP synthase FliI [Phenylobacterium zucineum
           HLK1]
 gi|196477739|gb|ACG77267.1| flagellum-specific ATP synthase FliI [Phenylobacterium zucineum
           HLK1]
          Length = 449

 Score =  292 bits (748), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 152/343 (44%), Positives = 216/343 (62%), Gaps = 7/343 (2%)

Query: 95  ISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDI 154
           + P+  W GR ++A G PIDG   L +G  S  + +  P A  R RV +    G+R +++
Sbjct: 91  VRPTRAWLGRTVDAFGNPIDGKGPLPQGLASYPLRAPPPAAHARARVGERLDLGVRAMNV 150

Query: 155 FTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DN 213
           FT  C GQR+GVFAGSG+GKS LLSM A++   D V++ L+GERGREVREFIE+ LG + 
Sbjct: 151 FTTCCRGQRLGVFAGSGVGKSVLLSMLAKNADCDAVVVGLIGERGREVREFIEETLGEEG 210

Query: 214 LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNS 273
           LK+++VVVATSDE  + R+ A    + IAE+   +   VL ++DS+TRFA + REI   +
Sbjct: 211 LKRAIVVVATSDEPALKRRQAAYMTMAIAEFLRDQDLEVLCLMDSVTRFAMAQREIGLAA 270

Query: 274 GELPVARGYPTSVFSELPRLLERIGPSE-----KEKGNITAVISVLVDGDNHNDPIADSV 328
           GE P  +GY  +VF+ELP+LLER GP          G IT + +VLVDGD+HN+PIAD+V
Sbjct: 271 GEPPTTKGYTPTVFTELPKLLERAGPGPIRPDGTRAGPITGLFTVLVDGDDHNEPIADAV 330

Query: 329 RSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRD 388
           R ILDGHIV+ R++AE GR+P ++ L S+SR         E+++V      +  +    +
Sbjct: 331 RGILDGHIVMERAIAERGRFPAINVLKSISRTMPGCQQPHEREVVKQARQALSAYANMEE 390

Query: 389 IRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS-EDVF 430
           +  IG YR G D ++D+A+   P +  FL Q P D +  E+ F
Sbjct: 391 LIRIGAYRAGADPLIDRAIELNPSLEAFLSQDPDDATGLEESF 433


>gi|306820116|ref|ZP_07453764.1| flagellar protein export ATPase FliI [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
 gi|304551894|gb|EFM39837.1| flagellar protein export ATPase FliI [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
          Length = 439

 Score =  292 bits (747), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 165/367 (44%), Positives = 233/367 (63%), Gaps = 5/367 (1%)

Query: 59  LGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDD 117
           + +V+    + V + P+G  + IS G  V   G    +       GRV++ LG+PID  +
Sbjct: 58  MAEVVGFTENAVLLMPLGDMQGISPGATVIASGNSHEVQVGDSLLGRVLDGLGQPIDDKE 117

Query: 118 SLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
           SL     +  + +  P  ++R R+ +    G++VID       GQRIG+FAGSG+GKSTL
Sbjct: 118 SLNVSR-AYPVNNMPPNPLSRMRIREPLPLGVKVIDGMLTCGRGQRIGIFAGSGVGKSTL 176

Query: 178 LSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPL 236
           L M AR+   D  +I L+GERGREV+EFIE+ L +  L +SVVVVATSD+  ++RK   L
Sbjct: 177 LGMIARNTVADINVIGLIGERGREVKEFIENDLKEEGLSRSVVVVATSDQPALVRKKGAL 236

Query: 237 TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLER 296
            A +IAEYF  +G NV+L++DS+TRF+ + RE+    GE PV +GYP SVF+ELPRLLER
Sbjct: 237 LATSIAEYFRDQGKNVILMMDSLTRFSMAQREVGLAIGEPPVTKGYPPSVFAELPRLLER 296

Query: 297 IGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLAS 356
            G S+K  G+ITA+ +VLVDGD+ N+PIAD+VR ILDGHIVL+R+LA +  YP +D LAS
Sbjct: 297 SGNSDK--GSITALYTVLVDGDDMNEPIADTVRGILDGHIVLSRALANKNHYPAIDVLAS 354

Query: 357 VSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDF 416
           VSR+     S +  K V  +  L+  ++++ D+  IG Y  G    +D A+ +   I +F
Sbjct: 355 VSRVMPSIISGEHMKKVGVMRDLLATYKDSEDLISIGAYVKGSSKKVDFAIEKNDEINNF 414

Query: 417 LKQSPSD 423
           LKQ   D
Sbjct: 415 LKQGVHD 421


>gi|315186386|gb|EFU20146.1| type III secretion system ATPase, FliI/YscN [Spirochaeta
           thermophila DSM 6578]
          Length = 448

 Score =  292 bits (747), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 164/361 (45%), Positives = 226/361 (62%), Gaps = 5/361 (1%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSL 119
           +VI +    VY+      E I +GD++   G    I  S    GRV++A G PID    L
Sbjct: 57  EVIGLKGSTVYLMGYQDPEGIQVGDVIEAMGEPLSIRVSEGLLGRVLDARGMPIDDKGPL 116

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
             G +   +    P  + R+R+E+   TGIR +D   P+  GQR+GVF+GSG+GKSTLL 
Sbjct: 117 PPG-IRYPVQGGPPHVLKRRRIEEQIATGIRALDGLLPIGKGQRVGVFSGSGVGKSTLLG 175

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTA 238
           M AR+   D  +I+L+GERGREV EFIE  LG+  LK+SVVVV+TSD   + R      A
Sbjct: 176 MVARNTNADVNVIALIGERGREVAEFIEHDLGEEGLKRSVVVVSTSDTPAVARYRGAFVA 235

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
           V IAEYF  +G +V+L+ DS+TRFA ++REI    GE P  RGYP SVFS LP+LLER G
Sbjct: 236 VAIAEYFRDQGKDVMLLFDSVTRFARALREIGLALGESPATRGYPPSVFSTLPKLLERCG 295

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
            S  EKG IT   SVLV+GD+ ++P++D+VR ILDGH+VL+R LA+   YP +D L+SVS
Sbjct: 296 TS--EKGTITGFFSVLVEGDDMDEPVSDAVRGILDGHVVLSRRLAQRQHYPAIDVLSSVS 353

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           RLA K  +   ++    +   +  ++ET D+  +G Y  G +  +DKA+ ++P I  FL+
Sbjct: 354 RLAPKITTPPVREAARRVLRWLAAYQETEDLINVGAYARGSNPEVDKAIEKLPDINAFLR 413

Query: 419 Q 419
           Q
Sbjct: 414 Q 414


>gi|294665982|ref|ZP_06731245.1| type III secretion system ATPase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292604230|gb|EFF47618.1| type III secretion system ATPase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 442

 Score =  292 bits (747), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 161/370 (43%), Positives = 225/370 (60%), Gaps = 5/370 (1%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISP-SACWCGRVINALGKPIDGDDSL 119
           +V+  + D+  + P G    +S    V   GR    P      GRV++ LG+P DG  ++
Sbjct: 63  EVVGFSRDLALLAPFGELVGLSRETRVIGLGRPLAVPVGPALLGRVLDGLGEPSDGQGAI 122

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
              D  + I ++ P  M R+ +E+   TG+R++D  T L  GQR+G+FA +G+GKSTL+ 
Sbjct: 123 AC-DTWVPIQAQAPDPMRRRLIEQPMPTGVRIVDGLTTLGEGQRMGIFAAAGVGKSTLMG 181

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTA 238
           MFAR    D  +I L+GERGREVREFIE  LG D L +SVVV ATSD S I R  A    
Sbjct: 182 MFARGTQCDVNVIVLIGERGREVREFIELILGADGLARSVVVCATSDRSSIERAKAAYVG 241

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
             IAEYF  +G  VLL++DS+TRFA + REI   +GE P  RG+P SVF+ELPRLLER G
Sbjct: 242 TAIAEYFRDRGLRVLLMMDSLTRFARAQREIGLAAGEPPTRRGFPPSVFAELPRLLERAG 301

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
             E   G+ITA  +VL + D  +DPIA+ VR ILDGH++L+R +A + +YP +D LAS+S
Sbjct: 302 MGEN--GSITAFYTVLAEDDTGSDPIAEEVRGILDGHLILSREIAAKNQYPAIDVLASLS 359

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+  +   +D  +    L  L+ ++ E   +  +G YR G D + D+A+ ++  I DFL 
Sbjct: 360 RVMSQIVPSDHSQAAGQLRRLLAKYNEVETLVQVGEYRQGSDAVADEAIDRIDAIRDFLS 419

Query: 419 QSPSDLSSED 428
           Q    LS+ D
Sbjct: 420 QPTDQLSAYD 429


>gi|227876742|ref|ZP_03994851.1| H(+)-transporting two-sector ATPase [Mobiluncus mulieris ATCC
           35243]
 gi|269976269|ref|ZP_06183265.1| flagellum-specific ATP synthase [Mobiluncus mulieris 28-1]
 gi|306817689|ref|ZP_07451431.1| flagellar protein export ATPase FliI [Mobiluncus mulieris ATCC
           35239]
 gi|307699792|ref|ZP_07636843.1| ATPase FliI/YscN family protein [Mobiluncus mulieris FB024-16]
 gi|227842639|gb|EEJ52839.1| H(+)-transporting two-sector ATPase [Mobiluncus mulieris ATCC
           35243]
 gi|269935598|gb|EEZ92136.1| flagellum-specific ATP synthase [Mobiluncus mulieris 28-1]
 gi|304649503|gb|EFM46786.1| flagellar protein export ATPase FliI [Mobiluncus mulieris ATCC
           35239]
 gi|307614830|gb|EFN94048.1| ATPase FliI/YscN family protein [Mobiluncus mulieris FB024-16]
          Length = 441

 Score =  291 bits (746), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 170/413 (41%), Positives = 245/413 (59%), Gaps = 9/413 (2%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISL 83
           G + S+  +   V  L    C    VV  G  +    +V+ ++  +    P+   + + +
Sbjct: 22  GEVESVVGLSVQVRGLD---CRVGEVVLVGDGTGTPAEVVALDAGLASCMPLDNLDGLRV 78

Query: 84  GDLVFHWGRFRISP-SACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVE 142
           G  V   G     P      GRVI+A G+PIDG   +   D  + I    P A+ R R++
Sbjct: 79  GSPVRGTGLPATVPVGPALLGRVIDAAGRPIDGKGPIYVAD-HVPIHGSAPNALERARID 137

Query: 143 KGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREV 202
                G+RV+D    L  GQRIG+FAGSG+GKSTL+SM AR    +  +I+LVGERGREV
Sbjct: 138 TPVAMGVRVLDTLVTLGRGQRIGLFAGSGVGKSTLMSMIARGTNAEVCVIALVGERGREV 197

Query: 203 REFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITR 261
           REF+ED LG+  L +SVVVVATSDESP+LRK A  TA  +AEY+   G +VLL++DS+TR
Sbjct: 198 REFLEDDLGEEGLSRSVVVVATSDESPMLRKRAAFTATRVAEYYRDAGRHVLLMMDSLTR 257

Query: 262 FAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHN 321
              + REI  + GE P  RGYP S FS + +LLER G      G++T + +VLVDGD+HN
Sbjct: 258 TCMAQREIGLSVGEPPATRGYPPSTFSMMAQLLERAGSGAV--GSVTGIYTVLVDGDDHN 315

Query: 322 DPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIH 381
           +PIAD  RSILDGH+VL+R LA  G YP VD LAS+SR+A K  + ++K+  ++L  ++ 
Sbjct: 316 EPIADQARSILDGHVVLDRKLAVAGHYPAVDALASISRVASKVCTREQKEAATALRQVMG 375

Query: 382 RFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSD-LSSEDVFQEI 433
                +D+  +G Y+ G +  +D A+     I  FL Q   + ++ ++ +Q++
Sbjct: 376 AKRGVQDLLDVGAYQQGTNPEVDLALQYDEEIEAFLTQKTDEKITFDEAWQQL 428


>gi|159024047|gb|ABW87275.1| HrcN [Xanthomonas fuscans subsp. fuscans]
          Length = 442

 Score =  291 bits (746), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 161/370 (43%), Positives = 225/370 (60%), Gaps = 5/370 (1%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISP-SACWCGRVINALGKPIDGDDSL 119
           +V+  + D+  + P G    +S    V   GR    P      GRV++ LG+P DG  ++
Sbjct: 63  EVVGFSRDLALLAPFGELVGLSRETRVIGLGRPLAVPVGPALLGRVLDGLGEPSDGQGAI 122

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
              D  + I ++ P  M R+ +E+   TG+R++D  T L  GQR+G+FA +G+GKSTL+ 
Sbjct: 123 AC-DTWVPIQAQAPDPMRRRLIEQPMPTGVRIVDGLTTLGEGQRMGIFAAAGVGKSTLMG 181

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTA 238
           MFAR    D  +I L+GERGREVREFIE  LG D L +SVVV ATSD S I R  A    
Sbjct: 182 MFARGTQCDVNVIVLIGERGREVREFIELILGADGLARSVVVCATSDRSSIERAKAAYVG 241

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
             IAEYF  +G  VLL++DS+TRFA + REI   +GE P  RG+P SVF+ELPRLLER G
Sbjct: 242 TAIAEYFRDRGLRVLLMMDSLTRFARAQREIGLAAGEPPTRRGFPPSVFAELPRLLERAG 301

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
             E   G+ITA  +VL + D  +DPIA+ VR ILDGH++L+R +A + +YP +D LAS+S
Sbjct: 302 MGEN--GSITAFYTVLAEDDTGSDPIAEEVRGILDGHLILSREIAAKNQYPAIDVLASLS 359

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+  +   +D  +    L  L+ ++ E   +  +G YR G D + D+A+ ++  I DFL 
Sbjct: 360 RVMSQIVPSDHSQAARQLRRLLAKYNEVETLVQVGEYRQGSDAVADEAIDRIDAIRDFLS 419

Query: 419 QSPSDLSSED 428
           Q    LS+ D
Sbjct: 420 QPTDQLSAYD 429


>gi|158320515|ref|YP_001513022.1| flagellar protein export ATPase FliI [Alkaliphilus oremlandii
           OhILAs]
 gi|158140714|gb|ABW19026.1| flagellar protein export ATPase FliI [Alkaliphilus oremlandii
           OhILAs]
          Length = 437

 Score =  291 bits (744), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 170/425 (40%), Positives = 258/425 (60%), Gaps = 10/425 (2%)

Query: 7   TLAQLAEDYSK-NLVVQGGYISSITSVYYTVTCLSQYVCLGDFV-VHQGKNSDN-LGQVI 63
           +L +  E  SK +L+   GY+S +  +  T+  +   V LG+   ++  K ++  L +V+
Sbjct: 5   SLKKYEEALSKLDLIKYTGYVSQVIGL--TIESVGPAVKLGEMCKIYSLKGTEPILSEVV 62

Query: 64  RINLDIVYICPVGIGEEISLGDLVFHWG-RFRISPSACWCGRVINALGKPIDGDDSLGKG 122
                 V + P+G  E I  G  V   G   ++S      GRV++ LG PID D  L   
Sbjct: 63  GFKEKKVLLMPLGEMEGIGPGSKVEALGITMQVSVGEELLGRVLDGLGNPID-DKELLNT 121

Query: 123 DLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFA 182
           + +  +M+  P  + R ++ +    G++ +D      +GQRIG+FAGSG+GKSTLL M A
Sbjct: 122 NKTYPVMAAPPNPLKRTKINEPLALGVKTLDGLLTCGNGQRIGIFAGSGVGKSTLLGMIA 181

Query: 183 RSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPLTAVTI 241
           R+   D  +I+L+GERGREVREFIE+ L +  LK+SVV+VATSD+  ++RK   L A  +
Sbjct: 182 RNTQADINVIALIGERGREVREFIENDLQEEGLKRSVVIVATSDQPALIRKKGALLATAV 241

Query: 242 AEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSE 301
           AEYF  +G NV+L++DS+TRF+ + RE+    GE PV+RGY  SVF+ELP+LLER G S 
Sbjct: 242 AEYFRDQGKNVILMMDSLTRFSMAQREVGLAVGEPPVSRGYTPSVFAELPKLLERSGTS- 300

Query: 302 KEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLA 361
            +KG+IT + +VLVDGD+ N+PIAD+VR ILDGHIVL+R +A    YP +D LASVSR+ 
Sbjct: 301 -DKGSITGLYTVLVDGDDMNEPIADTVRGILDGHIVLSRKIANRNHYPAIDVLASVSRVM 359

Query: 362 DKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSP 421
                     + + +  L+  +  + D+  IG Y  G +  +D++++++  I  FL+Q  
Sbjct: 360 PNIVEKKHLLIANEIKELLSTYNSSEDLINIGAYIKGTNRRIDESINKIDSINSFLRQDV 419

Query: 422 SDLSS 426
            D ++
Sbjct: 420 HDKTT 424


>gi|170742092|ref|YP_001770747.1| flagellum-specific ATP synthase [Methylobacterium sp. 4-46]
 gi|168196366|gb|ACA18313.1| flagellar protein export ATPase FliI [Methylobacterium sp. 4-46]
          Length = 451

 Score =  291 bits (744), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 153/333 (45%), Positives = 215/333 (64%), Gaps = 2/333 (0%)

Query: 95  ISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDI 154
           I PS  W GRV++ALG+P+DG   L  G L   + +  PPA  R RV      G+R I+ 
Sbjct: 105 IRPSPAWLGRVVDALGRPVDGRGPLPPGPLPYPLRADPPPAHARARVGPPLDLGVRCINT 164

Query: 155 FTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DN 213
           F  +C GQR+G+FAGSG+GKS LLSM AR+   D  +I LVGERGREV+EF++D LG + 
Sbjct: 165 FLTMCVGQRMGIFAGSGVGKSVLLSMLARAAACDVAVIGLVGERGREVQEFLQDDLGPEG 224

Query: 214 LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNS 273
           L +SVVVVATSDE  ++R+ A    + +AE F   G  VL ++DS+TRFA + R++   +
Sbjct: 225 LARSVVVVATSDEPALMRRNAAYVTLALAESFRDAGAQVLCMIDSVTRFAMAQRDVGLAA 284

Query: 274 GELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILD 333
           GE P A+GY  +VFSELPRLLER GP     G+I+ + +VLV+GD+HN+P+AD+VR ILD
Sbjct: 285 GEPPTAKGYTPTVFSELPRLLERAGPGTG-AGSISGLFTVLVEGDDHNEPVADAVRGILD 343

Query: 334 GHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIG 393
           GHIV+ R +AE GRYP ++ L SVSR   +A        V     L+  + +  ++  +G
Sbjct: 344 GHIVMERRIAEGGRYPAINVLRSVSRTMPRACDPAFLPTVQRARWLLSTYADMEELIRLG 403

Query: 394 GYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
            YRPG    +D+A+  +P +  F++Q   + +S
Sbjct: 404 AYRPGSSPDVDEAIGLMPDLEAFMRQGKEEATS 436


>gi|307718601|ref|YP_003874133.1| hypothetical protein STHERM_c09130 [Spirochaeta thermophila DSM
           6192]
 gi|306532326|gb|ADN01860.1| hypothetical protein STHERM_c09130 [Spirochaeta thermophila DSM
           6192]
          Length = 448

 Score =  290 bits (743), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 164/361 (45%), Positives = 225/361 (62%), Gaps = 5/361 (1%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSL 119
           +VI +    VY+      E I +GD++   G    I  S    GRV++A G PID    L
Sbjct: 57  EVIGLKGSTVYLMGYRDPEGIQVGDVIEAMGEPLSIRVSEGLLGRVLDARGMPIDDKGPL 116

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
             G +   +    P  + R+R+E+   TGIR +D   P+  GQR+GVF+GSG+GKSTLL 
Sbjct: 117 PPG-IRYPVQGGPPHVLKRRRIEEQIATGIRALDGLLPIGKGQRVGVFSGSGVGKSTLLG 175

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPLTA 238
           M AR+   D  +I+L+GERGREV EFIE  LG+  LK+SVVVV+TSD   + R      A
Sbjct: 176 MVARNTNADVNVIALIGERGREVAEFIEHDLGEEGLKRSVVVVSTSDTPAVARYRGAFVA 235

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
           V IAEYF  +G +V+L+ DSITRFA ++RE+    GE P  RGYP SVFS LP+LLER G
Sbjct: 236 VAIAEYFRDQGKDVMLLFDSITRFARALREMGLALGESPATRGYPPSVFSTLPKLLERCG 295

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
            S  EKG IT   SVLV+GD+ ++P++D+VR ILDGH+VL+R LA+   YP +D L+SVS
Sbjct: 296 TS--EKGTITGFFSVLVEGDDMDEPVSDAVRGILDGHVVLSRRLAQRQHYPAIDVLSSVS 353

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           RLA K  +   +     +   +  ++ET D+  +G Y  G +  +DKA+ ++P I  FL+
Sbjct: 354 RLAPKITTPPVRDAARRVMRWLAAYQETEDLINVGAYARGSNPEVDKAIEKLPDINAFLR 413

Query: 419 Q 419
           Q
Sbjct: 414 Q 414


>gi|85706173|ref|ZP_01037268.1| H+-transporting two-sector ATPase, flagellum-specific [Roseovarius
           sp. 217]
 gi|85669337|gb|EAQ24203.1| H+-transporting two-sector ATPase, flagellum-specific [Roseovarius
           sp. 217]
          Length = 444

 Score =  290 bits (743), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 158/397 (39%), Positives = 241/397 (60%), Gaps = 5/397 (1%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNL-GQVIRINLDIVYICPVGIGEEIS 82
           G +S++      ++ LS    LGD VV Q ++   L G+VIR+    + + P    + ++
Sbjct: 18  GRVSAVQGSSLQISGLSAEARLGDRVVIQRRSDGALHGEVIRLEAASLVVLPDTSPDGVA 77

Query: 83  LGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQR-V 141
           LGD V       ++PS  W GR+I+  G+P+DG   L   ++    +   PPA  R+R +
Sbjct: 78  LGDRVILGQENSVAPSHSWLGRIIDPFGEPLDGRPLLRGANI--RALRADPPAPTRRRTL 135

Query: 142 EKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGRE 201
               +TG+   +   P+  GQR+G+FAGSG+GKS LL   AR    D V+I+L+GERGRE
Sbjct: 136 GARLETGMVAFNTVLPIVRGQRVGLFAGSGVGKSMLLGHLARHMQADVVVIALIGERGRE 195

Query: 202 VREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSIT 260
           +REF+E  LG + +++SV+V ATSD SP++R+    TA+ +AE+F  +G  VL + DSIT
Sbjct: 196 LREFVETVLGPEGMRRSVIVAATSDRSPLIRRRCAWTAMAVAEFFRDEGKQVLFLADSIT 255

Query: 261 RFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNH 320
           RFA + RE+AT +GE+P  RG+P+S    +  L ER GP  +  G+ITA+++VLV G + 
Sbjct: 256 RFAEAHREVATAAGEMPALRGFPSSTAHLIMSLCERAGPGAESMGDITALLTVLVAGSDM 315

Query: 321 NDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLI 380
           ++PIAD +R +LDGH++L+R +AE GRYP +D L SVSR   +A S +E  L++    L+
Sbjct: 316 DEPIADILRGVLDGHVILDRQIAERGRYPAIDLLRSVSRSLPRAASDEENALIARARALL 375

Query: 381 HRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFL 417
             +  +  +   G Y  G D  LD+A+   P +  FL
Sbjct: 376 SSYSRSETMIRAGLYAEGSDPELDQAIRIWPDLDGFL 412


>gi|149203131|ref|ZP_01880102.1| H+-transporting two-sector ATPase, flagellum-specific [Roseovarius
           sp. TM1035]
 gi|149143677|gb|EDM31713.1| H+-transporting two-sector ATPase, flagellum-specific [Roseovarius
           sp. TM1035]
          Length = 444

 Score =  290 bits (742), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 159/412 (38%), Positives = 246/412 (59%), Gaps = 4/412 (0%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNL-GQVIRINLDIVYICPVGIGEEIS 82
           G +S++      ++ LS    LGD V  + ++   L G+VIR+    V + P    E ++
Sbjct: 18  GRVSAVQGNTLRISGLSSEARLGDRVDIRRRSGAPLSGEVIRLEAASVMVLPESSPEGVA 77

Query: 83  LGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVE 142
           LGD V       I+PS  W GR+I+  G P+DG   L +G  +  + ++ P    R+ + 
Sbjct: 78  LGDRVILGQAEAIAPSHGWLGRIIDPFGAPLDGRPLL-RGAETRALRAEPPAPARRRALG 136

Query: 143 KGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREV 202
              +TG+   +   P+  GQR+G+FAGSG+GK+ LL   AR    D V+I+L+GERGRE+
Sbjct: 137 ARLETGMAAFNTVLPIVRGQRVGLFAGSGVGKTMLLGHLARHMQADVVVIALIGERGREL 196

Query: 203 REFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITR 261
           REF+E  LG + ++++V+V ATSD SP++R+    TA+ +AE+F  +G  VL + DSITR
Sbjct: 197 REFVEHVLGPEGMRRAVIVAATSDRSPLVRRRCAWTAMAVAEFFRDQGQQVLFLADSITR 256

Query: 262 FAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHN 321
           FA + RE+AT +GE+P  RG+P S    +  L ER GP E   G+ITA+++VLV G +  
Sbjct: 257 FAEAHREVATAAGEMPALRGFPASTSHLIMSLCERAGPGEDGAGDITALLTVLVAGSDME 316

Query: 322 DPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIH 381
           +PIAD +R +LDGH+VL+R +AE GRYP +D L SVSR   +A + +E  L+S    L+ 
Sbjct: 317 EPIADILRGVLDGHVVLDRQIAERGRYPAIDLLRSVSRSLPRAATDEENTLISRTRSLLG 376

Query: 382 RFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEI 433
            +  +  +   G Y  G D  LD+A+   P +  FL +  + +S+++ F  +
Sbjct: 377 NYARSETMIKAGLYAEGSDPELDQAIRIWPELDGFLAEKEA-VSAKNSFARL 427


>gi|217077671|ref|YP_002335389.1| flagellar protein export ATPase FliI [Thermosipho africanus TCF52B]
 gi|217037526|gb|ACJ76048.1| flagellar protein export ATPase FliI [Thermosipho africanus TCF52B]
          Length = 434

 Score =  290 bits (741), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 165/377 (43%), Positives = 238/377 (63%), Gaps = 7/377 (1%)

Query: 58  NLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISP-SACWCGRVINALGKPIDGD 116
            L +V+  N + + + P+     +  G  V   G +   P S    G+VI++LG+P+DG 
Sbjct: 53  TLAEVVGFNDNGIILMPLEDISGLKKGCQVLKTGEYVSVPVSEELLGKVIDSLGRPLDGK 112

Query: 117 DSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKST 176
               K    + I+ + P  + R+R+      G+R ID F  L +GQRIG+FAGSG+GKST
Sbjct: 113 KIYTKE--KVPIVREAPNPLVRKRITTPISVGVRAIDGFLTLGYGQRIGIFAGSGVGKST 170

Query: 177 LLSMFARSDCFDKVIISLVGERGREVREFIE-DYLGDNLKKSVVVVATSDESPILRKMAP 235
           LL M AR+   D  +ISL+GERGREVREFIE D   + LK+SVVVV+TSD+  +LR  A 
Sbjct: 171 LLGMVARNTSADINVISLIGERGREVREFIEKDLKKEGLKRSVVVVSTSDQPALLRVKAL 230

Query: 236 LTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLE 295
           LTA +IAEYF  KG NVLL++DS+TR+A + RE+   +GE P  RGYP SVF+ LP++LE
Sbjct: 231 LTATSIAEYFRDKGYNVLLMVDSLTRWAIAQREVGLATGEPPTTRGYPPSVFAGLPKILE 290

Query: 296 RIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLA 355
           R G S  +KG+IT + +VLV+ D+ N+PI+D+VR I+DGHI+L+R LAE   YP +D L 
Sbjct: 291 RAGNS--DKGSITGIYTVLVESDDFNEPISDTVRGIVDGHIILSRKLAESAHYPAIDILM 348

Query: 356 SVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYD 415
           SVSRL +     + K     +  L+  + + +D+  +G Y+ G +  +DKA+  +  I  
Sbjct: 349 SVSRLMNDITRKEHKIAALKIKDLLATYYDAKDLIDVGAYKKGTNPKIDKAIELIDEINK 408

Query: 416 FLKQSPSD-LSSEDVFQ 431
           FL+QS  + +S ED  +
Sbjct: 409 FLRQSVDEKMSFEDTVE 425


>gi|258592502|emb|CBE68811.1| flagellum-specific ATP synthase [NC10 bacterium 'Dutch sediment']
          Length = 479

 Score =  289 bits (740), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 172/411 (41%), Positives = 240/411 (58%), Gaps = 7/411 (1%)

Query: 18  NLVVQGGYISSITSVYYTVTCLSQYVCLGDFV-VHQGKNSDNLGQVIRINLDIVYICPVG 76
           NL+   G ++ +  V   +  + Q   +G+   +      D   +V+  + +I+ + P+G
Sbjct: 19  NLIRSLGKVTKV--VGLVIEAVGQEAFIGELCRIRSAGRHDVWAEVVGFHGEILLLMPLG 76

Query: 77  IGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPA 135
               I  G  V   GR F +       GRV+N LG+PIDG   + + +    +  + P  
Sbjct: 77  EIHGIRPGSEVVAAGRPFEVPVGRSMLGRVVNGLGRPIDGKAPV-EVEARCSVHRQPPSP 135

Query: 136 MNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLV 195
           M R  + +   TGIRVID       GQR+G+FAGSG+GKSTLL M AR    D  +I+LV
Sbjct: 136 MTRAPIIEPLATGIRVIDGLLTCGKGQRVGIFAGSGVGKSTLLGMIARYTEADVNVIALV 195

Query: 196 GERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLL 254
           GERGREVREFI   LG D L++SVVVVATS+E  +LR+ A   A  IAEYF  +G +VLL
Sbjct: 196 GERGREVREFITKELGEDGLRRSVVVVATSNEPSLLRRQAAYVATAIAEYFRDQGKHVLL 255

Query: 255 ILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVL 314
           ++DS+TRFA + REI  + GE P  RGYP S F+ LP LLER G ++   G+IT + ++L
Sbjct: 256 MMDSLTRFALAQREIGLSVGEPPTTRGYPPSAFAMLPGLLERAGTAD-HGGSITGLYTIL 314

Query: 315 VDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVS 374
           V+GD+ N+P+AD  R+ILDGHIVL R LAE   YPPVD L SVSRL       + +   S
Sbjct: 315 VEGDDMNEPVADHARAILDGHIVLTRELAERNHYPPVDFLGSVSRLMSVVAPREVRAAAS 374

Query: 375 SLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLS 425
            L  L+    + +D+  IG Y  G +  +D+A+  +  I  FL+QS  + S
Sbjct: 375 KLRELLAAHRQAQDLINIGAYVSGSNPKVDEALRYMTPIEAFLRQSSDERS 425


>gi|146296283|ref|YP_001180054.1| flagellar protein export ATPase FliI [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145409859|gb|ABP66863.1| type III secretion system ATPase, FliI/YscN [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 431

 Score =  289 bits (740), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 162/411 (39%), Positives = 250/411 (60%), Gaps = 17/411 (4%)

Query: 16  SKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICP- 74
           S N     G+++ +  +  T+  +   V +G     +   S+ L +V+    + V + P 
Sbjct: 11  STNFYQFTGFVNQVIGL--TIESIGPAVSIGTLCKIKTAKSETLAEVVGFKENKVLLMPY 68

Query: 75  ---VGI--GEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIM 129
              VGI  G ++   D +F      +       GR+++ LG+PIDG   + K  +   + 
Sbjct: 69  SDLVGIFPGCKVIAQDSIFE-----VKVGEELLGRILDGLGQPIDGKGEI-KSKIKYPVE 122

Query: 130 SKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDK 189
           ++ P  + R R++     GI+ ID    +  GQR+G+FAGSG+GKSTLL M AR+   D 
Sbjct: 123 NRAPNPLERPRIDSVMPLGIKAIDALITIGKGQRVGIFAGSGVGKSTLLGMIARNAKADV 182

Query: 190 VIISLVGERGREVREFIE-DYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSK 248
            +++L+GERGRE++EF+E D   + LK+SVV+VATSDES + R  A   A+ IAEYF  +
Sbjct: 183 NVLALIGERGRELKEFLEKDLKEEGLKRSVVIVATSDESALKRVKAAYVAMAIAEYFRDQ 242

Query: 249 GDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNIT 308
           G +VL ++DS+TRFA + REI    GE PV+RGY  SVFS +P+LLER G  + +KG+IT
Sbjct: 243 GMDVLFMMDSLTRFAMAQREIGLAIGEPPVSRGYTPSVFSIMPKLLERAG--KNQKGSIT 300

Query: 309 AVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSAD 368
           A+ +VLVDGD+ N+PI D+ R ILDGHIVL+RS+A +  YP +D LAS+SR+ +   S +
Sbjct: 301 ALYTVLVDGDDFNEPITDTARGILDGHIVLSRSIANKNHYPAIDVLASISRVMNDIVSPE 360

Query: 369 EKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
            K++ +    ++  ++E  D+  IG Y  G +  +D+A+  +P I +FL+Q
Sbjct: 361 HKEVANETKRILATYKEAEDLITIGAYTKGTNSEIDRAIDLMPRINEFLRQ 411


>gi|119384841|ref|YP_915897.1| FliI/YscN family ATPase [Paracoccus denitrificans PD1222]
 gi|119374608|gb|ABL70201.1| ATPase, FliI/YscN family [Paracoccus denitrificans PD1222]
          Length = 444

 Score =  289 bits (739), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 167/405 (41%), Positives = 243/405 (60%), Gaps = 9/405 (2%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNL-GQVIRINLDIVYICPVGIGEEIS 82
           G +S+I +       L+ +  LGD VV   ++   L G+++ ++ D   I P G  + +S
Sbjct: 18  GQVSAIQAGVILAGGLNSHASLGDRVVFSMRSGQVLNGEIVALHSDQAVILPEGPMDGLS 77

Query: 83  LG---DLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQ 139
           +    +LVF      ++P+  W GR+I+  G+P+DG   +  G+         PPA +R 
Sbjct: 78  ISTRVELVFAP---MLAPANAWIGRIIDPFGRPLDGRPLVAGGE-ERGFRPPPPPAASRN 133

Query: 140 RVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERG 199
           R+     TG+ V D   PL  GQR+G+FAGSG+GKSTLLSM A+    D V+I+LVGERG
Sbjct: 134 RLGGRLDTGLAVFDTLLPLVRGQRMGLFAGSGVGKSTLLSMLAKGVPADVVVIALVGERG 193

Query: 200 REVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDS 258
           RE+REF+E+ LG+  + +SVVV ATSD+ P++R+     A+T+AE+F  +G +VL + DS
Sbjct: 194 RELREFVEETLGEEGMARSVVVAATSDQPPLMRRRCAWAAMTVAEHFRDQGRHVLFLADS 253

Query: 259 ITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGD 318
           ITRFA + REIA  +GE P  RG+P S    +  L ER GP     G+ITA+ SVLV G 
Sbjct: 254 ITRFAEAHREIALAAGESPSYRGFPPSTSHLIMSLAERSGPGPAGAGDITAIFSVLVAGS 313

Query: 319 NHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTH 378
           +  +P+AD +R +LDGH+VL+R++AE GR+P VD L SVSR   +A SADE  L++    
Sbjct: 314 DMEEPVADILRGVLDGHVVLDRAIAERGRFPAVDVLRSVSRSLPQAASADENALIARARA 373

Query: 379 LIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSD 423
            +  + E+  +   G Y PG D  LD+AV   P +  F  +   D
Sbjct: 374 TLGTYAESELMIRAGLYAPGSDPALDEAVRLYPALDAFFTRRGGD 418


>gi|24251287|gb|AAN46406.1| HrpB6 [Xanthomonas oryzae pv. oryzae]
          Length = 442

 Score =  289 bits (739), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 160/367 (43%), Positives = 223/367 (60%), Gaps = 5/367 (1%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISP-SACWCGRVINALGKPIDGDDSL 119
           +V+  + D+  + P G    +S    V   GR    P  A   GRV++ LG+P DG  ++
Sbjct: 63  EVVGFSRDLALLAPFGELIGLSRETRVIGLGRPLAVPVGAALLGRVLDGLGEPSDGQGAI 122

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
              D  + I ++ P  M R+ +E    TG+R++D    L  GQR+G+FA +G+GKSTL+ 
Sbjct: 123 AC-DTWVPIQAQAPDPMRRRLIEHPMPTGVRIVDGLMTLGEGQRMGIFAAAGVGKSTLMG 181

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTA 238
           MFAR    D  +I L+GERGREVREFIE  LG D L +SVVV ATSD S I R  A    
Sbjct: 182 MFARGTQCDVNVIVLIGERGREVREFIELILGADGLARSVVVCATSDRSSIERAKAAYVG 241

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
             IAEYF  +G  VLL++DS+TRFA + REI   +GE P  RG+P SVF+ELPRLLER G
Sbjct: 242 TAIAEYFRDRGLRVLLMMDSLTRFARAQREIGLAAGEPPTRRGFPPSVFAELPRLLERAG 301

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
             E   G+ITA  +VL + D  +DPIA+ VR ILDGH++L+R +A + +YP +D LAS+S
Sbjct: 302 MGES--GSITAFYTVLAEDDTGSDPIAEEVRGILDGHLILSREIAAKNQYPAIDVLASLS 359

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+  +   +D  +    L  L+ ++ E   +  +G YR G D + D+A++++  I DFL 
Sbjct: 360 RVMSQIVPSDHSQAAGRLRRLLAKYNEVETLVQVGEYRQGSDAVADEAINRIDAIRDFLS 419

Query: 419 QSPSDLS 425
           Q    LS
Sbjct: 420 QPTDQLS 426


>gi|260431754|ref|ZP_05785725.1| flagellum-specific ATP synthase [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260415582|gb|EEX08841.1| flagellum-specific ATP synthase [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 445

 Score =  289 bits (739), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 154/391 (39%), Positives = 240/391 (61%), Gaps = 3/391 (0%)

Query: 20  VVQGGYISSITSVYYTVTCLSQYVCLGD-FVVHQGKNSDNLGQVIRINLDIVYICPVGIG 78
           V Q G +S +      +  L+    +GD   + + +  D  G+V+ +  D+V++ P    
Sbjct: 19  VRQMGVVSGVARGMIEIDGLATVARIGDHLTLRRPQGPDLAGEVLNVESDVVHMLPSAAP 78

Query: 79  EEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNR 138
           + + LGD V+       +P   W GRV++  G P+DG   L  G    ++++  P A++R
Sbjct: 79  DGVRLGDRVYLEPTPAFAPGMHWLGRVVDPFGTPLDGKPLL-PGMHERDVLAAPPRAVDR 137

Query: 139 QRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGER 198
           + + +   TG+ +++   P+  GQR+G+FAGSG+GKSTLL+  A+S   D V+++L+GER
Sbjct: 138 KPLGERMATGLAIMNTVLPIVRGQRVGLFAGSGVGKSTLLATLAKSMEADAVVVALIGER 197

Query: 199 GREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILD 257
           GREV EF+E+ LG + LK+S+VV ATSD+S + R+    +A+T AEY   +G +VL + D
Sbjct: 198 GREVNEFVENALGREGLKRSIVVAATSDQSALARRRCAWSAMTAAEYLRDQGLSVLFLAD 257

Query: 258 SITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDG 317
           S+TRFA + REIA   GE P  RG+P SV   +  L ER GP  + +G+ITAV SVLV G
Sbjct: 258 SVTRFAEAHREIAVAMGESPSLRGFPPSVTPMIAGLCERAGPGTENQGDITAVFSVLVAG 317

Query: 318 DNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLT 377
            + ++PIAD +R +LDGHIVL+R +AE GR+P +D   SVSR    A + +E +L++   
Sbjct: 318 SDMDEPIADILRGVLDGHIVLSREIAERGRFPAIDVSRSVSRSLPDAATPEENQLIAETR 377

Query: 378 HLIHRFEETRDIRLIGGYRPGVDLILDKAVH 408
            L+  +E++  +   G Y PG D +LD+A+ 
Sbjct: 378 RLVGSYEQSEVMIKAGLYTPGTDPLLDQAMR 408


>gi|323705443|ref|ZP_08117018.1| ATPase, FliI/YscN family [Thermoanaerobacterium xylanolyticum
           LX-11]
 gi|323535345|gb|EGB25121.1| ATPase, FliI/YscN family [Thermoanaerobacterium xylanolyticum
           LX-11]
          Length = 438

 Score =  289 bits (739), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 171/410 (41%), Positives = 253/410 (61%), Gaps = 8/410 (1%)

Query: 17  KNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNL-GQVIRINLDIVYICPV 75
           KN +   G +S +  V  T+  +     +GD    +  N   +  +V+    D VY+ P+
Sbjct: 17  KNFIKYYGKVSQV--VGLTIESVGPISNIGDVCEIRSINGTTVYAEVMGFKDDKVYLMPL 74

Query: 76  GIGEEISLGDLVFHWG-RFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPP 134
           G  + I  G+ V   G + +I       GRVI+ALG PIDG  ++    L +   +  P 
Sbjct: 75  GDMDGIGPGNSVVSTGQKLKIGVGKELLGRVIDALGNPIDGKGAIKCKKL-VSTNNTPPN 133

Query: 135 AMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISL 194
            + R+R+ +    GI+ ID       GQRIG+FAGSG+GKSTLL M AR+   D  +I+L
Sbjct: 134 PIERKRISEVMTLGIKAIDGLLTCGKGQRIGIFAGSGVGKSTLLGMIARNAKSDINVIAL 193

Query: 195 VGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVL 253
           +GERGREV EFIE  LG D LK+S++VV+TSD   ++R    + A +IAEYF  +G +VL
Sbjct: 194 IGERGREVNEFIEKDLGEDGLKRSILVVSTSDTPALMRVKGAMAATSIAEYFRDQGLDVL 253

Query: 254 LILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISV 313
           L++DS+TRFA + REI  + GE PV+RGY  SVFS LP+LLER G S+   G+ITA+ +V
Sbjct: 254 LMMDSVTRFAMAQREIGLSIGEAPVSRGYTPSVFSVLPKLLERAGSSKH--GSITALYTV 311

Query: 314 LVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLV 373
           LVDGD+ N+PI D+VR ILDGHIVL+R LA +G+YP +D L+S+SR+ +   + + K L 
Sbjct: 312 LVDGDDLNEPITDAVRGILDGHIVLSRKLANKGQYPAIDVLSSISRVMNDIVTDEHKNLS 371

Query: 374 SSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSD 423
               +++  +EE+ D+  IG Y  G +  +D+A+     + +++KQS ++
Sbjct: 372 LRFKNILSVYEESEDLINIGAYAKGSNPKIDEAILLHDDMINYIKQSTNE 421


>gi|315654581|ref|ZP_07907487.1| flagellar protein export ATPase FliI [Mobiluncus curtisii ATCC
           51333]
 gi|315657514|ref|ZP_07910396.1| flagellar protein export ATPase FliI [Mobiluncus curtisii subsp.
           holmesii ATCC 35242]
 gi|315491045|gb|EFU80664.1| flagellar protein export ATPase FliI [Mobiluncus curtisii ATCC
           51333]
 gi|315491986|gb|EFU81595.1| flagellar protein export ATPase FliI [Mobiluncus curtisii subsp.
           holmesii ATCC 35242]
          Length = 444

 Score =  289 bits (739), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 167/398 (41%), Positives = 235/398 (59%), Gaps = 8/398 (2%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISL 83
           G + S+  +   V  L    C    VV  G +     +V+ ++  I    P+   + + +
Sbjct: 25  GEVESVVGLSVRVRGLQ---CSVGEVVLVGDDPGVPAEVVALDAGIASCMPLDNLDGLRV 81

Query: 84  GDLVFHWGRFRISP-SACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVE 142
           G  V   G     P      GRVI+A G+P+DG   +   D  + I    P A+ R R++
Sbjct: 82  GSPVRGTGLPATVPVGPALLGRVIDAAGRPLDGKGPIYAAD-RVPIHGAAPNALERARID 140

Query: 143 KGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREV 202
                G+RV+D    L  GQRIG+FAGSG+GKSTL+SM AR    +  +I+LVGERGREV
Sbjct: 141 MPVAMGVRVLDTLVTLGRGQRIGLFAGSGVGKSTLMSMIARGTNAEVCVIALVGERGREV 200

Query: 203 REFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITR 261
           REF+ED LG+  L +SVVVVATSDESP+LRK A  TA  +AEY+   G +VLL++DS+TR
Sbjct: 201 REFLEDDLGEEGLSRSVVVVATSDESPMLRKRAAFTATRVAEYYRDAGRHVLLMMDSLTR 260

Query: 262 FAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHN 321
              + REI  + GE P  RGYP S FS + +LLER G      G++T + +VLVDGD+HN
Sbjct: 261 TCMAQREIGLSVGEPPATRGYPPSTFSMMAQLLERAG--SGAIGSVTGIYTVLVDGDDHN 318

Query: 322 DPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIH 381
           +PIAD  RSILDGH+VL+R LA  G YP +D L S+SR+A K  + ++++  ++L  ++ 
Sbjct: 319 EPIADQARSILDGHVVLDRKLAVAGHYPAIDALGSISRVASKVTTREQREAATALRQIMG 378

Query: 382 RFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
                +D+  +G Y+ G +  +D AV     I  FL Q
Sbjct: 379 AKRSVQDLLDVGAYQAGTNPEVDTAVKYDAEIEAFLTQ 416


>gi|58579714|ref|YP_198730.1| type III secretion system ATPase [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84621742|ref|YP_449114.1| type III secretion system ATPase [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|188574355|ref|YP_001911284.1| type III secretion system ATPase [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|7350913|gb|AAF61281.1| HrpB6 [Xanthomonas oryzae pv. oryzae]
 gi|9711583|dbj|BAB07852.1| HrpB6 [Xanthomonas oryzae pv. oryzae]
 gi|50428346|dbj|BAD29983.1| HrcN [Xanthomonas oryzae pv. oryzae]
 gi|58424308|gb|AAW73345.1| HrcN protein [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84365682|dbj|BAE66840.1| HrcN protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188518807|gb|ACD56752.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 442

 Score =  289 bits (739), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 160/367 (43%), Positives = 223/367 (60%), Gaps = 5/367 (1%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISP-SACWCGRVINALGKPIDGDDSL 119
           +V+  + D+  + P G    +S    V   GR    P  A   GRV++ LG+P DG  ++
Sbjct: 63  EVVGFSRDLALLAPFGELIGLSRETRVIGLGRPLAVPVGAALLGRVLDGLGEPSDGQGAI 122

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
              D  + I ++ P  M R+ +E    TG+R++D    L  GQR+G+FA +G+GKSTL+ 
Sbjct: 123 AC-DTWVPIQAQAPDPMRRRLIEHPMPTGVRIVDGLMTLGEGQRMGIFAAAGVGKSTLMG 181

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTA 238
           MFAR    D  +I L+GERGREVREFIE  LG D L +SVVV ATSD S I R  A    
Sbjct: 182 MFARGTQCDVNVIVLIGERGREVREFIELILGADGLARSVVVCATSDRSSIERAKAAYVG 241

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
             IAEYF  +G  VLL++DS+TRFA + REI   +GE P  RG+P SVF+ELPRLLER G
Sbjct: 242 TAIAEYFRDRGLRVLLMMDSLTRFARAQREIGLAAGEPPTRRGFPPSVFAELPRLLERAG 301

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
             E   G+ITA  +VL + D  +DPIA+ VR ILDGH++L+R +A + +YP +D LAS+S
Sbjct: 302 MGES--GSITAFYTVLAEDDTGSDPIAEEVRGILDGHLILSREIAAKNQYPAIDVLASLS 359

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+  +   +D  +    L  L+ ++ E   +  +G YR G D + D+A++++  I DFL 
Sbjct: 360 RVMSQIVPSDHSQAAGRLRRLLAKYNEVETLVQVGEYRQGSDAVADEAINRIDAIRDFLS 419

Query: 419 QSPSDLS 425
           Q    LS
Sbjct: 420 QPTDQLS 426


>gi|327441052|dbj|BAK17417.1| flagellar biosynthesis/type III secretory pathway ATPase
           [Solibacillus silvestris StLB046]
          Length = 441

 Score =  289 bits (739), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 166/374 (44%), Positives = 234/374 (62%), Gaps = 9/374 (2%)

Query: 59  LGQVIRINLDIVYICPVGIGEEISLGDLVFHWG---RFRISPSACWCGRVINALGKPIDG 115
           L +V+    +IV + P    +EIS+G LV   G     ++ P     G+V++A+G P DG
Sbjct: 58  LAEVVGFKDEIVILMPYSSLKEISIGCLVEGTGSPLEVKVGPE--LIGKVLDAMGNPFDG 115

Query: 116 DDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKS 175
              L KG +++    + P  ++R  + +  + G++ ID    +  GQR+G+FAGSG+GKS
Sbjct: 116 Q-PLPKGLMTVPTEKEPPNPLSRPPINEQLEVGVKAIDGMLTVGSGQRVGIFAGSGVGKS 174

Query: 176 TLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMA 234
           TLL M AR+   D  +I+LVGERGREVREFIE  LG + L++SVVV ATSD+  ++R  A
Sbjct: 175 TLLGMIARNTEADINVIALVGERGREVREFIERDLGPEGLQRSVVVAATSDQPALMRIKA 234

Query: 235 PLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLL 294
             TA  IAEYF  +G NV+L++DS+TR A + REI    GE P  RGY  SVF+ LP LL
Sbjct: 235 AFTATAIAEYFRDRGKNVMLMMDSVTRVAMAQREIGLAIGEPPATRGYTPSVFAILPTLL 294

Query: 295 ERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPL 354
           ER G +    G ITA  +VLVDGD+ N+PIAD+VR ILDGHIVL+R+LA +G+YP ++ L
Sbjct: 295 ERSGTNIN--GTITAFYTVLVDGDDMNEPIADAVRGILDGHIVLDRNLANKGQYPAINIL 352

Query: 355 ASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIY 414
            SVSRL +     +  +  S L  L + + ++ D+  IG Y+ G    +D+A+   P+I 
Sbjct: 353 KSVSRLMNHIAQPEHVRAASRLRELYYSYSKSEDLINIGAYKRGTSKEIDEAIMYEPLIT 412

Query: 415 DFLKQSPSDLSSED 428
           +FLKQ   D  S D
Sbjct: 413 EFLKQGYKDKISID 426


>gi|313901517|ref|ZP_07834964.1| type III secretion system ATPase, FliI/YscN [Thermaerobacter
           subterraneus DSM 13965]
 gi|313468212|gb|EFR63679.1| type III secretion system ATPase, FliI/YscN [Thermaerobacter
           subterraneus DSM 13965]
          Length = 476

 Score =  288 bits (738), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 155/372 (41%), Positives = 228/372 (61%), Gaps = 15/372 (4%)

Query: 72  ICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIM- 129
           + P+G    I  G  V   G+ FR++      GRV++ LG+P+DG     +G ++ E   
Sbjct: 102 LMPLGDARAIRPGSRVEATGQGFRVAVGEGLLGRVLDGLGRPLDG-----QGPVAAEAWY 156

Query: 130 ---SKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDC 186
              +  PP + R+ + +    G+R ID       GQR+G+FAGSG+GKSTLL+M  R   
Sbjct: 157 PAEADPPPPLARRPIREPLPVGVRAIDALLTCGRGQRVGIFAGSGVGKSTLLAMMTRHTA 216

Query: 187 FDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFS 246
            D V+++L+GER REVR+F++ +L  + +++VVV AT+D   ++R  A   A  IAE+F 
Sbjct: 217 ADVVVVALIGERNREVRDFVDHHLAGSRRRTVVVAATADRPALVRIKAAQVATAIAEFFR 276

Query: 247 SKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGN 306
            +G +VLL++DS+TR+A ++RE+    GE P  RGYP SVF+ LPRLLER G    ++G+
Sbjct: 277 DRGRHVLLVMDSVTRYAMALREVGLAVGEPPATRGYPPSVFAALPRLLERAG--TGDRGS 334

Query: 307 ITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWS 366
           IT   +VLVDGD+ N+P+AD+VR  LDGHIVL+R LAEEG++P VD LASVSRL  +   
Sbjct: 335 ITGFYTVLVDGDDFNEPVADAVRGTLDGHIVLSRQLAEEGQFPAVDVLASVSRLMPELVD 394

Query: 367 ADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
           A        L   +  + E RD+  IG Y+ G +  +D+A+ ++P I  FL Q   + +S
Sbjct: 395 AAHWAAAQRLRRWLGAYREARDLVEIGAYQRGTNPDVDRALERMPAIRAFLSQGRDEAAS 454

Query: 427 EDVFQEITKKLQ 438
              F E   +LQ
Sbjct: 455 ---FSEAVARLQ 463


>gi|298345993|ref|YP_003718680.1| H(+)-transporting two-sector ATPase [Mobiluncus curtisii ATCC
           43063]
 gi|304390249|ref|ZP_07372203.1| flagellar protein export ATPase FliI [Mobiluncus curtisii subsp.
           curtisii ATCC 35241]
 gi|298236054|gb|ADI67186.1| H(+)-transporting two-sector ATPase [Mobiluncus curtisii ATCC
           43063]
 gi|304326731|gb|EFL93975.1| flagellar protein export ATPase FliI [Mobiluncus curtisii subsp.
           curtisii ATCC 35241]
          Length = 444

 Score =  288 bits (738), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 167/398 (41%), Positives = 235/398 (59%), Gaps = 8/398 (2%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISL 83
           G + S+  +   V  L    C    VV  G +     +V+ ++  I    P+   + + +
Sbjct: 25  GEVESVVGLSVRVRGLQ---CSVGEVVLVGDDPGVPAEVVALDAGIASCMPLDNLDGLRV 81

Query: 84  GDLVFHWGRFRISP-SACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVE 142
           G  V   G     P      GRVI+A G+P+DG   +   D  + I    P A+ R R++
Sbjct: 82  GSPVRGTGLPATVPVGPALLGRVIDAAGRPLDGKGPIYAAD-RVPIHGAAPNALERARID 140

Query: 143 KGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREV 202
                G+RV+D    L  GQRIG+FAGSG+GKSTL+SM AR    +  +I+LVGERGREV
Sbjct: 141 MPVAMGVRVLDTLVTLGRGQRIGLFAGSGVGKSTLMSMIARGTNAEVCVIALVGERGREV 200

Query: 203 REFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITR 261
           REF+ED LG+  L +SVVVVATSDESP+LRK A  TA  +AEY+   G +VLL++DS+TR
Sbjct: 201 REFLEDDLGEEGLSRSVVVVATSDESPMLRKRAAFTATRVAEYYRDAGRHVLLMMDSLTR 260

Query: 262 FAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHN 321
              + REI  + GE P  RGYP S FS + +LLER G      G++T + +VLVDGD+HN
Sbjct: 261 TCMAQREIGLSVGEPPATRGYPPSTFSMMAQLLERAG--SGAIGSVTGIYTVLVDGDDHN 318

Query: 322 DPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIH 381
           +PIAD  RSILDGH+VL+R LA  G YP +D L S+SR+A K  + ++++  ++L  ++ 
Sbjct: 319 EPIADQARSILDGHVVLDRKLAVAGHYPAIDALGSISRVASKVTTREQREAATALRQIMG 378

Query: 382 RFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
                +D+  +G Y+ G +  +D AV     I  FL Q
Sbjct: 379 AKRSVQDLLDVGAYQAGTNPEVDTAVKYDAEIEAFLTQ 416


>gi|42526727|ref|NP_971825.1| flagellum-specific ATP synthase FliI [Treponema denticola ATCC
           35405]
 gi|41817042|gb|AAS11736.1| flagellum-specific ATP synthase FliI [Treponema denticola ATCC
           35405]
          Length = 474

 Score =  288 bits (737), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 168/384 (43%), Positives = 233/384 (60%), Gaps = 7/384 (1%)

Query: 55  NSDNL-GQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISP-SACWCGRVINALGKP 112
           N D L  +V+ +N  IV +      + + +GDLV   G     P      GRV++AL K 
Sbjct: 52  NPDGLKAEVVGLNGTIVQLMSYTDVQGVKIGDLVIASGEILSVPVGNILLGRVVDALCKS 111

Query: 113 IDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGI 172
            DG            +++  P AM R+ + +   TGIR ID    +  GQR+G+FAG+GI
Sbjct: 112 ADGKPEPYSAK-RYPVVASPPDAMTRKPIRQRIVTGIRAIDSLLAVGRGQRLGIFAGTGI 170

Query: 173 GKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILR 231
           GKSTLL M AR+   D  +I+L+GERGREV +FIE  LG + LK SV+V ATSD+S + R
Sbjct: 171 GKSTLLGMIARNTNADVNVIALIGERGREVLDFIEHDLGPEGLKHSVIVSATSDQSALAR 230

Query: 232 KMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELP 291
                TA  IAEYF  +G +V+L+ DS+TRFA + REI    GE P  RGY  SVFS LP
Sbjct: 231 IRGAYTATAIAEYFRDQGKDVMLLFDSVTRFAMAQREIGLAIGEPPATRGYTPSVFSSLP 290

Query: 292 RLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPV 351
           +LLER G SEK  G+IT   +VLV+GD+ N+PI+D+VR ILDGHIVL+R+LAE G+YP V
Sbjct: 291 KLLERSGTSEK--GSITGFYTVLVEGDDMNEPISDAVRGILDGHIVLDRNLAERGQYPAV 348

Query: 352 DPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVP 411
           + L S+SRL+++    + K     +  L+  + E+ D+  +G Y+ G    +D A+   P
Sbjct: 349 NVLKSISRLSNRVSGPNTKDASKRMRTLLKDYTESEDMINLGAYQKGSSAAIDDAIDHYP 408

Query: 412 IIYDFLKQSPSDLSS-EDVFQEIT 434
            IYDFL Q   D +  +D  Q+++
Sbjct: 409 RIYDFLTQEVDDPAKLKDTLQKLS 432


>gi|89098641|ref|ZP_01171523.1| flagellum-specific ATP synthase [Bacillus sp. NRRL B-14911]
 gi|89086603|gb|EAR65722.1| flagellum-specific ATP synthase [Bacillus sp. NRRL B-14911]
          Length = 438

 Score =  288 bits (737), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 168/399 (42%), Positives = 239/399 (59%), Gaps = 8/399 (2%)

Query: 43  VCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACW 101
           VC+    V  GK    + +V+    + V + P     EI+ G LV    +   I      
Sbjct: 42  VCI--IHVGSGKKRKIMAEVVGFKEENVILMPYTAISEIAPGSLVEATLKPLEIKIGTSL 99

Query: 102 CGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHG 161
            G VI+ALG P+DG  +L KG  S+      P  MNR  +    + G+R ID    + +G
Sbjct: 100 IGEVIDALGHPLDGK-ALPKGLASVPTEQDPPNPMNRPPISAPVEVGVRAIDSLLTVGYG 158

Query: 162 QRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVV 220
           QR+G+FAGSG+GKSTLL M AR+   D  +I+L+GERGREVREFIE+ LG+  LK+S+V+
Sbjct: 159 QRVGIFAGSGVGKSTLLGMVARNTKADLNVIALIGERGREVREFIENDLGEEGLKRSIVI 218

Query: 221 VATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVAR 280
            ATSD+  ++R     TA  IAEYF  KG NV+L++DS+TR A + RE+    GE P  +
Sbjct: 219 AATSDQPALMRIKGAYTATAIAEYFRDKGLNVVLMMDSVTRVAMAQREVGLAIGEPPTTK 278

Query: 281 GYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNR 340
           GY  SVF+ LP+LLER G + K  G+ITA  +VLVDGD+ N+PIAD+VR ILDGH VL+R
Sbjct: 279 GYTPSVFAVLPKLLERTGTNHK--GSITAFYTVLVDGDDMNEPIADTVRGILDGHFVLDR 336

Query: 341 SLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVD 400
           +LA +G+YP ++ L SVSR+ +     + KK    L   +  +  + D+  IG Y+ G  
Sbjct: 337 ALANKGQYPAINVLKSVSRVMNNIVPHEHKKSAELLRERLSTYINSEDLINIGAYKKGTS 396

Query: 401 LILDKAVHQVPIIYDFLKQSPSD-LSSEDVFQEITKKLQ 438
             +D+AV   P I  FLKQ   + ++ +D  Q + + ++
Sbjct: 397 REIDQAVRLYPEIISFLKQGTEEKVTMQDSIQHLLRLME 435


>gi|325473789|gb|EGC76977.1| flagellum-specific ATP synthase FliI [Treponema denticola F0402]
          Length = 474

 Score =  288 bits (737), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 168/384 (43%), Positives = 233/384 (60%), Gaps = 7/384 (1%)

Query: 55  NSDNL-GQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISP-SACWCGRVINALGKP 112
           N D L  +V+ +N  IV +      + + +GDLV   G     P      GRV++AL K 
Sbjct: 52  NPDGLKAEVVGLNGTIVQLMSYTDVQGVKIGDLVIASGEILSVPVGNVLLGRVVDALCKS 111

Query: 113 IDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGI 172
            DG            +++  P AM R+ + +   TGIR ID    +  GQR+G+FAG+GI
Sbjct: 112 ADGKPEPYSAK-RYPVVAPPPDAMTRKPIRQRIVTGIRAIDSLLAVGRGQRLGIFAGTGI 170

Query: 173 GKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILR 231
           GKSTLL M AR+   D  +I+L+GERGREV +FIE  LG + LK SV+V ATSD+S + R
Sbjct: 171 GKSTLLGMIARNTNADVNVIALIGERGREVLDFIEHDLGPEGLKHSVIVSATSDQSALAR 230

Query: 232 KMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELP 291
                TA  IAEYF  +G +V+L+ DS+TRFA + REI    GE P  RGY  SVFS LP
Sbjct: 231 IRGAYTATAIAEYFRDQGKDVMLLFDSVTRFAMAQREIGLAIGEPPATRGYTPSVFSSLP 290

Query: 292 RLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPV 351
           +LLER G SEK  G+IT   +VLV+GD+ N+PI+D+VR ILDGHIVL+R+LAE G+YP V
Sbjct: 291 KLLERSGTSEK--GSITGFYTVLVEGDDMNEPISDAVRGILDGHIVLDRNLAERGQYPAV 348

Query: 352 DPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVP 411
           + L S+SRL+++    + K     +  L+  + E+ D+  +G Y+ G    +D A+   P
Sbjct: 349 NVLKSISRLSNRVSGPNTKDASKRMRTLLKDYTESEDMINLGAYQKGSSAAIDDAIDHYP 408

Query: 412 IIYDFLKQSPSDLSS-EDVFQEIT 434
            IYDFL Q   D +  +D  Q+++
Sbjct: 409 RIYDFLTQEVDDPAKLKDTLQKLS 432


>gi|30524894|gb|AAP34339.1|AF499777_7 HrcN [Xanthomonas axonopodis pv. glycines]
          Length = 442

 Score =  288 bits (737), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 159/368 (43%), Positives = 223/368 (60%), Gaps = 5/368 (1%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISP-SACWCGRVINALGKPIDGDDSL 119
           +V+  + D+  + P G    +S    V   GR    P      GRV++ LG+P DG  ++
Sbjct: 63  EVVGFSRDLALLAPFGELVGLSRETRVIGLGRPLAVPVGPALLGRVLDGLGEPSDGQGAI 122

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
              D  + I ++ P  M R+ +E+   TG+R++D    L  GQR+G+FA +G+GKSTL+ 
Sbjct: 123 AC-DTWVPIQAQAPDPMRRRLIEQPMPTGVRIVDGLMTLGEGQRMGIFAAAGVGKSTLMG 181

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTA 238
           MFAR    D  +I L+GERGREVREFIE  LG D L +SVVV ATSD S I R  A    
Sbjct: 182 MFARGTQCDVNVIVLIGERGREVREFIELILGADGLARSVVVCATSDRSSIERAKAAYVG 241

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
             IAEYF  +G  VLL++DS+TRFA + REI   +GE P  RG+P SVF+ELPRLLER G
Sbjct: 242 TAIAEYFRDRGLRVLLMMDSLTRFARAQREIGLAAGEPPTRRGFPPSVFAELPRLLERAG 301

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
             E   G+ITA  +VL + D  +DPIA+ VR ILDGH++L+R +A + +YP +D LAS+S
Sbjct: 302 MGES--GSITAFYTVLAEDDTGSDPIAEEVRGILDGHLILSREIAAKNQYPAIDVLASLS 359

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+  +   +D  +    L  L+ ++ E   +  +G YR G D + D+A+ ++  I DFL 
Sbjct: 360 RVMSQIVPSDHSQAAGRLRRLLAKYNEVETLVQVGEYRQGSDAVADEAIDRIDAIRDFLS 419

Query: 419 QSPSDLSS 426
           Q    LS+
Sbjct: 420 QPTDQLSA 427


>gi|323530315|ref|YP_004232467.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Burkholderia sp. CCGE1001]
 gi|323387317|gb|ADX59407.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Burkholderia sp. CCGE1001]
          Length = 470

 Score =  288 bits (737), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 165/418 (39%), Positives = 242/418 (57%), Gaps = 9/418 (2%)

Query: 13  EDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNL--GQVIRINLDIV 70
           E  S   + + G +  +      V  L   V LG+    +  N   L   +VI    D+ 
Sbjct: 44  EILSTATIARSGKVLEVIGTLVKVAGLD--VTLGELCELRAANGKLLQHAEVIGFTRDVA 101

Query: 71  YICPVGIGEEISLGDLVFHWGRFRISPSA-CWCGRVINALGKPIDGDDSLGKGDLSMEIM 129
            + P     +IS    V   GR    P      GRVI++LG+PIDG   LG  +    + 
Sbjct: 102 LLSPFSRLADISRSTRVVGLGRSLTVPVGDSLLGRVIDSLGEPIDGLGPLGATE-QRPVF 160

Query: 130 SKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDK 189
           +  P  M R+ ++    TG+RV+D    L  GQR+G+FA +G+GKSTLL MFAR    D 
Sbjct: 161 ANPPSPMTRRMIDTPLATGVRVVDGMMTLAEGQRMGIFAPAGVGKSTLLGMFARGAQCDV 220

Query: 190 VIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSK 248
            +I+L+GERGREVREF+E  LG + + +SVVV ATSD S I R  A   A  IAE+F  +
Sbjct: 221 TVIALIGERGREVREFVELILGAEGMARSVVVCATSDRSSIERAKAAYVATAIAEHFRDR 280

Query: 249 GDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNIT 308
           G  VLL++DS+TRFA + REI   +GE P  RG+P S+F+ELPRLLER G    E G+IT
Sbjct: 281 GQRVLLMMDSLTRFARAQREIGLAAGEPPARRGFPPSIFAELPRLLERAGMG--EHGSIT 338

Query: 309 AVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSAD 368
           A+ +VL + ++ NDPIA+ VR I+DGH++L+R +A + +YP +D LAS+SR+  +  + D
Sbjct: 339 AMYTVLAEDESGNDPIAEEVRGIVDGHMILSREIAAKNQYPAIDVLASLSRVMPQVMTPD 398

Query: 369 EKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
             +  + L  L+ +  E   +  IG Y+PG + + D+A+ ++  I  F  Q+  +L++
Sbjct: 399 YVRAAARLRELLAKHREVEMLLQIGEYQPGGNPLADEAIRKIDAIRAFFNQATHELAA 456


>gi|323490145|ref|ZP_08095365.1| flagellum-specific ATP synthase [Planococcus donghaensis MPA1U2]
 gi|323396193|gb|EGA89019.1| flagellum-specific ATP synthase [Planococcus donghaensis MPA1U2]
          Length = 438

 Score =  288 bits (736), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 160/364 (43%), Positives = 234/364 (64%), Gaps = 11/364 (3%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWG---RFRISPSACWCGRVINALGKPIDGDD 117
           +V+    + + + P+    ++  G LV   G   + ++ PS    G+V++  G P+D  +
Sbjct: 59  EVVGFKENRIMLMPLQDLSQVGPGCLVVATGGPLQIKVGPS--ILGKVLDGTGMPLD--E 114

Query: 118 SLGKGDLSMEIMSKVPP-AMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKST 176
           SL    L     +  PP  + R R++K  + G+R ID    +  GQRIGVFAGSG+GKST
Sbjct: 115 SLLPRGLKKYSTNNAPPNPLKRPRIDKPLEVGVRAIDGLLTVGQGQRIGVFAGSGVGKST 174

Query: 177 LLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAP 235
           L+ M AR+   D  +I+LVGERGREVR+FIE  LG + LKKSVVV ATSD++P+ R  A 
Sbjct: 175 LMGMIARNTEADINVIALVGERGREVRDFIERDLGPEGLKKSVVVAATSDQTPMQRIKAA 234

Query: 236 LTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLE 295
           LTA  IAEYF  +G NV+L++DS+TRFA + RE+    GE P ++GY  SVF+ LP+LLE
Sbjct: 235 LTATAIAEYFRDQGKNVMLMMDSVTRFAMAQREVGLAVGEPPTSKGYTPSVFALLPKLLE 294

Query: 296 RIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLA 355
           R G S K  G+ITA  +VLVDGD+ N+PIAD+VR ILDGHIVL+R +A++G++P ++ +A
Sbjct: 295 RSGTSSK--GSITAFYTVLVDGDDMNEPIADAVRGILDGHIVLDRKIAQKGQFPAINVMA 352

Query: 356 SVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYD 415
           SVSR+  +  S + +        L+  +E + D+  IG Y+ G +  +D A+   P+I +
Sbjct: 353 SVSRVMHEVVSEEHQLAARDFKRLLAAYETSEDLINIGAYKSGANKEIDDAIRAYPVIKE 412

Query: 416 FLKQ 419
           +L+Q
Sbjct: 413 YLQQ 416


>gi|313905130|ref|ZP_07838499.1| flagellar protein export ATPase FliI [Eubacterium cellulosolvens 6]
 gi|313470033|gb|EFR65366.1| flagellar protein export ATPase FliI [Eubacterium cellulosolvens 6]
          Length = 434

 Score =  288 bits (736), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 155/345 (44%), Positives = 226/345 (65%), Gaps = 4/345 (1%)

Query: 81  ISLGDLVFHWG-RFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQ 139
           I+ G  V + G R RI       GR+INA+G+PIDG ++         + S     ++R 
Sbjct: 76  ITSGSFVRNTGHRLRIPVGEFLKGRIINAIGEPIDGKEAFPCNCDFYTVNSGYSNPLSRP 135

Query: 140 RVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERG 199
            +      G++ ID    +  GQRIG+FAGSG+GKSTLL M A++   D  +I+LVGERG
Sbjct: 136 PIRNRLNMGVKAIDGLNTIGKGQRIGIFAGSGVGKSTLLGMIAKNVTSDLNVIALVGERG 195

Query: 200 REVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDS 258
           REV EF+E  LG + +K++V+VVATSD+  ++R  APL A TIAEYF  +G +VLL++DS
Sbjct: 196 REVLEFVERDLGPEGMKRTVLVVATSDQPSMMRLKAPLVATTIAEYFRDQGMDVLLMMDS 255

Query: 259 ITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGD 318
           +TRFA + REI   +GE P+ARGY  S++SE P+LLER G  + +KG+IT + +VLV+GD
Sbjct: 256 LTRFAMAQREIGLATGEPPIARGYTPSIYSEFPKLLERAG--QFKKGSITGIYTVLVEGD 313

Query: 319 NHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTH 378
           + N+PIAD+VR ILDGHIVL+R+LA +  YP +D  AS+SRL  +  S + +K+ S + +
Sbjct: 314 DTNEPIADTVRGILDGHIVLSRALAAQNHYPAIDIGASISRLMVELVSPEHRKMASRMRN 373

Query: 379 LIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSD 423
           ++  +++  D+  IG Y+ G +  LD+AV +   I  FL Q   +
Sbjct: 374 ILGIYQKNADLIAIGAYKKGKNPALDEAVEKYGAINRFLMQGTQE 418


>gi|325917021|ref|ZP_08179260.1| Type III secretion system ATPase HrcN protein [Xanthomonas
           vesicatoria ATCC 35937]
 gi|325536772|gb|EGD08529.1| Type III secretion system ATPase HrcN protein [Xanthomonas
           vesicatoria ATCC 35937]
          Length = 442

 Score =  288 bits (736), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 159/370 (42%), Positives = 225/370 (60%), Gaps = 5/370 (1%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISP-SACWCGRVINALGKPIDGDDSL 119
           +V+  +  +  + P G    +S    V   GR    P  +   GRV++ LG+P DG   +
Sbjct: 63  EVVGFSRTLALLAPFGELVGLSRETRVIGSGRPLAVPVGSALLGRVLDGLGEPADGQGPV 122

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
              +  ++I ++ P  M R+ +E+   TG+R++D    L  GQR+G+FA +G+GKSTL+ 
Sbjct: 123 DCEEW-VQIQAQAPDPMRRRLIEQPMPTGVRIVDGLMTLGEGQRMGIFAAAGVGKSTLMG 181

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTA 238
           MFAR    D  +I L+GERGREVREFIE  LG D L +SVVV ATSD S I R  A    
Sbjct: 182 MFARGTQCDVNVIVLIGERGREVREFIEMILGEDGLARSVVVCATSDRSSIERAKAAYVG 241

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
             IAEYF  +G  VLL++DS+TRFA + REI   +GE P  RG+P SVF+ELPRLLER G
Sbjct: 242 TAIAEYFRDQGLRVLLMMDSLTRFARAQREIGLAAGEPPTRRGFPPSVFAELPRLLERAG 301

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
             E   G+ITA  +VL + D  +DPIA+ VR ILDGH++L+R +A + +YP +D L S+S
Sbjct: 302 MGET--GSITAFYTVLAEDDTGSDPIAEEVRGILDGHLILSREIAAKNQYPAIDVLGSLS 359

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+  +  SA++++    L  L+ +  E   +  +G YR G D + D+A+ ++  I DFL 
Sbjct: 360 RVMSQIVSAEQRQYAGQLRRLLAKHNEVETLLQVGEYRQGSDAVADEAIARIDAIRDFLS 419

Query: 419 QSPSDLSSED 428
           QS   LS  D
Sbjct: 420 QSTDQLSDYD 429


>gi|309388820|gb|ADO76700.1| type III secretion system ATPase, FliI/YscN [Halanaerobium
           praevalens DSM 2228]
          Length = 435

 Score =  288 bits (736), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 161/404 (39%), Positives = 247/404 (61%), Gaps = 8/404 (1%)

Query: 18  NLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGI 77
           N+    G+I+ +  +   +  +     +G+  + +G+N D   +V+  + + V + P+G 
Sbjct: 17  NMTRNFGHINRV--IGLVIESIGPQASIGELCLIKGENGDIKAEVVGFDDNKVLMMPIGE 74

Query: 78  GEEISLGDLVFHWG-RFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAM 136
            E I  G  V     + ++       G++I+  G  I G+D  G  ++   + +K P  +
Sbjct: 75  MEGIRPGARVIATDEKLKVKVGKELLGKIIDGSGNIISGEDPSGLNEVP--VNNKPPDPL 132

Query: 137 NRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVG 196
            R R++     G+R ID F     GQR+G+FAGSG+GKSTLL M AR+   D  +I LVG
Sbjct: 133 TRARIKAPLSLGVRCIDGFLTCGKGQRMGIFAGSGVGKSTLLGMAARNTNADINVIGLVG 192

Query: 197 ERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLI 255
           ERGREVR+FIE  LG + L++S+VVVATSD+  +LR  A   A  IAEYF  +G++VLL+
Sbjct: 193 ERGREVRDFIEKDLGAEGLERSIVVVATSDQPALLRVKAANIATAIAEYFRDQGEDVLLM 252

Query: 256 LDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLV 315
           +DS+TR A ++RE+    GE P  RGYP SVF+ELP+LLER G +  + G+ITA+ +VLV
Sbjct: 253 MDSVTRVAMALREVGLAIGEPPATRGYPPSVFAELPKLLERTGTN--DVGSITALYTVLV 310

Query: 316 DGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSS 375
           +GD+ N+P++D+VR ILDGHI L+R LAE   YP VD L+SVSR+ +   S +  +  + 
Sbjct: 311 EGDDFNEPVSDTVRGILDGHISLSRELAESSHYPAVDVLSSVSRIMEDIVSKEHSQAAAK 370

Query: 376 LTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
           L  +I  + ++ D+  IG Y  G +  +D+A+ ++  I +FL Q
Sbjct: 371 LQKIIATYNQSEDLINIGAYEKGSNPEVDRAIAKIDEINNFLTQ 414


>gi|157163914|ref|YP_001465995.1| flagellum-specific ATP synthase [Campylobacter concisus 13826]
 gi|112801755|gb|EAT99099.1| flagellar protein export ATPase FliI [Campylobacter concisus 13826]
          Length = 435

 Score =  287 bits (735), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 166/418 (39%), Positives = 242/418 (57%), Gaps = 7/418 (1%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFV--VHQGKNSDNLGQVIRINLDIVYICPVGIGEEI 81
           G I+ IT+    +T L     +GD V  V + K+ + LG V +I  D  YI P G  E  
Sbjct: 21  GVITKITATTIEITGLRP--SIGDIVRIVAKDKSKNGLGMVTQIKTDGAYISPFGFVEGF 78

Query: 82  SLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQR 140
            +GD V+   +   I       GRV++   KPIDG  ++   +  M IM     AM R  
Sbjct: 79  RIGDFVYESDQGMSIPVGPNLLGRVVDPFMKPIDGKGAIDTTEY-MPIMRAPIDAMKRGL 137

Query: 141 VEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGR 200
           + + F  GI+ ID       GQ++G+FAGSG+GKSTL+ M  ++      +++L+GERGR
Sbjct: 138 INEPFSVGIKTIDGLLTCGKGQKLGIFAGSGVGKSTLMGMIVKNTLAPIKVVALIGERGR 197

Query: 201 EVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSIT 260
           EV EFIE  LG +L+ +V++VATSD+S ++RK     A+++AEYF  +G++VL I+DS+T
Sbjct: 198 EVPEFIEKNLGGDLEGTVIIVATSDDSSLMRKYGAFCAMSVAEYFKQQGNDVLFIMDSVT 257

Query: 261 RFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNH 320
           RFA + REI    GE P ++GYP S  + LP+L+ER G  E+ KG+ITA  +VLV+GD+ 
Sbjct: 258 RFAMAQREIGLALGEPPTSKGYPPSSLTLLPQLMERAG-KEEGKGSITAFFTVLVEGDDM 316

Query: 321 NDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLI 380
           +DPIAD  RSILDGHIVL+R L + G YPP++   S SR+       + K        L 
Sbjct: 317 SDPIADQSRSILDGHIVLSRELTDFGIYPPINIQNSASRVMGDVIGKEHKLNAMKFKRLY 376

Query: 381 HRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
              +E   +  IG Y+ G D  LD A+ +   +  FLKQS  +  + +  +E+  K+ 
Sbjct: 377 SLLKENEVLLRIGAYQKGSDKELDLAISKKEFMESFLKQSSEESFALEEVEELLDKIN 434


>gi|89895732|ref|YP_519219.1| hypothetical protein DSY2986 [Desulfitobacterium hafniense Y51]
 gi|89335180|dbj|BAE84775.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 433

 Score =  287 bits (735), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 163/405 (40%), Positives = 242/405 (59%), Gaps = 9/405 (2%)

Query: 18  NLVVQGGYISSITSVYYTVTCLSQYVCLGDFV-VHQGKNSDNLGQVIRINLDIVYICPVG 76
           +L+V  G ++ I  V   +      V +G++  +H  +  +   +V+        + P+ 
Sbjct: 15  DLIVSHGRVAKI--VGLMIESDGPRVSVGEYCRIHTQQGKEIPAEVVGFRNSTTLLMPLA 72

Query: 77  IGEEISLGD-LVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPA 135
             E I+ GD +V    +  +       GR+++ LG+P+DG   +   D  ++  +  P A
Sbjct: 73  ELEGIAPGDRVVPQQHKLEVGVGQALLGRILDGLGRPLDGRPMVTHRDYPLQ--NAPPSA 130

Query: 136 MNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLV 195
             R R+      G+R +D    +  GQRIG+FAGSG+GKSTLL M AR+      +I+LV
Sbjct: 131 FLRPRIRDPLSVGVRTVDGILTIGRGQRIGIFAGSGVGKSTLLGMMARNTTAGVNVIALV 190

Query: 196 GERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLL 254
           GERGRE+R+FIE  LG+  L++SV+VVATSD+  ++R  A  TA  IAEYF  +G +VLL
Sbjct: 191 GERGRELRDFIEKDLGEEGLERSVLVVATSDQPALVRLKAAFTATAIAEYFRDQGQDVLL 250

Query: 255 ILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVL 314
           ++DS+TRFA + RE+   +GE P  RGYP SVF+ LP+LLER G SE   G+IT + +VL
Sbjct: 251 MMDSVTRFAMAQREVGLTTGEPPATRGYPPSVFAMLPKLLERSGMSEI--GSITGIYTVL 308

Query: 315 VDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVS 374
           VDGD+HN+PIAD+VR ILDGHIVL R LA +  YP +D L SVSR+ +   + + K+L  
Sbjct: 309 VDGDDHNEPIADTVRGILDGHIVLTRELAMQNHYPAIDTLQSVSRVMNDIIAPEHKELAG 368

Query: 375 SLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
            L   +  + + +D+  IG Y  G +  +D A+  +  I  FL+Q
Sbjct: 369 KLREHLAVYHDAKDLIDIGAYVTGSNPRIDAAIRHIEGINGFLRQ 413


>gi|317121818|ref|YP_004101821.1| type III secretion system ATPase, FliI/YscN [Thermaerobacter
           marianensis DSM 12885]
 gi|315591798|gb|ADU51094.1| type III secretion system ATPase, FliI/YscN [Thermaerobacter
           marianensis DSM 12885]
          Length = 462

 Score =  287 bits (735), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 164/421 (38%), Positives = 240/421 (57%), Gaps = 18/421 (4%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFV-VHQGKNSDNLGQVIRINLDIVYICPVGIGEEIS 82
           G++  +  V   V        LG+   +H+        +V+        + P+G    I 
Sbjct: 46  GWVEQV--VGLAVEARGPVSSLGELCWIHRAGLPPVPAEVVGFRGPHTLLMPLGDARAIR 103

Query: 83  LGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIM----SKVPPAMN 137
            G LV   GR F +       GRV++ LG+P+DG     +G +++E       + PP + 
Sbjct: 104 PGSLVEATGRGFTVGVGEGLLGRVLDGLGRPLDG-----QGPVAVEAWYPAEGEPPPPLA 158

Query: 138 RQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGE 197
           RQ + +    G+R ID       GQR+G+FAGSG+GKSTLL+M  R    D V+++L+GE
Sbjct: 159 RQPIREPLPVGVRSIDALLTCGRGQRVGIFAGSGVGKSTLLAMMTRHTAADVVVVALIGE 218

Query: 198 RGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILD 257
           R REVR+F++ +L  + +++VVV AT+D   ++R  A   A  IAE+F  +G +VLL++D
Sbjct: 219 RNREVRDFVDHHLAGSRRRTVVVAATADRPALVRIKAAQVATAIAEFFRDRGRHVLLVMD 278

Query: 258 SITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDG 317
           S+TR+A ++RE+    GE P  RGYP SVF+ LPRLLER G     +G+IT   +VLVDG
Sbjct: 279 SVTRYAMALREVGLAVGEPPATRGYPPSVFAALPRLLERAG--TGPRGSITGFYTVLVDG 336

Query: 318 DNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLT 377
           D+ N+PIAD+VR  LDGHIVL+R LAEEG++P VD LASVSRL  +            L 
Sbjct: 337 DDLNEPIADAVRGTLDGHIVLSRQLAEEGQFPAVDVLASVSRLMPELVEPAHWAAAQRLR 396

Query: 378 HLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKL 437
             +  + E RD+  IG Y+ G +  +D+A+ ++P I  FL Q   + S    F E   +L
Sbjct: 397 RWLGAYREARDLLEIGAYQRGSNPDVDRALERMPAIRAFLTQGRDEASP---FAEAVARL 453

Query: 438 Q 438
           Q
Sbjct: 454 Q 454


>gi|326796467|ref|YP_004314287.1| flagellar protein export ATPase FliI [Marinomonas mediterranea
           MMB-1]
 gi|326547231|gb|ADZ92451.1| flagellar protein export ATPase FliI [Marinomonas mediterranea
           MMB-1]
          Length = 449

 Score =  287 bits (735), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 169/415 (40%), Positives = 243/415 (58%), Gaps = 9/415 (2%)

Query: 32  VYYTVTCLSQYVCLGDFV-VHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHW 90
           V  T+  +   V LGD   V  G +     +V+  N  + Y+ P    E I+ G  V   
Sbjct: 31  VGLTMEAVGCKVALGDRCNVQVGASKWVESEVVGFNGKLTYLMPTEAIEGIAPGARVVPL 90

Query: 91  GR-FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGI 149
               R+       GRVIN LG+P+DG   +   D S+ +  ++   + R+ +      GI
Sbjct: 91  DDDSRMPVGDHLLGRVINGLGRPLDGRGPI-TSDESISLQGEIINPLQRKPISDTLDVGI 149

Query: 150 RVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDY 209
           + I+    +  GQR+G+FAGSG+GKS LL M  R    D  I+ L+GERGREV+EFIE  
Sbjct: 150 KTINSLLTVGKGQRLGLFAGSGVGKSMLLGMMTRFTEADITIVGLIGERGREVKEFIEQI 209

Query: 210 LGDN-LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIRE 268
           LG+  L KSVV+ + +D+S ++R  A +    IAEYF  +G NVLL++DS+TR+A + RE
Sbjct: 210 LGEEGLAKSVVIASPADDSALMRLRAAMLTTRIAEYFRDQGRNVLLLMDSLTRYAQAQRE 269

Query: 269 IATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSV 328
           IA + GE P  +GYP SVFS+LP+L+ER G  ++  G+ITA  +VL +GD+  DPIAD+ 
Sbjct: 270 IALSVGEPPATKGYPPSVFSKLPQLVERAGNGKEGGGSITAFYTVLTEGDDQQDPIADAS 329

Query: 329 RSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRD 388
           R+ILDGHIVL+R LAEEG YP +D  AS+SR      S++  +    +  L  +F++ RD
Sbjct: 330 RAILDGHIVLSRRLAEEGHYPAIDIEASISRAMPHIVSSEHLQGAMRVKQLYSKFQQNRD 389

Query: 389 IRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPS-----DLSSEDVFQEITKKLQ 438
           +  +G Y  G D  LD+A+  +P I DFL+QS S     + S E + Q +T   Q
Sbjct: 390 LISVGAYSKGSDPDLDQAIMLMPDINDFLRQSLSESFNLEQSLEKLVQALTSNQQ 444


>gi|159045786|ref|YP_001534580.1| flagellum-specific ATP synthase [Dinoroseobacter shibae DFL 12]
 gi|157913546|gb|ABV94979.1| flagellum-specific ATP synthase [Dinoroseobacter shibae DFL 12]
          Length = 450

 Score =  287 bits (735), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 165/440 (37%), Positives = 255/440 (57%), Gaps = 6/440 (1%)

Query: 1   MQKNLETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLG 60
           M  +  +LA   E  S + +   G++S+++     VT L+++  LGD VV  G     +G
Sbjct: 1   MTPDFSSLAAQIEGASFHRI--SGHVSALSEAVVEVTGLNRHARLGDRVVLTGATGAEVG 58

Query: 61  -QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSL 119
            +V+ ++   + + P    E  +L D  +  GR  + PS  W G+VI+  G+  DG    
Sbjct: 59  GEVVTLSGSHIEVLPEARLEGFALRDRAYFQGRSEVRPSEDWIGKVIDPFGRCHDGTIP- 117

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
             G  +  +    P A+ R+ +    +TG  V + F PL  GQR+G+FAGSG+GKSTLL 
Sbjct: 118 APGPTAYPLRGTPPSAITRKPLGHRLETGTAVFNTFLPLVRGQRLGLFAGSGVGKSTLLG 177

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTA 238
              RS   D  +++L+GERGREVREF++  LG D +K+++VV ATSD++P+L++ A   A
Sbjct: 178 KLTRSVQADIAVVALIGERGREVREFVDRTLGADGMKRAIVVAATSDQAPLLKRRAAWLA 237

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
           ++IAEYF   G +VL + DS+TRFA + RE+A  +GE P  RG+P S    +  L ER G
Sbjct: 238 MSIAEYFRDLGGHVLFLTDSVTRFAEAHREVALTAGEAPSMRGFPPSTGQMIMDLAERAG 297

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
           P  + KG+IT + SVLV G + ++P+AD +R +LDGH+VL+R +AE GR+P VD L SVS
Sbjct: 298 PGPEGKGDITGIFSVLVAGSDMDEPVADILRGVLDGHVVLSREIAERGRFPAVDVLQSVS 357

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R    A SA E +L+      +  +E +R +   G Y  G D  +D A+     +  FL 
Sbjct: 358 RSLPDAASAAENELLQLARRTMGIYERSRLMIQSGLYTQGSDAEIDAAITAHRELEGFLA 417

Query: 419 QSPSDLSSEDVFQEITKKLQ 438
           +  +  ++ D F+ + + L+
Sbjct: 418 RVETG-TAADSFEHLAQALR 436


>gi|21241185|ref|NP_640767.1| type III secretion system ATPase [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|21106492|gb|AAM35303.1| HrcN protein [Xanthomonas axonopodis pv. citri str. 306]
          Length = 442

 Score =  287 bits (735), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 159/368 (43%), Positives = 223/368 (60%), Gaps = 5/368 (1%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISP-SACWCGRVINALGKPIDGDDSL 119
           +V+  + D+  + P G    +S    V   GR    P      GRV++ LG+P DG  ++
Sbjct: 63  EVVGFSRDLALLAPFGELVGLSRETRVIGLGRPLAVPVGPALLGRVLDGLGEPSDGQGAI 122

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
              D  + I ++ P  M R+ +E+   TG+R++D    L  GQR+G+FA +G+GKSTL+ 
Sbjct: 123 AC-DTWVPIQAQAPDPMRRRLIEQPMPTGVRIVDGLMTLGEGQRMGIFAAAGVGKSTLMG 181

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTA 238
           MFAR    D  +I L+GERGREVREFIE  LG D L +SVVV ATSD S I R  A    
Sbjct: 182 MFARGTQCDVNVIVLIGERGREVREFIELILGADGLARSVVVCATSDRSSIERAKAAYVG 241

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
             IAEYF  +G  VLL++DS+TRFA + REI   +GE P  RG+P SVF+ELPRLLER G
Sbjct: 242 TAIAEYFRDRGLRVLLMMDSLTRFARAQREIGLAAGEPPTRRGFPPSVFAELPRLLERAG 301

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
             E   G+ITA  +VL + D  +DPIA+ VR ILDGH++L+R +A + +YP +D LAS+S
Sbjct: 302 MGES--GSITAFYTVLAEDDTGSDPIAEEVRGILDGHLILSREIAAKNQYPAIDVLASLS 359

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+  +   +D  +    L  L+ ++ E   +  +G YR G D + D+A+ ++  I DFL 
Sbjct: 360 RVMSQIVPSDHSQAAGRLRRLLAKYNEVETLVQVGEYRQGSDAVADEAIDRIDAIRDFLS 419

Query: 419 QSPSDLSS 426
           Q    LS+
Sbjct: 420 QPTDRLSA 427


>gi|220913729|ref|YP_002489038.1| ATPase, FliI/YscN family [Arthrobacter chlorophenolicus A6]
 gi|219860607|gb|ACL40949.1| ATPase, FliI/YscN family [Arthrobacter chlorophenolicus A6]
          Length = 446

 Score =  287 bits (735), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 164/364 (45%), Positives = 227/364 (62%), Gaps = 6/364 (1%)

Query: 74  PVGIGEEISLGDLVFHWGRFRISPSACWC-GRVINALGKPIDGDDSLGKGDLSMEIMSKV 132
           P+G    ++ GD     G+  + P+     GRV++ LG+PIDG   L  G   +   ++ 
Sbjct: 72  PLGRLTGVAAGDPARSKGKPLMVPTGTGLFGRVLDGLGRPIDGKGPLVTGR-HVPADNES 130

Query: 133 PPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVII 192
           P AM+R RVE    TG+RV+D    L  GQR+G+FAGSG+GKS+LLSM AR    +  +I
Sbjct: 131 PSAMHRARVEAPLHTGVRVLDTMATLGRGQRMGLFAGSGVGKSSLLSMVARGTDAEVSVI 190

Query: 193 SLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDN 251
           +LVGERGREVREF+ED LG + L +SVVVVATSDE  ++R    +TA  IAE F   G +
Sbjct: 191 ALVGERGREVREFLEDDLGAEGLARSVVVVATSDEPALMRLRCAVTATRIAESFREAGRD 250

Query: 252 VLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVI 311
           V+L++DS+TR A + REI  ++GE P  RGYP S FS L RLLER G +  E G++T + 
Sbjct: 251 VVLMMDSLTRVAMAQREIGLSAGEPPATRGYPPSTFSLLARLLERAGTA--ETGSVTGIY 308

Query: 312 SVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKK 371
           +VLVDGD+HN+PIAD+ RSILDGH+VL+R LA  G +P VD L SVSR+A K  +     
Sbjct: 309 TVLVDGDDHNEPIADAARSILDGHVVLDRKLAVAGHFPSVDVLGSVSRVASKVNAPGNTA 368

Query: 372 LVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSE-DVF 430
           + + L   +      +D+  +G Y  G + ++D A+     I  FL+Q   D +   D +
Sbjct: 369 VAAVLRKTLAARRNAQDLIDVGAYHRGTNPLVDAALDNEAAINSFLQQRMDDSTPHRDSW 428

Query: 431 QEIT 434
           Q +T
Sbjct: 429 QALT 432


>gi|220932523|ref|YP_002509431.1| flagellar protein export ATPase FliI [Halothermothrix orenii H 168]
 gi|219993833|gb|ACL70436.1| flagellar protein export ATPase FliI [Halothermothrix orenii H 168]
          Length = 437

 Score =  287 bits (734), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 166/398 (41%), Positives = 237/398 (59%), Gaps = 12/398 (3%)

Query: 43  VCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWG-RFRISPSACW 101
           +CL    +  GK S    +V+  + D V + P+G    I+ G  V   G +  +      
Sbjct: 45  ICL----IKNGKRSVK-AEVVGFDKDKVLLMPIGEMRGINPGARVVATGEKLTVKVGEGL 99

Query: 102 CGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHG 161
            G+V+N LG+PI     +  G   + +M++ P  + R+R+ +    GIR ID       G
Sbjct: 100 LGQVLNGLGQPISSGLKMRHGFTEVPVMAQPPDPLLRKRITEPLSLGIRSIDGLLTCGRG 159

Query: 162 QRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVV 220
           QR+G+FAGSG+GKSTLL M AR+   D  +I LVGERGREVR+FIE  LG + LKKS+VV
Sbjct: 160 QRVGIFAGSGVGKSTLLGMAARNTEADINVIGLVGERGREVRDFIERDLGPEGLKKSIVV 219

Query: 221 VATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVAR 280
           VATSD+  ++R  A   A  IAE+F  +G NVLL++DS+TR A + RE+    GE P  R
Sbjct: 220 VATSDKPALVRVKAAYVATAIAEFFRDQGKNVLLMMDSVTRVAMAFREVGLAVGEPPATR 279

Query: 281 GYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNR 340
           GYP SV++ELP+LLER G +  + G ITA+ +VLV+GD+ N+P++D+VR ILDGHIVL+R
Sbjct: 280 GYPPSVYAELPKLLERAGTN--QHGTITALYTVLVEGDDFNEPVSDTVRGILDGHIVLSR 337

Query: 341 SLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVD 400
            LA    YP VD L SVSRL       +  +    +  ++  + E+ D+  IG Y+PG +
Sbjct: 338 DLASRNHYPAVDVLESVSRLMPDIVDEEHLQAAGEVKKMLADYRESEDLINIGAYKPGSN 397

Query: 401 LILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
             +D+A+  +  I  FL+Q     SS   F+E    L+
Sbjct: 398 PAIDRALENINDINTFLRQGIGQKSS---FEETVTMLK 432


>gi|86139477|ref|ZP_01058046.1| H+-transporting two-sector ATPase, flagellum-specific [Roseobacter
           sp. MED193]
 gi|85823980|gb|EAQ44186.1| H+-transporting two-sector ATPase, flagellum-specific [Roseobacter
           sp. MED193]
          Length = 442

 Score =  287 bits (734), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 162/414 (39%), Positives = 251/414 (60%), Gaps = 4/414 (0%)

Query: 16  SKNLVVQGGYISSITSVYYTVTCLSQYVCLGD-FVVHQGKNSDNLGQVIRINLDIVYICP 74
           SK L    G +S I+     ++ L +   +GD  V+ +G   +  G+V++I+ + + + P
Sbjct: 14  SKKLATSMGRVSGISGGEIEISGLEREARIGDRLVLVRGPGDELHGEVLKIDSNKISMLP 73

Query: 75  VGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPP 134
               + +++ D V        +P   W GRVI+  G+P+DG   L +G+ + ++M+  P 
Sbjct: 74  DRSPDRVAINDRVKLMPAPDFAPGDNWIGRVIDPFGEPLDGRPLL-RGEKARDLMAPPPK 132

Query: 135 AMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISL 194
           A  R+ +     TG+ V +   P+  GQRIG+FAGSG+GKSTLL+  A+    D V+++L
Sbjct: 133 AAGRRHMGARLDTGLSVFNTILPIVQGQRIGLFAGSGVGKSTLLAKMAQFMQADVVVMAL 192

Query: 195 VGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVL 253
           +GERGREV  F++D LG + +K++VVV ATSD+S ++R+ +   A+TIAE+F  +G NVL
Sbjct: 193 IGERGREVNHFVKDVLGPEGMKRAVVVAATSDQSALVRRRSAWAAMTIAEHFRDQGKNVL 252

Query: 254 LILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISV 313
            + DS+TRFA + REI+  SGE P  RG+P SV   +  L ER GP  + +G+ITAV SV
Sbjct: 253 FMADSVTRFAEAHREISAASGEAPSLRGFPPSVTPLITGLCERAGPGSEGQGDITAVFSV 312

Query: 314 LVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLV 373
           LV G + ++PIAD +R +LDGHIVLNR +AE GR+P VD   SVSR    A + +E   +
Sbjct: 313 LVAGSDMDEPIADILRGVLDGHIVLNREIAERGRFPAVDVSRSVSRSLPAAATDEENATI 372

Query: 374 SSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFL-KQSPSDLSS 426
             +   +  +E++  +   G Y  G D++LD+AV   P +  F  K+ P  +S+
Sbjct: 373 LEVRKFLGSYEQSEVMIRAGLYSEGNDVVLDQAVKIWPELDAFFGKEDPQGVSN 426


>gi|15642991|ref|NP_228033.1| flagellum-specific ATP synthase [Thermotoga maritima MSB8]
 gi|4980716|gb|AAD35310.1|AE001706_9 flagellum-specific ATP synthase [Thermotoga maritima MSB8]
          Length = 438

 Score =  287 bits (734), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 166/390 (42%), Positives = 245/390 (62%), Gaps = 11/390 (2%)

Query: 50  VHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINA 108
           +  GKN+  L +V+    + V + P      + +G  V    +   +  S    GRV + 
Sbjct: 49  LQNGKNA--LAEVVGFREESVILMPYEDVSGLKMGCEVIRTNKVLEVGVSRKMIGRVFDG 106

Query: 109 LGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFA 168
           LG+PIDG   + +      +++  P  + R+R++     GIR ID F  +  GQRIG+FA
Sbjct: 107 LGRPIDGKPFVPED--RYPLINNPPNPLKRRRIKDPLPVGIRSIDGFITIGKGQRIGIFA 164

Query: 169 GSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDES 227
           GSG+GKSTLL M AR+   D  +++L+GERGREVREFIE  LG+  LK+S++VV+TSD+ 
Sbjct: 165 GSGVGKSTLLGMIARNTTADINVLALIGERGREVREFIERDLGEEGLKRSILVVSTSDQP 224

Query: 228 PILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVF 287
            + R  + LTA +IAE+F   G +VLL++DS+TR+A + RE+    GE P  RGYP SVF
Sbjct: 225 ALARVKSLLTATSIAEFFRDLGYDVLLMVDSLTRWAMAQREVGLAVGEPPTTRGYPPSVF 284

Query: 288 SELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGR 347
           + LP++LER G S+K  G+ITA+ +VLV+ D+ N+PI+D+VRSI+DGHI+L+R LAE   
Sbjct: 285 AGLPKILERAGNSDK--GSITAIYTVLVEADDFNEPISDTVRSIVDGHIILSRRLAESNH 342

Query: 348 YPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAV 407
           YP VD LASVSRL +   + + ++  + L  L+  +E  +D+  IG Y+ G + ++DKAV
Sbjct: 343 YPAVDVLASVSRLMNDIVTEEHREAANRLRSLMSAYESAKDLIEIGAYKSGTNPLVDKAV 402

Query: 408 HQVPIIYDFLKQSPSDLSSEDVFQEITKKL 437
                I  FLKQ   + +S   F+E  +KL
Sbjct: 403 EMKDEIDSFLKQGVFEKAS---FEETLQKL 429


>gi|242309920|ref|ZP_04809075.1| flagellum-specific ATP synthase [Helicobacter pullorum MIT 98-5489]
 gi|239523217|gb|EEQ63083.1| flagellum-specific ATP synthase [Helicobacter pullorum MIT 98-5489]
          Length = 432

 Score =  286 bits (733), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 160/398 (40%), Positives = 238/398 (59%), Gaps = 5/398 (1%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISL 83
           G ++ +   + +   LS  +  GD V    +N +++G V  +  +   I P    E   +
Sbjct: 20  GLVTKVEQGFLSANGLSPRI--GDIVRITNENGNSMGMVTTLEANSFKITPFSFVEGTKV 77

Query: 84  GDLVF-HWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVE 142
           GD V+ +    +I       GRVIN LG+PIDG   L + +  M I+ +   AM R  ++
Sbjct: 78  GDKVYLNTKGLQIPVGLELLGRVINPLGEPIDGKGEL-RAEGLMPIIRQPIAAMKRGMID 136

Query: 143 KGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREV 202
           + F  G++ ID       GQ++G+FAGSG+GKSTL+ M  R       +I+L+GERGREV
Sbjct: 137 EVFSVGVKSIDGLLTCGKGQKLGIFAGSGVGKSTLMGMIVRGAQAKIKVIALIGERGREV 196

Query: 203 REFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRF 262
            EF+E  LG +L  +V+VVATSD+SP++RK     A+++AEYF +KG++VL ++DS+TRF
Sbjct: 197 PEFVEKNLGGDLTNTVLVVATSDDSPLMRKYGAFAAMSVAEYFKAKGEDVLFMMDSVTRF 256

Query: 263 AHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHND 322
           A + REI    GE P ++GYP SV + LP+L+ER G  E+ KG+ITA  +VLV+GD+ +D
Sbjct: 257 AMAQREIGLALGEPPTSKGYPPSVLTLLPQLMERAG-KEEGKGSITAYFTVLVEGDDMSD 315

Query: 323 PIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHR 382
           PIAD  RSILDGHIVL+RSL + G YPP++ L S SRL       +          L   
Sbjct: 316 PIADQSRSILDGHIVLDRSLTDFGIYPPINILNSASRLMGDVAQKEHILAARKFRRLYSM 375

Query: 383 FEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQS 420
            +E   +  IG Y+ G D  +D+A+ +   + D+L+Q+
Sbjct: 376 LKENEVLIRIGAYQAGSDKEIDEAIAKKSDMEDYLRQN 413


>gi|56964031|ref|YP_175762.1| flagellum-specific ATP synthase [Bacillus clausii KSM-K16]
 gi|56910274|dbj|BAD64801.1| flagellum-specific ATP synthase [Bacillus clausii KSM-K16]
          Length = 437

 Score =  286 bits (733), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 159/379 (41%), Positives = 225/379 (59%), Gaps = 7/379 (1%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSL 119
           +V+    D + + P+     I+ G  V   G+   ++      G+++N +G+P     +L
Sbjct: 57  EVVGFKDDRILLMPLDDTRRIAPGSYVEGTGKPLNVACGPSLIGQIVNGVGEPFLQSAAL 116

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
           G  D +    +  P  + R R+ +    G+R ID    +  GQR+G+FAGSG+GKSTL+S
Sbjct: 117 GDTDANYSTDNSPPNPLERPRISEIMSVGVRAIDGLLTMGKGQRVGIFAGSGVGKSTLMS 176

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPLTA 238
           M A+    D  +I+L+GERGREV+EF+E  LG+  LKKSVVVVATSD+  +LR     TA
Sbjct: 177 MIAKQSDADVNVIALIGERGREVKEFVERDLGEEGLKKSVVVVATSDQPALLRVKGAQTA 236

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
             IAEYF  KG NV L++DS+TRFA + REI    GE P  +GYP SVF+ +P+LLER G
Sbjct: 237 TAIAEYFRDKGKNVNLMMDSVTRFAMAQREIGLAIGEPPTTKGYPPSVFAMMPKLLERSG 296

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
            +  + G+IT + +VLVDGD+ N+PIAD+VR ILDGH VL+R LA  G+YP V+ L SVS
Sbjct: 297 TN--QSGSITGLYTVLVDGDDMNEPIADAVRGILDGHFVLDRQLANRGQYPAVNVLKSVS 354

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           RL       D           +  +E++ D+  +G Y+ G    +D A+H  P + DFLK
Sbjct: 355 RLMKDLVENDHLHAAKLFRQRLADYEQSEDLISLGAYKQGSSKDIDAAIHDHPAMLDFLK 414

Query: 419 QSPSDLSSEDVFQEITKKL 437
           Q   ++   D F E   KL
Sbjct: 415 Q---EVEESDSFAETKTKL 430


>gi|222099441|ref|YP_002534009.1| Flagellum-specific ATP synthase [Thermotoga neapolitana DSM 4359]
 gi|221571831|gb|ACM22643.1| Flagellum-specific ATP synthase [Thermotoga neapolitana DSM 4359]
          Length = 431

 Score =  286 bits (733), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 164/390 (42%), Positives = 242/390 (62%), Gaps = 11/390 (2%)

Query: 50  VHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINA 108
           +  GKN+  L +V+      V + P      + +G  V    R   I       GR+ + 
Sbjct: 42  LQNGKNA--LAEVVGFKEGNVVLMPYEDVSGLKMGCEVIRTNRVLEIGVGRNMIGRIFDG 99

Query: 109 LGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFA 168
           LG+P+DG   + +    +   +  P  + R+R++     G+R ID F  +  GQRIG+FA
Sbjct: 100 LGRPLDGRSFVPEARYPL--TNSPPHPLKRKRIKDPLSVGVRAIDGFITIGKGQRIGIFA 157

Query: 169 GSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDES 227
           GSG+GKSTLL M AR+   D  +++L+GERGREVREFIE  LG+  LK+S++VV+TSD+ 
Sbjct: 158 GSGVGKSTLLGMIARNTTADVCVLALIGERGREVREFIERDLGEEGLKRSILVVSTSDQP 217

Query: 228 PILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVF 287
            + R  + LTA +IAEY+   G +VLL++DS+TR+A + RE+    GE P  RGYP SVF
Sbjct: 218 ALARVKSLLTATSIAEYYRDLGYDVLLMVDSLTRWAMAQREVGLAIGEPPTTRGYPPSVF 277

Query: 288 SELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGR 347
           + LP++LER G S++  G+ITAV +VLV+ D+ N+PI+D+VRSI+DGHIVL+R LAE   
Sbjct: 278 AGLPKILERAGNSDR--GSITAVYTVLVEADDFNEPISDTVRSIVDGHIVLSRRLAESNH 335

Query: 348 YPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAV 407
           YP +D LASVSRL +   S + K+  + L  L+  +E  +D+  IG Y+ G + ++DKA+
Sbjct: 336 YPAIDVLASVSRLMNDVVSEEHKEAANRLRSLLASYESAKDLIEIGAYKKGTNPLVDKAI 395

Query: 408 HQVPIIYDFLKQSPSDLSSEDVFQEITKKL 437
                I  FL+Q   + SS   F+E  ++L
Sbjct: 396 EMQEDINAFLRQGIFEKSS---FEETVQRL 422


>gi|311068145|ref|YP_003973068.1| flagellum-specific ATP synthase [Bacillus atrophaeus 1942]
 gi|310868662|gb|ADP32137.1| flagellum-specific ATP synthase [Bacillus atrophaeus 1942]
          Length = 438

 Score =  286 bits (733), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 169/389 (43%), Positives = 235/389 (60%), Gaps = 13/389 (3%)

Query: 43  VCLGDFVVHQGKNSDNL--GQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSA 99
           VCL    +H   +SD +   +V+    + + + P      IS G +V   G   RI   A
Sbjct: 42  VCL----IHPKGSSDKVIKAEVVGFQDENILLMPYLEAASISPGSIVEATGESLRIKVGA 97

Query: 100 CWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPP-AMNRQRVEKGFKTGIRVIDIFTPL 158
              G+VI+A G+P+DG   L KG LS     + PP  M R  + +    G+R ID    +
Sbjct: 98  GLIGQVIDAFGEPLDGK-LLPKG-LSPVSTDQAPPNPMKRPPIREKMAVGVRSIDSLLTV 155

Query: 159 CHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKS 217
             GQRIG+FAGSG+GKSTL+ M A+    D  +I+LVGERGREVREFIE  LG + LK+S
Sbjct: 156 GKGQRIGIFAGSGVGKSTLMGMIAKQTEADLNVIALVGERGREVREFIEKDLGPEGLKRS 215

Query: 218 VVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELP 277
           +VVVATSD+  ++R  A  TA  IAEYF  KG NV+ ++DS+TR A + REI   +GE P
Sbjct: 216 IVVVATSDQPALMRLKAAYTATAIAEYFRDKGQNVMFMMDSVTRVAMAQREIGLAAGEPP 275

Query: 278 VARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIV 337
             +GY  SVF+ LPRLLER G +E+  G ITA  +VLVDGD+ N+PIAD+VR ILDGHIV
Sbjct: 276 TTKGYTPSVFAILPRLLERTGANEQ--GTITAFYTVLVDGDDMNEPIADTVRGILDGHIV 333

Query: 338 LNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRP 397
           L+R+LA +G++P V+ L S+SR+     +       +    L+  ++ + D+  IG Y+ 
Sbjct: 334 LDRALANKGQFPAVNVLKSISRVMSNISAPHHLDAANKFRELLSTYQNSEDLINIGAYKR 393

Query: 398 GVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
           G    +D+A+   P +  FLKQ   + S+
Sbjct: 394 GSSREIDEAIQFYPQLIQFLKQGTEESST 422


>gi|330447946|ref|ZP_08311594.1| conserved hypothetical protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328492137|dbj|GAA06091.1| conserved hypothetical protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 450

 Score =  286 bits (732), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 154/366 (42%), Positives = 226/366 (61%), Gaps = 5/366 (1%)

Query: 61  QVIRINLDIVYICPV-GIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSL 119
           QV+  + +I Y+ PV  +G   +   ++   G   ++ S  W GRV+N LG+P+D  + L
Sbjct: 61  QVVGFDHNIAYLMPVRQLGGLYAGAKVIPMQGGSTVNVSHEWIGRVVNGLGEPLDNGEPL 120

Query: 120 GKGD-LSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLL 178
             G+ LS+E     P  M RQ VE     GI+ I+    +  GQRIG+ AGSG+GKS L+
Sbjct: 121 QGGERLSLEPKPINP--MKRQPVESPLDVGIKAINGLLTVGKGQRIGLMAGSGVGKSVLM 178

Query: 179 SMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPLT 237
            M  +    D +++ L+GERGREVREFIE  LG+   K++V++ A +DESP++R  A   
Sbjct: 179 GMITQFTAADIIVVGLIGERGREVREFIERNLGEEGRKRAVIIAAPADESPLMRLRATKL 238

Query: 238 AVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERI 297
              +AEYF  +G +VLL++DS+TR+A + REIA   GE P +RGYP SVFS LP+LLER 
Sbjct: 239 CHRVAEYFRDQGKDVLLMMDSLTRYAMAQREIALALGEPPASRGYPPSVFSLLPQLLERA 298

Query: 298 GPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASV 357
           G  E   G++TA+ +VL +GD+  DP+ DS R+ILDGHIVL+R+LAE+G YP +D  AS+
Sbjct: 299 GNGENPNGSLTAIYTVLAEGDDQQDPVVDSARAILDGHIVLSRTLAEQGHYPAIDINASI 358

Query: 358 SRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFL 417
           SR            + +    L   +++ +++  +GGY+ G D  LD+AV   P +  FL
Sbjct: 359 SRCMSSCTEQAHVTVANQFRQLNANYQQVKELLPLGGYQQGQDPELDQAVMMQPQLKQFL 418

Query: 418 KQSPSD 423
           +Q  S+
Sbjct: 419 QQPVSE 424


>gi|170288527|ref|YP_001738765.1| flagellar protein export ATPase FliI [Thermotoga sp. RQ2]
 gi|170176030|gb|ACB09082.1| flagellar protein export ATPase FliI [Thermotoga sp. RQ2]
          Length = 438

 Score =  286 bits (731), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 167/391 (42%), Positives = 245/391 (62%), Gaps = 13/391 (3%)

Query: 50  VHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINA 108
           +  GKN+  L +V+    + V + P      + +G  V    +   +  S    GRV + 
Sbjct: 49  LQNGKNA--LAEVVGFREESVILMPYEDVSGLKMGCEVIRTNKVLEVGVSRKMIGRVFDG 106

Query: 109 LGKPIDGDDSLGKGDLSMEIMSKVPP-AMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVF 167
           LG+PIDG   + +    +   +  PP  + R+R++     GIR ID F  +  GQRIG+F
Sbjct: 107 LGRPIDGKPFVPEDRYPL---TNTPPNPLKRRRIKDPLPVGIRSIDGFITVGKGQRIGIF 163

Query: 168 AGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDE 226
           AGSG+GKSTLL M AR+   D  +++L+GERGREVREFIE  LG+  LK+S++VV+TSD+
Sbjct: 164 AGSGVGKSTLLGMIARNTTADINVLALIGERGREVREFIERDLGEEGLKRSILVVSTSDQ 223

Query: 227 SPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSV 286
             + R  + LTA +IAE+F   G +VLL++DS+TR+A + RE+    GE P  RGYP SV
Sbjct: 224 PALARVKSLLTATSIAEFFRDLGYDVLLMVDSLTRWAMAQREVGLAVGEPPTTRGYPPSV 283

Query: 287 FSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEG 346
           F+ LP++LER G S+K  G+ITA+ +VLV+ D+ N+PI+D+VRSI+DGHI+L+R LAE  
Sbjct: 284 FAGLPKILERAGNSDK--GSITAIYTVLVEADDFNEPISDTVRSIVDGHIILSRRLAESN 341

Query: 347 RYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKA 406
            YP VD LASVSRL +   + + ++  + L  L+  +E  +D+  IG Y+ G + ++DKA
Sbjct: 342 HYPAVDVLASVSRLMNDIVTEEHREAANRLRSLMSAYESAKDLIEIGAYKSGTNPLVDKA 401

Query: 407 VHQVPIIYDFLKQSPSDLSSEDVFQEITKKL 437
           V     I  FLKQ   + +S   F+E  +KL
Sbjct: 402 VEMKDEIDSFLKQGVFEKAS---FEETLQKL 429


>gi|90577384|ref|ZP_01233195.1| putative flagellum-specific ATP synthase [Vibrio angustum S14]
 gi|90440470|gb|EAS65650.1| putative flagellum-specific ATP synthase [Vibrio angustum S14]
          Length = 449

 Score =  286 bits (731), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 151/361 (41%), Positives = 222/361 (61%), Gaps = 3/361 (0%)

Query: 61  QVIRINLDIVYICPV-GIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSL 119
           QV+  + +I Y+ PV  +G   +   ++   G   ++ S  W GRV+N LG+P+D    L
Sbjct: 61  QVVGFDHNIAYLMPVRQLGGLYAGAKVIPMQGGSTVNVSHKWIGRVVNGLGEPLDNGSPL 120

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
             G+ S+ +  K    M RQ VE     GI+ I+    +  GQRIG+ AGSG+GKS L+ 
Sbjct: 121 QGGE-SLSLEPKPINPMKRQPVESPLDVGIKAINGLLTVGKGQRIGLMAGSGVGKSVLMG 179

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPLTA 238
           M  +    D +++ L+GERGREVREFIE  LG+   K++V++ A +DESP++R  A    
Sbjct: 180 MITKYTAADIIVVGLIGERGREVREFIERNLGEEGRKRAVIIAAPADESPLMRLRATKLC 239

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
             +AEYF  +G +VLL++DS+TR+A + REIA   GE P +RGYP SVFS LP+LLER G
Sbjct: 240 HRVAEYFRDQGKDVLLLMDSLTRYAMAQREIALALGEPPASRGYPPSVFSLLPQLLERAG 299

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
             E   G++TA+ +VL +GD+  DP+ DS R+ILDGHIVL+R+LAE+G YP +D  AS+S
Sbjct: 300 NGENPNGSLTAIYTVLAEGDDQQDPVVDSARAILDGHIVLSRTLAEQGHYPAIDINASIS 359

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R            + +    L   +++ +++  +GGY+ G D  LD+AV   P +  FL+
Sbjct: 360 RCMSSCTEQAHVTVANQFRQLNANYQQVKELLPLGGYQQGQDPELDQAVMMQPQLKQFLQ 419

Query: 419 Q 419
           Q
Sbjct: 420 Q 420


>gi|126697822|ref|YP_001086719.1| flagellum-specific ATP synthase [Clostridium difficile 630]
 gi|115249259|emb|CAJ67072.1| ATP synthase subunit beta FliI [Clostridium difficile]
          Length = 439

 Score =  286 bits (731), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 157/348 (45%), Positives = 224/348 (64%), Gaps = 13/348 (3%)

Query: 97  PSACWC-----GRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRV 151
           P +  C     G+V++ LG PID  D++  GD    + ++ P  M R+++    +TG+R 
Sbjct: 95  PLSVMCSDNLLGKVLDGLGNPIDNSDAV-LGD-RYNLNNEPPDPMKRKKIRNIMETGVRA 152

Query: 152 IDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG 211
           ID FT    GQRIG+FAGSG+GKST L M AR+   D  +I+L+GERGREV +FI+  LG
Sbjct: 153 IDAFTTCGEGQRIGIFAGSGVGKSTTLGMIARNAKADVNVIALIGERGREVLDFIDKDLG 212

Query: 212 DN-LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIA 270
           +  +KKSVVV ATSD++P++R    LTA  IAEYF  +G  V+L++DS+TRFA + RE+ 
Sbjct: 213 EEGMKKSVVVCATSDKAPLVRLKGALTATAIAEYFRDQGKKVILMMDSVTRFAMAQREVG 272

Query: 271 TNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRS 330
              GE P  +GY  SVF+ LP+L+ER G S+K  G+ITA  +VLVDGD+ N+PIAD+ R 
Sbjct: 273 VAIGEPPAQKGYTPSVFAMLPKLMERTGTSDK--GSITAFYTVLVDGDDFNEPIADTTRG 330

Query: 331 ILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIR 390
           ILDGHIVL+R LA +  YP +D L S+SRL ++  S ++ K+ S    ++  + E  D+ 
Sbjct: 331 ILDGHIVLSRDLANKNHYPSIDVLNSLSRLMNEIASKEDIKIASFARDMLAEYREAEDLI 390

Query: 391 LIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
            IG Y  G +  +D+A++    I +FLKQ  ++ SS   F E    L+
Sbjct: 391 NIGAYASGTNKKIDEAIYYHEHIINFLKQGINEKSS---FNETISSLR 435


>gi|77464910|ref|YP_354414.1| H+-transporting two-sector ATPase, alpha/beta subunit [Rhodobacter
           sphaeroides 2.4.1]
 gi|77389328|gb|ABA80513.1| H+-transporting two-sector ATPase, alpha/beta subunit [Rhodobacter
           sphaeroides 2.4.1]
          Length = 436

 Score =  286 bits (731), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 169/414 (40%), Positives = 244/414 (58%), Gaps = 2/414 (0%)

Query: 11  LAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIV 70
           LAE  + +L  + G ++ I     +V  L Q   LGD V   G      G+V+R++   V
Sbjct: 9   LAEIAAISLSRRYGRVTGIGRGTLSVGGLEQGTALGDRVEICGAGGILGGEVLRLSSHEV 68

Query: 71  YICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMS 130
            I P G  E +++GD V   G   I+P   W GR+++ LG+P+DG   L +G  +  + +
Sbjct: 69  TILPDGSPEGLAIGDAVALVGPAEIAPDDSWIGRIVDPLGRPLDGR-PLFRGPRARPLRA 127

Query: 131 KVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKV 190
             P A  R+ +     TG+ V D   PL  GQRIG+FAGSG+GKS+LL+ FARS   D V
Sbjct: 128 AAPQAAARRSLGPRLPTGVAVFDTLLPLVQGQRIGLFAGSGVGKSSLLAKFARSVVADVV 187

Query: 191 IISLVGERGREVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKG 249
           +I LVGERGRE+REF E  LG   + ++VVV ATSD+SP++R+     A+ +AE+F  +G
Sbjct: 188 VIGLVGERGRELREFTERVLGPAGMARAVVVTATSDQSPLVRRRCGWAAMAVAEHFRDQG 247

Query: 250 DNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITA 309
            +VLL++DSITRFA + RE+A   GE    RG+P S    +  L ER GP  +  G+ITA
Sbjct: 248 LHVLLLVDSITRFAEAHREVALAGGEAASMRGFPPSTAHTIMALAERAGPGAEGTGDITA 307

Query: 310 VISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADE 369
           V SVLV G +  +P+AD +R +LDGH+V++R +AE GR+P +D L SVSR   +A S  E
Sbjct: 308 VFSVLVAGSDMEEPVADILRGVLDGHVVMDRKIAERGRFPAIDLLRSVSRALPEAASTAE 367

Query: 370 KKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSD 423
             L++    L+  ++    +   G Y  G D ++D A+   P +  FL +  SD
Sbjct: 368 NALIAEARRLLGAWDRAEMMIQAGLYARGSDPLVDAAIRVWPALDAFLAEDASD 421


>gi|255022048|ref|ZP_05294054.1| Flagellum-specific ATP synthase FliI [Acidithiobacillus caldus ATCC
           51756]
 gi|254968534|gb|EET26090.1| Flagellum-specific ATP synthase FliI [Acidithiobacillus caldus ATCC
           51756]
          Length = 448

 Score =  286 bits (731), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 164/374 (43%), Positives = 213/374 (56%), Gaps = 15/374 (4%)

Query: 58  NLGQVIRINLDIVYICPVG------IGEEISLGDLVFHWGRFRISPSACWCGRVINALGK 111
            LG+VI  + D   + P G       G  + L D         ++      GRVI+A G+
Sbjct: 68  RLGEVIGFHGDRAAVMPFGGLRGVFAGASVILADQ-----DSMVAVGDALLGRVIDAQGR 122

Query: 112 PIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSG 171
           P+DG   L      +      P  ++R R+ K    G+R I+    +  GQRIG+FAGSG
Sbjct: 123 PLDGRPLLATQRRPLR--QPAPHPLHRARIVKPLDVGVRAINALLTVGEGQRIGLFAGSG 180

Query: 172 IGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILR 231
           +GKS LL M AR    D V+I+L+GERGREVREF+ED LGD L  SV+VVAT+D  PILR
Sbjct: 181 VGKSVLLGMMARHTQADVVVIALIGERGREVREFVEDILGDGLSHSVLVVATADAPPILR 240

Query: 232 KMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELP 291
                 A  IAE+F  +G  VLLI+DS+TR+A + RE+   +GELP  +GYP SVFS L 
Sbjct: 241 MRGAEYATAIAEHFRDQGKRVLLIMDSLTRYAMAAREVGLTAGELPATKGYPPSVFSTLS 300

Query: 292 RLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPV 351
            L ER G +  E G ITA  SVL +GD+  DP+AD+ RSILDGHIVL+R LA  G  P +
Sbjct: 301 VLTERAGTA--ENGAITAFYSVLTEGDDLQDPVADAARSILDGHIVLSRDLAAAGVLPAI 358

Query: 352 DPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVP 411
           DP  S SR+       +   LV  +      + E  D+  IG YR G D  LD A+ + P
Sbjct: 359 DPAVSASRVMRSIVDTEHLALVQRVMSWWGNYREKSDLIAIGAYRQGSDPTLDMAMQKYP 418

Query: 412 IIYDFLKQSPSDLS 425
            I DFL+Q P + S
Sbjct: 419 AILDFLRQHPEESS 432


>gi|154249443|ref|YP_001410268.1| flagellar protein export ATPase FliI [Fervidobacterium nodosum
           Rt17-B1]
 gi|154153379|gb|ABS60611.1| flagellar protein export ATPase FliI [Fervidobacterium nodosum
           Rt17-B1]
          Length = 443

 Score =  286 bits (731), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 172/423 (40%), Positives = 254/423 (60%), Gaps = 11/423 (2%)

Query: 1   MQKNLETLAQLAEDYSKNL--VVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDN 58
           +Q+N++ L ++ ED  K L      G +  I  +  T+        LG+       N   
Sbjct: 6   LQENIKFL-EIIEDKVKKLNPYEYAGEVQKIIGL--TIESRGPDAALGELCKILVGNKKA 62

Query: 59  LGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWC-GRVINALGKPIDGDD 117
           L +V+    D+  + P+     +  G  V   GR    P      GRVI+ALG+PIDG  
Sbjct: 63  LAEVVGFKEDLTILMPLEDVTGLKKGCEVLKTGRTVSVPVGEELKGRVIDALGRPIDGKR 122

Query: 118 SLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
            + K     +I+S+ P  + R+R+ +    G+R ID F  L  GQRIG+FAGSG+GKSTL
Sbjct: 123 LVLKE--YRQIVSEAPNPLIRKRILEPLPVGVRAIDGFLTLGKGQRIGIFAGSGVGKSTL 180

Query: 178 LSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPL 236
           L M AR+   D  +I+L+GERGREVREFIE  LG+  +K+SVVVV+TSD+  +LR  A L
Sbjct: 181 LGMIARNTTADINVIALIGERGREVREFIEKDLGEEGIKRSVVVVSTSDQPALLRIKALL 240

Query: 237 TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLER 296
           TA TIAEYF  KG  V+L++DS+TR+A + RE+    GE P  RGYP SVF++LP++LER
Sbjct: 241 TATTIAEYFRDKGYAVMLMVDSLTRWAMAQREVGLAIGEPPTTRGYPPSVFAQLPKILER 300

Query: 297 IGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLAS 356
            G S  +KG+IT + +VLV+ D+ N+PI+D+VR I+DGHI+L+R LAE   +P +D L S
Sbjct: 301 AGNS--DKGSITGIYTVLVEADDFNEPISDTVRGIVDGHIILSRKLAESNHFPAIDVLMS 358

Query: 357 VSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDF 416
           +SRL       +  +   ++  +I  + + +D+  +G Y+ G +  +DK++  +  I  F
Sbjct: 359 ISRLMVDITKPEHIQSARAIRDIIATYNDAKDLIDVGAYKKGANPKIDKSIELIDEINKF 418

Query: 417 LKQ 419
           L+Q
Sbjct: 419 LRQ 421


>gi|221636054|ref|YP_002523930.1| flagellar protein export ATPase FliI [Thermomicrobium roseum DSM
           5159]
 gi|221157913|gb|ACM07031.1| flagellar protein export ATPase FliI [Thermomicrobium roseum DSM
           5159]
          Length = 450

 Score =  285 bits (730), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 162/360 (45%), Positives = 223/360 (61%), Gaps = 14/360 (3%)

Query: 87  VFHWGRFRISPSAC-------WCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQ 139
           V H  R   +P A          GRVI+ LG+PIDG   L +    + I    P  + R 
Sbjct: 82  VRHGSRVVRAPEALHVPVGPELLGRVIDGLGRPIDGKGPL-RCRRRLRIGGAPPSPLQRA 140

Query: 140 RVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERG 199
            +     TG+R ID       GQR+G+FAGSG+GKSTLL M +R+   D  +I+L+GERG
Sbjct: 141 PIRDILPTGVRTIDALLTCGRGQRLGIFAGSGVGKSTLLGMISRNAVCDVRVIALIGERG 200

Query: 200 REVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDS 258
           REV+EFIE  LG   L+++VVVV+TSD+  ++R  A  TA  IAEYF  +G +V+L++DS
Sbjct: 201 REVQEFIERDLGPAGLEQAVVVVSTSDQPALMRIKAAWTATLIAEYFRDRGMSVVLMMDS 260

Query: 259 ITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGD 318
           +TR A + RE+   +GE P  RGYP SVF+ LPRLLER G    E+G+ITA  +VLV+GD
Sbjct: 261 VTRLAMAQREVGLAAGEPPATRGYPPSVFALLPRLLERAG--NAEQGSITAFYTVLVEGD 318

Query: 319 NHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTH 378
           + N+PI+D+VR ILDGHIVL R+LA+ G YP +D LASVSRL     + D + L S +  
Sbjct: 319 DLNEPISDTVRGILDGHIVLARTLADRGHYPAIDVLASVSRLMPSLVTPDHRALASEVRE 378

Query: 379 LIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
           L+  +E  RD+  IG Y  G +  +D+A+  +P I  FL+Q P + ++   F E    L+
Sbjct: 379 LLAAYESARDLIDIGAYVHGTNPTVDRALSLMPEIRRFLQQKPEERAT---FAETVAWLE 435


>gi|260574407|ref|ZP_05842411.1| ATPase, FliI/YscN family [Rhodobacter sp. SW2]
 gi|259023303|gb|EEW26595.1| ATPase, FliI/YscN family [Rhodobacter sp. SW2]
          Length = 437

 Score =  285 bits (730), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 170/431 (39%), Positives = 255/431 (59%), Gaps = 6/431 (1%)

Query: 8   LAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINL 67
           LA++A   + +LV   G I+ I      V  L++   LGD V+ +G  +   G+V+R+  
Sbjct: 9   LAEIAGVQTTSLV---GRIAEIGRGTLRVAGLTEASALGDRVLIRGSGAVLGGEVLRLAR 65

Query: 68  DIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSME 127
           + V + P G  E +++GD V   GR  I+P   W GR+I+  GKP+DG  +L +G     
Sbjct: 66  EGVTVLPDGSAEGLAIGDAVELVGRAEIAPDDSWIGRIIDPFGKPLDGR-ALFRGPKPRP 124

Query: 128 IMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCF 187
           +    P A  R+R+ +   T + V D   PL  GQRIG+FAGSG+GKS+LL+ FAR    
Sbjct: 125 LRDAAPAAATRRRLGERLSTSVAVFDTLLPLVRGQRIGLFAGSGVGKSSLLAKFARGVTA 184

Query: 188 DKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFS 246
           D V+I+LVGERGRE+REF +  LG   + +SVVV ATSD+SP++R+    TA+ +AE+F 
Sbjct: 185 DVVVIALVGERGRELREFTDRVLGPQGMARSVVVTATSDQSPLIRRRCAWTAMAVAEHFR 244

Query: 247 SKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGN 306
            +G +VL + DSITRFA + RE+   +GE    RG+P S    +  L ER GP  +  G+
Sbjct: 245 DQGLHVLFLADSITRFAEAHREVVLAAGEEGNLRGFPPSTSHTIMSLAERAGPGPEGMGD 304

Query: 307 ITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWS 366
           ITAV SVLV G + ++P+AD +R +LDGH+V++R +AE GRYP +D L SVSR   +A +
Sbjct: 305 ITAVFSVLVAGSDMDEPVADILRGVLDGHVVMDRKIAERGRYPAIDLLRSVSRSLPEAAN 364

Query: 367 ADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
             E  +++    L+  ++    +   G Y  G D ++D A+   P +  FL +  +D   
Sbjct: 365 LAENAMIAEARRLLGAYDRAEMMIQAGLYAKGSDPMVDAAIRVWPALDAFLAEDAAD-GV 423

Query: 427 EDVFQEITKKL 437
           E  F+++   L
Sbjct: 424 EGSFRKLAACL 434


>gi|78045988|ref|YP_362163.1| type III secretion system ATPase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325927683|ref|ZP_08188911.1| Type III secretion system ATPase HrcN protein [Xanthomonas
           perforans 91-118]
 gi|462306|sp|P80153|HRPB6_XANEU RecName: Full=Probable ATP synthase hrpB6
 gi|398113|gb|AAA27605.1| AA: 163-179 mononucleotide binding box A; 193-207 magnesium binding
           domain; 244-256 mononucleotide binding box B
           [Xanthomonas campestris]
 gi|984883|gb|AAB08461.1| HrpB6 [Xanthomonas euvesicatoria]
 gi|78034418|emb|CAJ22063.1| HrcN protein [Xanthomonas campestris pv. vesicatoria str. 85-10]
 gi|325541884|gb|EGD13398.1| Type III secretion system ATPase HrcN protein [Xanthomonas
           perforans 91-118]
          Length = 442

 Score =  285 bits (730), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 161/377 (42%), Positives = 226/377 (59%), Gaps = 6/377 (1%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISP-SACWCGRVINALGKPIDGDDSL 119
           +V+  + D+  + P G    +S    V   GR    P      GRV++ LG+P DG  ++
Sbjct: 63  EVVGFSRDLALLAPFGELIGLSRETRVIGLGRPLAVPVGPALLGRVLDGLGEPSDGQGAI 122

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
              D  + I ++ P  M R+ +E    TG+R++D    L  GQR+G+FA +G+GKSTL+ 
Sbjct: 123 AC-DTWVPIQAQAPDPMRRRLIEHPMPTGVRIVDGLMTLGEGQRMGIFAAAGVGKSTLMG 181

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTA 238
           MFAR    D  +I L+GERGREVREFIE  LG D L +SVVV ATSD S I R  A    
Sbjct: 182 MFARGTQCDVNVIVLIGERGREVREFIELILGADGLARSVVVCATSDRSSIERAKAAYVG 241

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
             IAEYF  +G  VLL++DS+TRFA + REI   +GE P  RG+P SVF+ELPRLLER G
Sbjct: 242 TAIAEYFRDRGLRVLLMMDSLTRFARAQREIGLAAGEPPTRRGFPPSVFAELPRLLERAG 301

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
             E   G+ITA  +VL + D  +DPIA+ VR ILDGH++L+R +A + +YP +D LAS+S
Sbjct: 302 MGES--GSITAFYTVLAEDDTGSDPIAEEVRGILDGHLILSREIAAKNQYPAIDVLASLS 359

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+  +    D  +    L  L+ ++ E   +  +G YR G D + D+A+ ++  I DFL 
Sbjct: 360 RVMSQIVPYDHSQAAGRLRRLLAKYNEVETLVQVGEYRQGSDAVADEAIDRIDAIRDFLS 419

Query: 419 QSPSDLSS-EDVFQEIT 434
           Q    LS+ E+  + +T
Sbjct: 420 QPTDQLSAYENTLELLT 436


>gi|120554911|ref|YP_959262.1| flagellum-specific ATP synthase [Marinobacter aquaeolei VT8]
 gi|120324760|gb|ABM19075.1| flagellar protein export ATPase FliI [Marinobacter aquaeolei VT8]
          Length = 463

 Score =  285 bits (730), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 155/391 (39%), Positives = 230/391 (58%), Gaps = 4/391 (1%)

Query: 32  VYYTVTCLSQYVCLGDFVVHQGKNSDNL-GQVIRINLDIVYICPVGIGEEISLGDLVFHW 90
           V  T+ C+   + +GD  + QG ++ ++  +V+    D VY+ P+   E +  G  V   
Sbjct: 32  VGLTLECVGCPMVVGDRCLIQGDSATSVEAEVVGFEEDKVYLMPLTAIEGLKPGARVIPL 91

Query: 91  GRF-RISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGI 149
               R+       GRV+N  G P+DG   L + +  +++   +   +NR  V +    GI
Sbjct: 92  ASASRVPVGPQMLGRVVNGAGDPLDGKGPL-QAEARVQLTGDIINPLNRAPVRQSMDVGI 150

Query: 150 RVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDY 209
           R I+    +  GQR+G+FAGSG+GKS LL M  R    D  ++ L+GERGREV+EFIED 
Sbjct: 151 RAINALLTVGQGQRLGLFAGSGVGKSMLLGMMTRFTDADITVVGLIGERGREVKEFIEDI 210

Query: 210 LGDN-LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIRE 268
           LGD  L +SVVV A +D+SP++R  A +    IAEY+  +G  VLL++DS+TR+A + RE
Sbjct: 211 LGDEGLARSVVVAAPADDSPLMRLRAAMLTTRIAEYYRDQGKRVLLLMDSLTRYAQAQRE 270

Query: 269 IATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSV 328
           IA   GE P  +GYP SVF++LP+L+ER G      G+ITA  +VL +GD+  DPIAD+ 
Sbjct: 271 IALAVGEPPATKGYPPSVFAKLPQLVERTGNGRPGGGSITAFYTVLTEGDDQQDPIADAA 330

Query: 329 RSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRD 388
           R+ILDGHIVL+R LAEEG YP +D  AS+SR+  +   ++          +  R+++ RD
Sbjct: 331 RAILDGHIVLSRRLAEEGHYPAIDVEASISRVMPQVTDSEHFSRAQRFKQVYSRYQQARD 390

Query: 389 IRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
           +  +G Y  G D   D A+  +  +  FL+Q
Sbjct: 391 LISVGAYVKGSDPETDFAIQHIGNMSQFLQQ 421


>gi|88800457|ref|ZP_01116021.1| flagellum-specific ATP synthase [Reinekea sp. MED297]
 gi|88776787|gb|EAR07998.1| flagellum-specific ATP synthase [Reinekea sp. MED297]
          Length = 486

 Score =  285 bits (730), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 154/352 (43%), Positives = 216/352 (61%), Gaps = 22/352 (6%)

Query: 72  ICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSL---GKGDLSMEI 128
           + P+ +  E+ +GD +               GRV+N  G+PIDG  +L    +  L+ E 
Sbjct: 88  VVPLEVANELVIGDELL--------------GRVVNGFGEPIDGKGALLCRAQQSLNGEY 133

Query: 129 MSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFD 188
           ++     ++R+ + +    GIR I+    +  GQR+G+FAGSG+GKS LL M  R    D
Sbjct: 134 INP----LHREPIRQPLDVGIRAINSLLTVGRGQRLGLFAGSGVGKSVLLGMMTRFTDAD 189

Query: 189 KVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSS 247
             I+ L+GERGREV+EFIE+ LGD  L +SVVV + +D++P+LR  A      IAEYF S
Sbjct: 190 ITIVGLIGERGREVKEFIEEILGDEGLARSVVVASPADDAPLLRLRAAQYTTAIAEYFRS 249

Query: 248 KGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNI 307
           +G  VLL++DS+TR+A + REIA   GE P  +GYP SVF+ LP+L+ER G +EK  G+I
Sbjct: 250 QGKTVLLLMDSLTRYAQAQREIALAIGEPPATKGYPPSVFARLPQLVERAGNAEKGGGSI 309

Query: 308 TAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSA 367
           TA  +VL +GD+  DPIADS R+ILDGH VLNR LAEEG YP +D   S+SR+  +  S 
Sbjct: 310 TAFYTVLTEGDDQQDPIADSSRAILDGHFVLNRKLAEEGHYPAIDIEQSISRVMPQVVSE 369

Query: 368 DEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
           D  K   +   L   + + RD+  IG Y  G +  +D+A+   PII DFL+Q
Sbjct: 370 DHLKAAQATKQLWSTYSQNRDLISIGAYTKGSNQEIDQAIALQPIIRDFLRQ 421


>gi|294625830|ref|ZP_06704446.1| type III secretion system ATPase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292599858|gb|EFF43979.1| type III secretion system ATPase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 448

 Score =  285 bits (729), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 161/376 (42%), Positives = 225/376 (59%), Gaps = 11/376 (2%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISP-SACWCGRVINALGKPIDGDDSL 119
           +V+  + D+  + P G    +S    V   GR    P      GRV++ LG+P DG  ++
Sbjct: 63  EVVGFSRDLALLAPFGELVGLSRETRVIGLGRPLAVPVGPALLGRVLDGLGEPSDGQGAI 122

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
              D  + I ++ P  M R+ +E+   TG+R++D  T L  GQR+G+FA +G+GKSTL+ 
Sbjct: 123 AC-DTWVPIQAQAPDPMRRRLIEQPMPTGVRIVDGLTTLGEGQRMGIFAAAGVGKSTLMG 181

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTA 238
           MFAR    D  +I L+GERGREVREFIE  LG D L +SVVV ATSD S I R  A    
Sbjct: 182 MFARGTQCDVNVIVLIGERGREVREFIELILGADGLARSVVVCATSDRSSIERAKAAYVG 241

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
             IAEYF  +G  VLL++DS+TRFA + REI   +GE P  RG+P SVF+ELPRLLER G
Sbjct: 242 TAIAEYFRDRGLRVLLMMDSLTRFARAQREIGLAAGEPPTRRGFPPSVFAELPRLLERAG 301

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
               E G+ITA  +VL + D  +DPIA+ VR ILDGH++L+R +A + +YP +D LAS+S
Sbjct: 302 MG--ENGSITAFYTVLAEDDTGSDPIAEEVRGILDGHLILSREIAAKNQYPAIDVLASLS 359

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQV------PI 412
           R+  +   +D  +    L  L+ ++ E   +  +G YR G D + D+A+ ++        
Sbjct: 360 RVMSQIVPSDHSQAAGQLRRLLAKYNEVETLVQVGEYRQGSDAVADEAIDRIDAIDKFDA 419

Query: 413 IYDFLKQSPSDLSSED 428
           I DFL Q    LS+ D
Sbjct: 420 IRDFLSQPTDQLSAYD 435


>gi|88858105|ref|ZP_01132747.1| flagellum-specific ATP synthase [Pseudoalteromonas tunicata D2]
 gi|88819722|gb|EAR29535.1| flagellum-specific ATP synthase [Pseudoalteromonas tunicata D2]
          Length = 442

 Score =  285 bits (729), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 152/362 (41%), Positives = 223/362 (61%), Gaps = 3/362 (0%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISP-SACWCGRVINALGKPIDGDDSL 119
           +V+  N D++Y+ P      +  G  V    +    P      GRV++ LG+PIDG   +
Sbjct: 61  EVVGFNGDVLYLMPNDALSGVLPGARVIPQVKEAGLPVGMSLLGRVVDGLGRPIDGLGPI 120

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
            K +  ++        + R+ + +    G+R I+    +  GQR+G+FAGSG+GKS LL 
Sbjct: 121 -KAEKKLKFAQNAINPLARRAITQPMDVGVRAINAVITVGQGQRMGLFAGSGVGKSVLLG 179

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTA 238
           M  R    D +++ LVGERGREV+EFIE+ LGD   K+SVVV A +D SP++R     TA
Sbjct: 180 MMTRGTSADVIVVGLVGERGREVKEFIEEILGDEGRKRSVVVAAPADASPLMRLKGCETA 239

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
           VTIAEYF  +G NVLL+LDS+TR+A + REIA   GE P  +GYP SVF++LP L+ER G
Sbjct: 240 VTIAEYFRDQGLNVLLLLDSVTRYAMAQREIALAVGEPPATKGYPPSVFAKLPALVERAG 299

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
              K +G+ITA  +VL +GD+  DPIAD+ R+ILDGHIVL+R LA+ G YP +D   S+S
Sbjct: 300 NGGKGQGSITAFFTVLSEGDDMQDPIADAARAILDGHIVLSRELADSGHYPAIDIEKSIS 359

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+  +  S    +    L  +   +++ +D+  +G Y+ G D ILDK++  +P++  FL+
Sbjct: 360 RVMPQVVSEAHMQQARVLKQVYSLYQQNKDLITLGAYQKGADPILDKSISMMPMVNGFLQ 419

Query: 419 QS 420
           Q+
Sbjct: 420 QT 421


>gi|153934199|ref|YP_001384903.1| flagellar protein export ATPase FliI [Clostridium botulinum A str.
           ATCC 19397]
 gi|153936379|ref|YP_001388372.1| flagellar protein export ATPase FliI [Clostridium botulinum A str.
           Hall]
 gi|152930243|gb|ABS35743.1| flagellar protein export ATPase FliI [Clostridium botulinum A str.
           ATCC 19397]
 gi|152932293|gb|ABS37792.1| flagellar protein export ATPase FliI [Clostridium botulinum A str.
           Hall]
          Length = 438

 Score =  285 bits (729), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 168/392 (42%), Positives = 239/392 (60%), Gaps = 9/392 (2%)

Query: 49  VVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVIN 107
           +++  KN     +V+    + V + P+G    I+ G  V   G+   +  S    G+V++
Sbjct: 49  IIYNEKNQTIPCEVVGFKEENVILMPLGELIGIAPGCKVIPQGKPLSVICSENILGKVLD 108

Query: 108 ALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVF 167
            LG P++G++ +     +++  S  P  M R+R++    TGI+ ID F  +  GQRIG+F
Sbjct: 109 GLGNPLEGEELMEGSPYALD--SDPPDPMKRRRIKDVIPTGIKAIDGFITVGEGQRIGIF 166

Query: 168 AGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDE 226
           AGSG+GKST L M A+    D  +I+L+GERGREVR+FIE  LG+  LKKSV+V ATSD+
Sbjct: 167 AGSGVGKSTTLGMIAKYAEADINVIALIGERGREVRDFIEKDLGEEGLKKSVIVCATSDK 226

Query: 227 SPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSV 286
             ++R     TA  IAEYF  +G  V+L++DS+TRFA + REI    GE P  +GY  SV
Sbjct: 227 PALVRLKGAFTATAIAEYFRDQGKKVILMMDSVTRFAMAQREIGLAIGEPPATKGYTPSV 286

Query: 287 FSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEG 346
           F++LPRL+ER G S K  G+ITA  +VLVDGD+ N+PIAD+VR ILDGHIVL+RSLA + 
Sbjct: 287 FAKLPRLMERTGMSNK--GSITAFYTVLVDGDDFNEPIADAVRGILDGHIVLSRSLAAKN 344

Query: 347 RYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKA 406
            YP +D L+SVSRL  +  S + K        L+  ++ + D+  IG Y  G +  +D A
Sbjct: 345 HYPAIDILSSVSRLMSEIASKEHKNAAGVARDLLATYKNSEDLINIGAYVKGSNPKVDMA 404

Query: 407 VHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
           +H    I  FLKQ    +S +  F+E T  LQ
Sbjct: 405 IHYHESILSFLKQG---ISEQHSFEESTSILQ 433


>gi|294679037|ref|YP_003579652.1| flagellar protein export ATPase FliI [Rhodobacter capsulatus SB
           1003]
 gi|294477857|gb|ADE87245.1| flagellar protein export ATPase FliI [Rhodobacter capsulatus SB
           1003]
          Length = 440

 Score =  285 bits (729), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 156/402 (38%), Positives = 238/402 (59%), Gaps = 3/402 (0%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLG-QVIRINLDIVYICPVGIGEEIS 82
           G +  +      V+ L+    LGD      ++    G +VI +    V +      E ++
Sbjct: 23  GRVFEVGKGTIEVSGLTTRATLGDRARIHAQSGPVFGAEVIALRRGAVTLLADCAVEGVA 82

Query: 83  LGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVE 142
           +GD V   G+  I+P   W GR+++  G+P+DG   L +G     I +  PPA  R+R+ 
Sbjct: 83  IGDRVEVLGQAGIAPDDSWIGRIVDPFGRPLDGRPLL-RGGHDRNIRATPPPAAFRRRLG 141

Query: 143 KGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREV 202
           +  +TG+   +   PL  GQRIG+FAGSG+GKS+LL+ FA+    D V+I+L+GERGRE+
Sbjct: 142 ERVETGLDAFNTLLPLVRGQRIGLFAGSGVGKSSLLAKFAKGVAADVVVIALIGERGREL 201

Query: 203 REFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITR 261
           REF+E  LG + + +SV+V ATSD+SP++R+     A+T+AEYF  +G +VL + DS+TR
Sbjct: 202 REFVEKTLGPEGMARSVIVAATSDQSPLVRRRCGWAAMTVAEYFRDQGKHVLFLADSVTR 261

Query: 262 FAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHN 321
           FA + RE+A  +GE P  RGYP S   ++  L ER GP  +  G+ITAV SVLV G +  
Sbjct: 262 FAEAHREVALAAGEPPSLRGYPPSTSHQIMSLAERSGPGMEGAGDITAVFSVLVAGSDME 321

Query: 322 DPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIH 381
           +P+AD +R  LDGH+VL+R +AE GR+P +D L SVSR   +A +  E +L++    L+ 
Sbjct: 322 EPVADILRGTLDGHVVLDRGIAERGRFPAIDLLRSVSRSLPEAATPAENELIAKARKLLG 381

Query: 382 RFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSD 423
            ++    +   G Y  G D ++D A+   P +  FL +  +D
Sbjct: 382 AYDRAEMMIQAGLYAAGSDPVIDAAIKVWPALDGFLARDAAD 423


>gi|256376470|ref|YP_003100130.1| ATPase, FliI/YscN family [Actinosynnema mirum DSM 43827]
 gi|255920773|gb|ACU36284.1| ATPase, FliI/YscN family [Actinosynnema mirum DSM 43827]
          Length = 439

 Score =  285 bits (729), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 150/338 (44%), Positives = 221/338 (65%), Gaps = 5/338 (1%)

Query: 103 GRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQ 162
           GRV++ LG+P+DG   L  G  S+ +    P A+ RQ ++K  + G+R +D   P   GQ
Sbjct: 100 GRVLDGLGRPMDGGPPL-VGLESVTVDMTPPSALQRQLIDKPLQLGVRALDTMVPCGQGQ 158

Query: 163 RIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVV 221
           RIG+FAGSG+GKS+LLSM  R    +  +++L+GERGREVREFIE+ LG + L +SVVVV
Sbjct: 159 RIGIFAGSGVGKSSLLSMITRGTEAEITVVALIGERGREVREFIENDLGPEGLARSVVVV 218

Query: 222 ATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARG 281
           ATSD+ P++R  A   A  IAE++  +G N LL++DS+TR A + RE+  ++GE P  RG
Sbjct: 219 ATSDQPPMVRLRAGFVATRIAEWYRDRGANALLMMDSLTRIAMAQREVGLSAGEPPATRG 278

Query: 282 YPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRS 341
           +P SVF+ +P LLER GP+E+  G+IT + +VLV+GD+HN+PIAD+ RSILDGH+VL+R 
Sbjct: 279 FPPSVFALMPTLLERAGPAER--GSITGLYTVLVEGDDHNEPIADTARSILDGHVVLDRR 336

Query: 342 LAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDL 401
           LA  G +P +D L SVSR+     + +++   + L  L+    + R++  IG Y  G +L
Sbjct: 337 LATSGHFPSIDVLESVSRVTGAVTTPEQRADAAQLRRLLAARRDVRELVEIGAYVGGTNL 396

Query: 402 ILDKAVHQVPIIYDFLKQS-PSDLSSEDVFQEITKKLQ 438
             D+A+   P I   L Q   +  S+E  ++E+ + L 
Sbjct: 397 DADRAMALEPRINGLLTQDIHARTSAESSWEELRELLH 434


>gi|260886634|ref|ZP_05897897.1| flagellar protein export ATPase FliI [Selenomonas sputigena ATCC
           35185]
 gi|330839534|ref|YP_004414114.1| ATPase, FliI/YscN family [Selenomonas sputigena ATCC 35185]
 gi|260863777|gb|EEX78277.1| flagellar protein export ATPase FliI [Selenomonas sputigena ATCC
           35185]
 gi|329747298|gb|AEC00655.1| ATPase, FliI/YscN family [Selenomonas sputigena ATCC 35185]
          Length = 475

 Score =  285 bits (728), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 168/375 (44%), Positives = 231/375 (61%), Gaps = 16/375 (4%)

Query: 70  VYICPVGIGEEISLG-DLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDL---- 124
           V + P+G  + I  G ++V      ++       GRV++ LG+PIDG     KG L    
Sbjct: 109 VLLMPIGEMQGIGPGCEVVSAQKTLQVQVGPELLGRVLDGLGEPIDG-----KGPLLCKH 163

Query: 125 SMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARS 184
              + +  P  + R R+      G+R ID    L  GQRIG+ AGSG+GKSTLLSM AR+
Sbjct: 164 EYPLQADPPSPLERPRIRDSLYVGVRAIDGLITLGDGQRIGIMAGSGVGKSTLLSMIARN 223

Query: 185 DCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPLTAVTIAE 243
              D  +I+LVGERGREV+EFIE  LG+  LK+SVVVVATSD+  ++R    +TA  IAE
Sbjct: 224 TEADISVIALVGERGREVKEFIERDLGEEGLKRSVVVVATSDKPALVRIKGAMTATAIAE 283

Query: 244 YFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKE 303
           YF  +G  V+L++DS+TRFA + RE+    GE P  RGY  SVF+ LPRLLER G S K 
Sbjct: 284 YFRDQGKRVVLMMDSVTRFAMAQREVGLTIGEPPATRGYTPSVFALLPRLLERAGTSRK- 342

Query: 304 KGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADK 363
            G+IT + +VLVDGD+ N+PIAD+VRSILDGHIVL+R++A +  +P +D LASVSR+ ++
Sbjct: 343 -GSITGIYTVLVDGDDMNEPIADAVRSILDGHIVLSRAIAAQNHFPAIDVLASVSRVMNE 401

Query: 364 AWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSD 423
                  K   +L  L+  ++E  D+  IG Y  G    +D AV ++  I DFL+Q   +
Sbjct: 402 VVDEAHLKASQNLRALMAVYKEAEDLIHIGAYVKGSSQKIDTAVAKIDAINDFLRQGVFE 461

Query: 424 LSSEDVFQEITKKLQ 438
            SS   ++E  K L+
Sbjct: 462 QSS---YEETEKTLE 473


>gi|281412275|ref|YP_003346354.1| flagellar protein export ATPase FliI [Thermotoga naphthophila
           RKU-10]
 gi|281373378|gb|ADA66940.1| flagellar protein export ATPase FliI [Thermotoga naphthophila
           RKU-10]
          Length = 438

 Score =  285 bits (728), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 166/390 (42%), Positives = 243/390 (62%), Gaps = 11/390 (2%)

Query: 50  VHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINA 108
           +  GKN+  L +V+    + V + P      + +G  V    +   +  S    GRV + 
Sbjct: 49  LQNGKNA--LAEVVGFREESVILMPYEDVSGLKMGCEVIRTNKVLEVGVSRKMIGRVFDG 106

Query: 109 LGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFA 168
           LG+PIDG   + +      + +  P  + R+R++     GIR ID    +  GQRIG+FA
Sbjct: 107 LGRPIDGKPFVPED--RYPLTNNPPNPLKRRRIKDPLPVGIRSIDGLITVGKGQRIGIFA 164

Query: 169 GSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDES 227
           GSG+GKSTLL M AR+   D  +++L+GERGREVREFIE  LG+  LK+S++VV+TSD+ 
Sbjct: 165 GSGVGKSTLLGMIARNTTADVNVLALIGERGREVREFIERDLGEEGLKRSILVVSTSDQP 224

Query: 228 PILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVF 287
            + R  + LTA +IAE+F   G +VLL++DS+TR+A + RE+    GE P  RGYP SVF
Sbjct: 225 ALARVKSLLTATSIAEFFRDLGYDVLLMVDSLTRWAMAQREVGLAVGEPPTTRGYPPSVF 284

Query: 288 SELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGR 347
           + LP++LER G S+K  G+ITA+ +VLV+ D+ N+PI+D+VRSI+DGHI+L+R LAE   
Sbjct: 285 AGLPKILERAGNSDK--GSITAIYTVLVEADDFNEPISDTVRSIVDGHIILSRRLAESNH 342

Query: 348 YPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAV 407
           YP VD LASVSRL +   + + ++  + L  L+  +E  +D+  IG Y+ G + ++DKAV
Sbjct: 343 YPAVDVLASVSRLMNDIVTEEHREAANRLRSLMSAYESAKDLIEIGAYKSGTNPLVDKAV 402

Query: 408 HQVPIIYDFLKQSPSDLSSEDVFQEITKKL 437
                I  FLKQ   + SS   F+E  +KL
Sbjct: 403 EMKDEIDSFLKQGVFEKSS---FEETLQKL 429


>gi|255099418|ref|ZP_05328395.1| flagellum-specific ATP synthase [Clostridium difficile QCD-63q42]
          Length = 439

 Score =  285 bits (728), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 157/348 (45%), Positives = 224/348 (64%), Gaps = 13/348 (3%)

Query: 97  PSACWC-----GRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRV 151
           P +  C     G+V++ LG PID  D++  GD    + ++ P  M R+++    +TG+R 
Sbjct: 95  PLSVMCSDNLLGKVLDGLGNPIDNSDAV-LGD-RYNLNNEPPDPMKRKKIRNIMETGVRA 152

Query: 152 IDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG 211
           ID FT    GQRIG+FAGSG+GKST L M AR+   D  +I+L+GERGREV +FI+  LG
Sbjct: 153 IDAFTTCGEGQRIGIFAGSGVGKSTTLGMIARNAKADVNVIALIGERGREVLDFIDKDLG 212

Query: 212 DN-LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIA 270
           +  +KKSVVV ATSD++P++R    LTA  IAEYF  +G  V+L++DS+TRFA + RE+ 
Sbjct: 213 EEGMKKSVVVYATSDKAPLVRLKGALTATAIAEYFRDQGKKVILMMDSVTRFAMAQREVG 272

Query: 271 TNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRS 330
              GE P  +GY  SVF+ LP+L+ER G S+K  G+ITA  +VLVDGD+ N+PIAD+ R 
Sbjct: 273 VAIGEPPAQKGYTPSVFAILPKLMERTGTSDK--GSITAFYTVLVDGDDFNEPIADTTRG 330

Query: 331 ILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIR 390
           ILDGHIVL+R LA +  YP +D L S+SRL ++  S ++ K+ S    ++  + E  D+ 
Sbjct: 331 ILDGHIVLSRDLANKNHYPSIDVLNSLSRLMNEIASKEDIKIASFARDMLAEYREAEDLI 390

Query: 391 LIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
            IG Y  G +  +D+A++    I +FLKQ  ++ SS   F E    L+
Sbjct: 391 NIGAYASGTNKKIDEAIYYHEHIINFLKQGINEKSS---FNETISSLR 435


>gi|327399350|ref|YP_004340219.1| ATPase, FliI/YscN family [Hippea maritima DSM 10411]
 gi|327181979|gb|AEA34160.1| ATPase, FliI/YscN family [Hippea maritima DSM 10411]
          Length = 434

 Score =  285 bits (728), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 175/421 (41%), Positives = 249/421 (59%), Gaps = 15/421 (3%)

Query: 18  NLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGI 77
           NL+V  G I  +  +    T   + V +GD    +        +V+  + D V + P+G+
Sbjct: 15  NLIVTYGRIKKVAGITIKSTG-PKNVKIGDVCKIETDEGWIDSEVVGFDEDGVVLMPLGV 73

Query: 78  GEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSLGKGDLSME----IMSKV 132
            + +    LV   GR   +  S    GRV+NALG+PIDG     KG + +E    +  K 
Sbjct: 74  LDGVKSLSLVKSEGRGLSVPVSERLLGRVVNALGRPIDG-----KGPIPVEEYYPVYPKP 128

Query: 133 PPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVII 192
            P + RQ +++    G++ ID    +  GQR+G+FAGSG+GKSTLL M AR+   D  +I
Sbjct: 129 VPPLERQIIKEPLSLGVKAIDGLLTIGKGQRVGIFAGSGVGKSTLLGMIARNSSADVNVI 188

Query: 193 SLVGERGREVREFIE-DYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDN 251
           +L+GERGREVREFIE D   + LK+SVVVVATSDE+ +LR+     A +IAE+F  +G N
Sbjct: 189 ALIGERGREVREFIERDLKEEGLKRSVVVVATSDEASLLRREGAFVATSIAEFFKDRGAN 248

Query: 252 VLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVI 311
           V+L++DS TRFA + REI    GE P  +GY  SVF+ LPRL+ER G     KG+ITA+ 
Sbjct: 249 VMLMMDSATRFAMAQREIGLAVGEPPTTKGYTPSVFTLLPRLMERAG--NFNKGSITAIY 306

Query: 312 SVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKK 371
           +VLVDGD+  +PIAD+ RSILDGHIVL+R +AE GRYP VD L S+SRL     + + K+
Sbjct: 307 TVLVDGDDLMEPIADASRSILDGHIVLSRKIAERGRYPAVDVLRSISRLMSSITTDEHKE 366

Query: 372 LVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSD-LSSEDVF 430
           L   +  ++  + +  D+  IG Y  G +  +D+A+  +  +  FL Q   +  S ED  
Sbjct: 367 LALKIRKVLSVYADAEDLINIGAYVKGSNKDIDEAIKYIDKVEGFLAQKIEESFSFEDTL 426

Query: 431 Q 431
            
Sbjct: 427 N 427


>gi|149182506|ref|ZP_01860979.1| flagellum-specific ATP synthase [Bacillus sp. SG-1]
 gi|148849766|gb|EDL63943.1| flagellum-specific ATP synthase [Bacillus sp. SG-1]
          Length = 440

 Score =  285 bits (728), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 161/362 (44%), Positives = 225/362 (62%), Gaps = 7/362 (1%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSL 119
           +V+    + V + P     EIS G LV    +   I       G+V+++LG P+DG+ SL
Sbjct: 57  EVVGFKEETVILMPYSNINEISPGSLVEATSKPLTIKVGHSLIGKVVDSLGNPLDGE-SL 115

Query: 120 GKGDLSMEIMSKVPPA-MNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLL 178
            KG L+     + PP+ + R  + +  + G+R ID    +  GQR+G+FAGSG+GKSTLL
Sbjct: 116 PKG-LTPAFTEQDPPSPLTRPPINEKIEVGVRAIDSMLTVGKGQRVGIFAGSGVGKSTLL 174

Query: 179 SMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPLT 237
            M AR+   D  +I+L+GERGREVREFIE  LG+  LKKS+VV ATSD+  ++R     T
Sbjct: 175 GMIARNTTADLNVIALIGERGREVREFIERDLGEEGLKKSIVVAATSDQPALMRIKGAFT 234

Query: 238 AVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERI 297
           A  IAEYF  KG NV+L++DS+TR A + REI    GE P  +GY  SVF+ LP+LLER 
Sbjct: 235 ATAIAEYFRDKGMNVMLMMDSVTRVAMAQREIGLAVGEPPATKGYTPSVFAILPKLLERT 294

Query: 298 GPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASV 357
           G +E   G ITA  +VLVDGD+ N+PIAD+ R ILDGHIVL+R++A +G++P ++ L SV
Sbjct: 295 GTNEH--GTITAFYTVLVDGDDMNEPIADTTRGILDGHIVLDRNIANKGQFPAINVLRSV 352

Query: 358 SRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFL 417
           SRL +   S D  +    +  L+  +  + D+  IG Y+ G    +D+A+   P I  FL
Sbjct: 353 SRLMNHLASPDHLRAAEKIRELMSTYSNSEDLINIGAYKKGTSQEIDQAITYQPKILSFL 412

Query: 418 KQ 419
           KQ
Sbjct: 413 KQ 414


>gi|254973915|ref|ZP_05270387.1| flagellum-specific ATP synthase [Clostridium difficile QCD-66c26]
 gi|255091301|ref|ZP_05320779.1| flagellum-specific ATP synthase [Clostridium difficile CIP 107932]
 gi|255312959|ref|ZP_05354542.1| flagellum-specific ATP synthase [Clostridium difficile QCD-76w55]
 gi|255515718|ref|ZP_05383394.1| flagellum-specific ATP synthase [Clostridium difficile QCD-97b34]
 gi|255648812|ref|ZP_05395714.1| flagellum-specific ATP synthase [Clostridium difficile QCD-37x79]
 gi|260682031|ref|YP_003213316.1| flagellum-specific ATP synthase [Clostridium difficile CD196]
 gi|260685629|ref|YP_003216762.1| flagellum-specific ATP synthase [Clostridium difficile R20291]
 gi|306518927|ref|ZP_07405274.1| flagellum-specific ATP synthase [Clostridium difficile QCD-32g58]
 gi|260208194|emb|CBA60534.1| flagellum-specific ATP synthase [Clostridium difficile CD196]
 gi|260211645|emb|CBE01900.1| flagellum-specific ATP synthase [Clostridium difficile R20291]
          Length = 439

 Score =  285 bits (728), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 157/348 (45%), Positives = 224/348 (64%), Gaps = 13/348 (3%)

Query: 97  PSACWC-----GRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRV 151
           P +  C     G+V++ LG PID  D++  GD    + ++ P  M R+++    +TG+R 
Sbjct: 95  PLSVMCSDNLLGKVLDGLGNPIDNSDAV-LGD-RYNLNNEPPDPMKRKKIRNIMETGVRA 152

Query: 152 IDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG 211
           ID FT    GQRIG+FAGSG+GKST L M AR+   D  +I+L+GERGREV +FI+  LG
Sbjct: 153 IDAFTTCGEGQRIGIFAGSGVGKSTTLGMIARNAKADVNVIALIGERGREVLDFIDKDLG 212

Query: 212 DN-LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIA 270
           +  +KKSVVV ATSD++P++R    LTA  IAEYF  +G  V+L++DS+TRFA + RE+ 
Sbjct: 213 EEGMKKSVVVCATSDKAPLVRLKGALTATAIAEYFRDQGKKVILMMDSVTRFAMAQREVG 272

Query: 271 TNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRS 330
              GE P  +GY  SVF+ LP+L+ER G S+K  G+ITA  +VLVDGD+ N+PIAD+ R 
Sbjct: 273 IAIGEPPAQKGYTPSVFAILPKLMERTGTSDK--GSITAFYTVLVDGDDFNEPIADTTRG 330

Query: 331 ILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIR 390
           ILDGHIVL+R LA +  YP +D L S+SRL ++  S ++ K+ S    ++  + E  D+ 
Sbjct: 331 ILDGHIVLSRDLANKNHYPSIDVLNSLSRLMNEIASKEDIKIASFARDMLAEYREAEDLI 390

Query: 391 LIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
            IG Y  G +  +D+A++    I +FLKQ  ++ SS   F E    L+
Sbjct: 391 NIGAYASGTNKKIDEAIYYHEHIINFLKQGINEKSS---FNETISSLR 435


>gi|255305275|ref|ZP_05349447.1| flagellum-specific ATP synthase [Clostridium difficile ATCC 43255]
          Length = 439

 Score =  285 bits (728), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 157/348 (45%), Positives = 224/348 (64%), Gaps = 13/348 (3%)

Query: 97  PSACWC-----GRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRV 151
           P +  C     G+V++ LG PID  D++  GD    + ++ P  M R+++    +TG+R 
Sbjct: 95  PLSVMCSDNLLGKVLDGLGNPIDNSDAV-LGD-RYNLNNEPPDPMKRKKIRNIMETGVRA 152

Query: 152 IDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG 211
           ID FT    GQRIG+FAGSG+GKST L M AR+   D  +I+L+GERGREV +FI+  LG
Sbjct: 153 IDAFTTCGEGQRIGIFAGSGVGKSTTLGMIARNAKADVNVIALIGERGREVLDFIDKDLG 212

Query: 212 DN-LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIA 270
           +  +KKSVVV ATSD++P++R    LTA  IAEYF  +G  V+L++DS+TRFA + RE+ 
Sbjct: 213 EEGMKKSVVVCATSDKAPLVRLKGALTATAIAEYFRDQGKKVILMMDSVTRFAMAQREVG 272

Query: 271 TNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRS 330
              GE P  +GY  SVF+ LP+L+ER G S+K  G+ITA  +VLVDGD+ N+PIAD+ R 
Sbjct: 273 IAIGEPPAQKGYTPSVFAILPKLMERTGTSDK--GSITAFYTVLVDGDDFNEPIADTTRG 330

Query: 331 ILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIR 390
           ILDGHIVL+R LA +  YP +D L S+SRL ++  S ++ K+ S    ++  + E  D+ 
Sbjct: 331 ILDGHIVLSRDLANKNHYPSIDVLNSLSRLMNEIASKEDIKIASFARDMLAEYREAEDLI 390

Query: 391 LIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
            IG Y  G +  +D+A++    I +FLKQ  ++ SS   F E    L+
Sbjct: 391 NIGAYASGTNKKIDEAIYYHEHIINFLKQGINEKSS---FNETISSLR 435


>gi|238927415|ref|ZP_04659175.1| H(+)-transporting two-sector ATPase [Selenomonas flueggei ATCC
           43531]
 gi|238884697|gb|EEQ48335.1| H(+)-transporting two-sector ATPase [Selenomonas flueggei ATCC
           43531]
          Length = 457

 Score =  285 bits (728), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 165/371 (44%), Positives = 228/371 (61%), Gaps = 11/371 (2%)

Query: 70  VYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDS-LGKGDLSME 127
           V + PVG  + I  G  V   GR  R+       GRV++ LG PIDG    L K +  ++
Sbjct: 80  VLLMPVGEMQGIGPGCEVVATGRRLRVKVGMELLGRVLDGLGNPIDGKGPILAKEEYPLQ 139

Query: 128 IMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCF 187
                PP + R R+      G+R ID    L  GQRIG+ AGSG+GKSTLLSM AR+   
Sbjct: 140 ---APPPPLTRPRIHDNLYVGVRAIDGLITLGDGQRIGIMAGSGVGKSTLLSMIARNTEA 196

Query: 188 DKVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFS 246
           D  +I+LVGERGREVR+FIE  LG+  LK+SVVVVATSD+  ++R    +T   IAEYF 
Sbjct: 197 DISVITLVGERGREVRDFIERDLGEEGLKRSVVVVATSDQPALVRIKGAMTGTAIAEYFR 256

Query: 247 SKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGN 306
            +G  V+L++DS+TRFA + RE+    GE P  RGY  SVF+ LPRLLER G S  EKG+
Sbjct: 257 DQGRRVVLMMDSVTRFAMAQREVGLTIGEPPATRGYTPSVFAMLPRLLERAGTS--EKGS 314

Query: 307 ITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWS 366
           IT + +VLVDGD+ N+PIAD+VRSILDGHIVL+R +A +  +P +D L+SVSR+  +   
Sbjct: 315 ITGIYTVLVDGDDMNEPIADAVRSILDGHIVLSRRIAAQNHFPAIDVLSSVSRVMYEVVE 374

Query: 367 ADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
               +    +  L+  ++E  D+  IG Y  G    +D A+ ++  I +FL Q   +++S
Sbjct: 375 KRHLEAAQEMRQLMAVYQEAEDLIHIGAYVKGSSPKIDAAIQKIDGINEFLCQGIYEVTS 434

Query: 427 EDVFQEITKKL 437
              ++E  ++L
Sbjct: 435 ---YEETEQRL 442


>gi|51894136|ref|YP_076827.1| flagellar-specific ATP synthase [Symbiobacterium thermophilum IAM
           14863]
 gi|51857825|dbj|BAD41983.1| flagellar-specific ATP synthase [Symbiobacterium thermophilum IAM
           14863]
          Length = 436

 Score =  285 bits (728), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 164/378 (43%), Positives = 231/378 (61%), Gaps = 7/378 (1%)

Query: 52  QGKNSDNLGQVIRINLDIVYICPVGIGEEISLG-DLVFHWGRFRISPSACWCGRVINALG 110
           QG       +V+    D + + P+G  + +  G D++   G  +        GRVI+ LG
Sbjct: 46  QGDGRRVPAEVVGFREDRLLLMPLGETDGLRPGWDVIATGGPLQAPVGMGLLGRVIDGLG 105

Query: 111 KPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGS 170
            PID    L  G     I+   P  + RQR+ +    G+R +D    +  GQRIG+FAGS
Sbjct: 106 NPIDDKGPL-MGCGFRPILGPAPDPLARQRIHRPLSLGVRALDALITVGMGQRIGIFAGS 164

Query: 171 GIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATSDESPI 229
           G+GKSTLL M AR+   D  +I+LVGERGREVREFIE  LG+  L++SVVVVATS++  +
Sbjct: 165 GVGKSTLLGMVARATAADCNVIALVGERGREVREFIEKDLGEEGLRRSVVVVATSEQPSL 224

Query: 230 LRKMAPLTAVTIAEYF-SSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFS 288
           +R  A L A  IAEYF  + G +V+L++DS+TR AH+ RE+    GE P  RGY  SVF+
Sbjct: 225 VRIRAALMATAIAEYFRDAHGLDVILMMDSVTRLAHAQREVGLAVGEPPATRGYTPSVFA 284

Query: 289 ELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRY 348
            LPR+LER G      G++T V +VLVDGD+ N+P+AD+VRSILDGH+VL+R LA  G Y
Sbjct: 285 MLPRVLERSG--TGPAGSVTGVYTVLVDGDDMNEPVADAVRSILDGHVVLSRKLANAGHY 342

Query: 349 PPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVH 408
           P +DPL SVSR+     + + +K    L  L+  ++E  D+  IG Y+ G + ++D+A+ 
Sbjct: 343 PAIDPLQSVSRVMPDVTTPEHRKQAQRLRALLSAYQEAEDLIQIGAYQQGTNPLVDEALA 402

Query: 409 QVPIIYDFLKQSPSDLSS 426
           ++  I  FL Q P+D  S
Sbjct: 403 KMDQIKRFLIQ-PADQPS 419


>gi|332981434|ref|YP_004462875.1| type III secretion system ATPase, FliI/YscN [Mahella australiensis
           50-1 BON]
 gi|332699112|gb|AEE96053.1| type III secretion system ATPase, FliI/YscN [Mahella australiensis
           50-1 BON]
          Length = 435

 Score =  285 bits (728), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 158/372 (42%), Positives = 226/372 (60%), Gaps = 4/372 (1%)

Query: 49  VVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSA-CWCGRVIN 107
           ++ Q  +   + +V+    + + + P+G  + I  G  V         P+     GRV++
Sbjct: 46  ILSQDGSISAIAEVVGFREERMLLMPLGNVKGIGPGSTVIAMNTSLTVPAGPGLLGRVLD 105

Query: 108 ALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVF 167
            LG+P+D    L   D+  ++    P  + RQR+ +    GI+ ID      +GQR+GVF
Sbjct: 106 GLGRPMDSAGPLA-ADMYYDVEKDPPDPLTRQRICEPIVLGIKAIDGLLTCGYGQRMGVF 164

Query: 168 AGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDES 227
           AGSG+GKSTL+ M AR    D  +I+L+GERGREV+EFIE  LG+ L +SV+VVATSD+ 
Sbjct: 165 AGSGVGKSTLMGMMARYASADVNVIALIGERGREVKEFIEKDLGEGLARSVLVVATSDQP 224

Query: 228 PILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVF 287
           P++R  A   A  IAEYF  +G NVLL++DS+TRFA + RE+    GE PV+RGY  SVF
Sbjct: 225 PLIRTKAAFVATAIAEYFRDQGCNVLLMMDSLTRFAMAQREVGLAIGEPPVSRGYTPSVF 284

Query: 288 SELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGR 347
           + +PRLLER G S  +KG+IT + +VLVDGD+ N+P+ D+ RSILDGHIVL+R LA    
Sbjct: 285 ATMPRLLERAGTS--DKGSITGIYTVLVDGDDFNEPVTDNARSILDGHIVLSRELANRNH 342

Query: 348 YPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAV 407
           YPP+D LASVSR+     +     L S +  ++  ++   D+  IG Y  G    +D A+
Sbjct: 343 YPPIDILASVSRVMPDVVTDRHMMLASQIKKIMAVYKGAEDLINIGAYVRGSSRDIDYAI 402

Query: 408 HQVPIIYDFLKQ 419
             +  I DFL+Q
Sbjct: 403 DHIDDINDFLQQ 414


>gi|226950072|ref|YP_002805163.1| flagellar protein export ATPase FliI [Clostridium botulinum A2 str.
           Kyoto]
 gi|226843623|gb|ACO86289.1| flagellar protein export ATPase FliI [Clostridium botulinum A2 str.
           Kyoto]
          Length = 438

 Score =  285 bits (728), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 168/392 (42%), Positives = 239/392 (60%), Gaps = 9/392 (2%)

Query: 49  VVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVIN 107
           +++  KN     +V+    + V + P+G    I+ G  V   G+   +  S    G+V++
Sbjct: 49  IIYNEKNQTIPCEVVGFKEENVILMPLGELIGIAPGCKVIPQGKPLSVICSENILGKVLD 108

Query: 108 ALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVF 167
            LG P++G++ +     +++  S  P  M R+R++    TGI+ ID F  +  GQRIG+F
Sbjct: 109 GLGNPLEGEELMEGSPYALD--SDPPDPMKRRRIKDVIPTGIKAIDGFITVGEGQRIGIF 166

Query: 168 AGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDE 226
           AGSG+GKST L M A+    D  +I+L+GERGREVR+FIE  LG+  LKKSV+V ATSD+
Sbjct: 167 AGSGVGKSTTLGMIAKYAEADINVIALIGERGREVRDFIEKDLGEEGLKKSVIVCATSDK 226

Query: 227 SPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSV 286
             ++R     TA  IAEYF  +G  V+L++DS+TRFA + REI    GE P  +GY  SV
Sbjct: 227 PALVRLKGAFTATAIAEYFRDQGKKVILMMDSVTRFAMAQREIGLAIGEPPATKGYTPSV 286

Query: 287 FSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEG 346
           F++LPRL+ER G S K  G+ITA  +VLVDGD+ N+PIAD+VR ILDGHIVL+RSLA + 
Sbjct: 287 FAKLPRLMERSGMSNK--GSITAFYTVLVDGDDFNEPIADAVRGILDGHIVLSRSLAAKN 344

Query: 347 RYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKA 406
            YP +D L+SVSRL  +  S + K        L+  ++ + D+  IG Y  G +  +D A
Sbjct: 345 HYPAIDILSSVSRLMSEIASKEHKNAAGMARDLLATYKNSEDLINIGAYVKGSNPKVDMA 404

Query: 407 VHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
           +H    I  FLKQ    +S +  F+E T  LQ
Sbjct: 405 IHYHESILSFLKQG---ISEQHSFEESTSILQ 433


>gi|205373376|ref|ZP_03226180.1| flagellum-specific ATP synthase [Bacillus coahuilensis m4-4]
          Length = 441

 Score =  284 bits (727), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 157/374 (41%), Positives = 228/374 (60%), Gaps = 7/374 (1%)

Query: 50  VHQGKNSDNL--GQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVI 106
           + +GK+   +   +V+    D+V + P     +I+ G LV   G   ++       G V+
Sbjct: 47  IRKGKSGSQIIKAEVVGFQHDMVLLMPYSTISDIAPGSLVEGTGEALKVKIGKGLIGSVL 106

Query: 107 NALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGV 166
           ++LG P+DG D L KG  S  + +  P  + R  + +  + G+R ID    +  GQR+G+
Sbjct: 107 DSLGNPLDGSD-LPKGLSSTSVENMPPNPLTRPTISEPLEVGVRAIDTMLTIGKGQRVGI 165

Query: 167 FAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSD 225
           FAGSG+GKSTLL M AR+   D  II+L+GERGREVREFIE  LG + L +S+V+ ATSD
Sbjct: 166 FAGSGVGKSTLLGMIARNTKADINIIALIGERGREVREFIERDLGPEGLSRSIVIAATSD 225

Query: 226 ESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTS 285
           +  ++R     TA  IAEYF  +G NV+L++DS+TR A + RE+    GE P  +GY  S
Sbjct: 226 QPALMRIKGAFTATAIAEYFRDQGMNVMLMMDSVTRVAMAQREVGLAVGEPPATKGYTPS 285

Query: 286 VFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEE 345
           VF+ LP+LLER G +    G ITA  +VLVDGD+ N+PIAD+ R ILDGHIVL+R +A  
Sbjct: 286 VFAILPKLLERTGTNHL--GTITAFYTVLVDGDDMNEPIADTTRGILDGHIVLDREIANR 343

Query: 346 GRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDK 405
           G+YP ++ L SVSRL +       K+  + + +L+  +E++ D+  IG Y+ G    +D+
Sbjct: 344 GQYPAINILKSVSRLMNHLAENGHKESANKIRNLLSTYEKSEDLINIGAYKKGTSPEIDE 403

Query: 406 AVHQVPIIYDFLKQ 419
           A+   P I  FLKQ
Sbjct: 404 AILYFPSILSFLKQ 417


>gi|154174001|ref|YP_001407433.1| flagellum-specific ATP synthase [Campylobacter curvus 525.92]
 gi|112803229|gb|EAU00573.1| flagellar protein export ATPase FliI [Campylobacter curvus 525.92]
          Length = 435

 Score =  284 bits (727), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 171/437 (39%), Positives = 249/437 (56%), Gaps = 10/437 (2%)

Query: 4   NLETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFV--VHQGKNSDNLGQ 61
           NLE L    +    +L    G I+ IT+    +T L     +GD V  V + K+ + LG 
Sbjct: 2   NLERLNLKLKSKDLSLSNTFGIITKITATNIEITGLCP--SIGDIVRIVAKDKSKNGLGM 59

Query: 62  VIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSLG 120
           V +I     +I P G  E   +GD V+   +   I       GRV++   KP+DG  ++ 
Sbjct: 60  VTQIKSGGAFISPFGFVEGFRIGDFVYASDQGMNIPVGRNLLGRVVDPFMKPVDGKGAIE 119

Query: 121 KGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSM 180
             +  M IM     AM R  + + F  GI+ ID       GQ++G+FAGSG+GKSTL+ M
Sbjct: 120 TSEY-MPIMKAPIDAMKRGLINEPFSVGIKTIDGLLTCGKGQKLGIFAGSGVGKSTLMGM 178

Query: 181 FARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVT 240
             ++      +++L+GERGREV EFIE  LG NL  +V+VVATSD+S ++RK     A++
Sbjct: 179 IVKNTLAPIKVVALIGERGREVPEFIEKNLGGNLDGTVIVVATSDDSSLMRKYGAFCAMS 238

Query: 241 IAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPS 300
           +AEYF ++G++VL I+DS+TRFA + REI    GE P ++GYP S  + LP+L+ER G  
Sbjct: 239 VAEYFKNQGNDVLFIMDSVTRFAMAQREIGLALGEPPTSKGYPPSSLTLLPQLMERAG-K 297

Query: 301 EKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRL 360
           E+ KG+ITA  +VLV+GD+ +DPIAD  RSILDGHIVL+R L + G YPP++   S SR+
Sbjct: 298 EEGKGSITAFFTVLVEGDDMSDPIADQSRSILDGHIVLSRELTDFGIYPPINIQNSASRV 357

Query: 361 ADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQS 420
                S + ++       L    +E   +  IG Y+ G D  LD A+ +   + +FLKQ 
Sbjct: 358 MGDVISNEHRQNAMKFKRLYSLLKENEVLLRIGAYQRGSDKELDLAISKKEYMENFLKQD 417

Query: 421 PSDLSSEDVFQEITKKL 437
             ++     F+EI   L
Sbjct: 418 AQEVYK---FEEIQSLL 431


>gi|148380617|ref|YP_001255158.1| flagellar protein export ATPase FliI [Clostridium botulinum A str.
           ATCC 3502]
 gi|148290101|emb|CAL84220.1| flagellum-specific ATP synthase [Clostridium botulinum A str. ATCC
           3502]
          Length = 438

 Score =  284 bits (727), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 168/392 (42%), Positives = 239/392 (60%), Gaps = 9/392 (2%)

Query: 49  VVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVIN 107
           +++  KN     +V+    + V + P+G    I+ G  V   G+   +  S    G+V++
Sbjct: 49  IIYNEKNQTIPCEVVGFKEENVILMPLGELIGIAPGCKVIPQGKPLSVICSENILGKVLD 108

Query: 108 ALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVF 167
            LG P++G++ +     +++  S  P  M R+R++    TGI+ ID F  +  GQRIG+F
Sbjct: 109 GLGNPLEGEELMEGSPYALD--SDPPDPMKRRRIKDVIPTGIKAIDGFITVGEGQRIGIF 166

Query: 168 AGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDE 226
           AGSG+GKST L M A+    D  +I+L+GERGREVR+FIE  LG+  LKKSV+V ATSD+
Sbjct: 167 AGSGVGKSTTLGMIAKYAEADINVIALIGERGREVRDFIEKDLGEEGLKKSVIVCATSDK 226

Query: 227 SPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSV 286
             ++R     TA  IAEYF  +G  V+L++DS+TRFA + REI    GE P  +GY  SV
Sbjct: 227 PALVRLKGAFTATAIAEYFRDQGKKVILMMDSVTRFAMAQREIGLAIGEPPATKGYTPSV 286

Query: 287 FSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEG 346
           F++LPRL+ER G S K  G+ITA  +VLVDGD+ N+PIAD+VR ILDGHIVL+RSLA + 
Sbjct: 287 FAKLPRLMERSGMSNK--GSITAFYTVLVDGDDFNEPIADAVRGILDGHIVLSRSLAAKN 344

Query: 347 RYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKA 406
            YP +D L+SVSRL  +  S + K        L+  ++ + D+  IG Y  G +  +D A
Sbjct: 345 HYPAIDILSSVSRLMSEIASKEHKNAAGVARDLLATYKNSEDLINIGAYVKGSNPKVDMA 404

Query: 407 VHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
           +H    I  FLKQ    +S +  F+E T  LQ
Sbjct: 405 IHYHESILSFLKQG---ISEQHSFEESTSILQ 433


>gi|83646016|ref|YP_434451.1| type III secretion system ATPase [Hahella chejuensis KCTC 2396]
 gi|83634059|gb|ABC30026.1| Flagellar biosynthesis/type III secretory pathway ATPase [Hahella
           chejuensis KCTC 2396]
          Length = 448

 Score =  284 bits (727), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 162/363 (44%), Positives = 222/363 (61%), Gaps = 5/363 (1%)

Query: 59  LGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDD 117
           L +VI  +     + P+   E +S    V   GR   I  S    GRV++ LG PID  +
Sbjct: 68  LAEVIGFSRQEALLTPLSEMEGLSAHTEVIPTGRSHEIQISEGILGRVLDGLGAPIDDGE 127

Query: 118 SLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
            L  G +   I+S  P  + R+ VE    TG+R ID       GQR+GVFA +G+GKSTL
Sbjct: 128 PL-TGGVPYPIISASPNPLTRRLVETPMTTGVRAIDGMLTCGEGQRMGVFAAAGVGKSTL 186

Query: 178 LSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPL 236
           LSM  R    D V+I L+GERGREVR FIE  LG + ++++VVV ATSD   + R  A  
Sbjct: 187 LSMITRHTDADIVVIGLIGERGREVRGFIERDLGAEGMQRAVVVAATSDRPAMERVKAGY 246

Query: 237 TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLER 296
            A  IAE+F  +G  VLL++DS+TRFA ++REI   +GE P  RG+P +VF+ LP+LLER
Sbjct: 247 VATAIAEHFRDQGKRVLLLIDSVTRFARALREIGLAAGEPPARRGFPPTVFATLPKLLER 306

Query: 297 IGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLAS 356
            GP  K  G I+A+ +VLV+GD+  +P+AD VRSILDGHIVL+R+LAE G +P VD LAS
Sbjct: 307 AGPGAK--GAISALYTVLVEGDDMTEPVADEVRSILDGHIVLSRALAESGHFPAVDILAS 364

Query: 357 VSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDF 416
            SRL +   + ++ +    L  L+ R++E   +  IG Y+PG D + D A+  +  I  F
Sbjct: 365 SSRLMNDIATPEQLQQARRLRQLLARYKEIELLVRIGEYQPGTDPLADAAIKAIEPINQF 424

Query: 417 LKQ 419
           L+Q
Sbjct: 425 LRQ 427


>gi|118474658|ref|YP_892815.1| flagellum-specific ATP synthase [Campylobacter fetus subsp. fetus
           82-40]
 gi|261885883|ref|ZP_06009922.1| flagellum-specific ATP synthase [Campylobacter fetus subsp.
           venerealis str. Azul-94]
 gi|118413884|gb|ABK82304.1| flagellar protein export ATPase FliI [Campylobacter fetus subsp.
           fetus 82-40]
          Length = 434

 Score =  284 bits (727), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 159/403 (39%), Positives = 235/403 (58%), Gaps = 7/403 (1%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFV--VHQGKNSDNLGQVIRINLDIVYICPVGIGEEI 81
           G I+ IT+    +T L     +GD V  +    N + LG V  +N     + P G  E  
Sbjct: 21  GIITKITTNNMEITGLRP--SIGDIVRIISIDGNKNELGMVTGLNQTGASVSPFGFVEGF 78

Query: 82  SLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQR 140
            +GD V+   +   I       GRV++    P D   ++ +    + IM    PAM R  
Sbjct: 79  KIGDRVYASDQGMSIPVGESLLGRVVDPFMNPKDSKGAI-EATTYVPIMQMPIPAMKRGL 137

Query: 141 VEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGR 200
           + + F  G++ ID       GQ++G+FAGSG+GKSTL+ M  ++      +++L+GERGR
Sbjct: 138 INEPFSVGVKTIDGLLTCGKGQKLGIFAGSGVGKSTLMGMIVKNSVAPIKVVALIGERGR 197

Query: 201 EVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSIT 260
           EV EFIE  L  +L  +V++VATSD+SP++RK     A+++AEYF S G +VL I+DS+T
Sbjct: 198 EVPEFIEKNLNGDLSNTVIIVATSDDSPLMRKYGAFCAMSVAEYFKSSGRDVLFIMDSVT 257

Query: 261 RFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNH 320
           RFA + REI    GE P ++GYP SV + LP+L+ER G  E+ KG+ITA  +VLV+GD+ 
Sbjct: 258 RFAMAQREIGLALGEPPTSKGYPPSVLTILPQLMERAG-KEEGKGSITAFFTVLVEGDDM 316

Query: 321 NDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLI 380
           +DPIAD  RSILDGHIVL+R L + G YPP++ L S SR+     S + +   S    L 
Sbjct: 317 SDPIADQSRSILDGHIVLSRELTDFGIYPPINILNSASRVMGDVTSKEHRANASKFKRLF 376

Query: 381 HRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSD 423
              +E   +  IG Y+ G+D  LD A+ +   + +F+KQ+P++
Sbjct: 377 SMLKENEVLIRIGAYQKGIDKELDSAISKKGFMEEFMKQNPTE 419


>gi|239628989|ref|ZP_04672020.1| ATPase FliI/YscN [Clostridiales bacterium 1_7_47_FAA]
 gi|239519135|gb|EEQ59001.1| ATPase FliI/YscN [Clostridiales bacterium 1_7_47FAA]
          Length = 434

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 164/372 (44%), Positives = 237/372 (63%), Gaps = 9/372 (2%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWG-RFRISPSACWCGRVINALGKPIDGDDSL 119
           +V+    + V + P    E I  G  V + G R RI+ S    GR ++A+G PIDG   L
Sbjct: 57  EVVGFRENRVLLMPYEEMEGIGYGSAVRNTGERLRIAVSNQLIGRTVDAMGMPIDG---L 113

Query: 120 GK-GDLSM-EIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
           G   D+S   I  K    M R R++   + G++ ID    +  GQR+G+FAGSG+GKSTL
Sbjct: 114 GPVDDVSYYPITGKPSNPMERPRIDTIIQMGVKAIDGLLTVGKGQRMGIFAGSGVGKSTL 173

Query: 178 LSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPL 236
           + M A++   D  +I+LVGER REV EFI   LG+  LK+SV+VVATS +S ++R    +
Sbjct: 174 MGMIAKNVKADVNVIALVGERSREVVEFINRDLGEEGLKRSVLVVATSSQSAMMRSKCTM 233

Query: 237 TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLER 296
           TA TIAEYF  +G +VLL++DS+TRFA + RE+  + GE PVARGY  S++SELP+LLER
Sbjct: 234 TATTIAEYFKDQGMDVLLMMDSLTRFAMAQREVGLSIGEPPVARGYTPSIYSELPKLLER 293

Query: 297 IGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLAS 356
            G    E+G+IT + +VLV+GD+ N+PI+D+VR I+DGHI+L+R +A + RYP +D L+S
Sbjct: 294 SG--NFEEGSITGIYTVLVEGDDANEPISDTVRGIIDGHIMLSRKVAAKNRYPAIDILSS 351

Query: 357 VSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDF 416
           VSRL +   + + K+    L  L+  +E   D+  IG Y+ G +  LD+A+ ++  IY F
Sbjct: 352 VSRLMNDIVTPEHKEAAGKLRRLLAVYESNSDLVSIGAYKKGTNPELDEALERIDSIYGF 411

Query: 417 LKQSPSDLSSED 428
           L+Q   +  S D
Sbjct: 412 LQQKTDESFSLD 423


>gi|302338080|ref|YP_003803286.1| flagellar protein export ATPase FliI [Spirochaeta smaragdinae DSM
           11293]
 gi|301635265|gb|ADK80692.1| flagellar protein export ATPase FliI [Spirochaeta smaragdinae DSM
           11293]
          Length = 453

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 149/323 (46%), Positives = 213/323 (65%), Gaps = 4/323 (1%)

Query: 98  SACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTP 157
           S    GRV++A+G+PIDG   +G G  S+  ++  P  + R+ +++   TG+R ID  TP
Sbjct: 96  SEKMLGRVLDAMGRPIDGKGPVG-GAESVSTVNTPPNVLTRKPIKRQMVTGVRAIDTMTP 154

Query: 158 LCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKK 216
           +  GQRIG+F+GSG+GKSTLL M AR+   D  +I+L+GERGREV+EFIE  LG + L++
Sbjct: 155 IGKGQRIGIFSGSGVGKSTLLGMIARNTSADINVIALIGERGREVQEFIEYDLGPEGLER 214

Query: 217 SVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGEL 276
           S++VV+T D +P+ R      A TIAE+F  KG +V+L+ DS+TRFA + REI    GE 
Sbjct: 215 SILVVSTGDTAPLSRLRGAFVATTIAEHFRDKGADVMLLFDSVTRFARAQREIGLAVGEP 274

Query: 277 PVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHI 336
           P  RGY  SVFS LP+LLER G  E+  G IT   ++LV+GD+ ++P+AD+VR ILDGHI
Sbjct: 275 PATRGYTPSVFSTLPKLLERCGTGER--GTITGFYTILVEGDDMDEPVADAVRGILDGHI 332

Query: 337 VLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYR 396
           VL+R LA+  RYP +D LAS+SRL  K  S   +K    L  L+  + +  D+  +G Y 
Sbjct: 333 VLSRKLAQAYRYPAIDVLASLSRLGTKITSPLVQKASGKLRSLLAVYTDAEDLINVGAYA 392

Query: 397 PGVDLILDKAVHQVPIIYDFLKQ 419
            G +  +D+A+ ++  I +FL Q
Sbjct: 393 EGSNSAIDEAIEKIDAIREFLGQ 415


>gi|269796395|ref|YP_003315850.1| type III secretion system ATPase, FliI/YscN [Sanguibacter keddieii
           DSM 10542]
 gi|269098580|gb|ACZ23016.1| type III secretion system ATPase, FliI/YscN [Sanguibacter keddieii
           DSM 10542]
          Length = 459

 Score =  284 bits (726), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 159/384 (41%), Positives = 231/384 (60%), Gaps = 7/384 (1%)

Query: 38  CLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLG-DLVFHWGRFRIS 96
            L   + LG+    +G ++  L +V+ +        P+G    I  G       G  ++ 
Sbjct: 55  ALGDVLALGE--TGRGSDASMLAEVVAVTGSTARCMPLGAMRGIRPGLQARTTGGALQVP 112

Query: 97  PSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFT 156
             +   GRV++ LG+P+DG   L  G  ++ +  + P  + RQRV +    G+R +D  T
Sbjct: 113 VGSGLLGRVVDGLGRPLDGRGPL-VGTTTVPLDGRAPHPLERQRVAQPLTLGVRTLDTLT 171

Query: 157 PLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLK 215
            +  GQR+G+FAGSG+GKSTLLSM AR       +I+LVGERGREVREF+ED LG + L 
Sbjct: 172 TVGRGQRMGLFAGSGVGKSTLLSMVARGTDAAVSVIALVGERGREVREFLEDDLGPEGLA 231

Query: 216 KSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGE 275
           +SVVVVATSDE  ++R  A   A  IAE F   G++V+L++DS+TR A + REI  + GE
Sbjct: 232 RSVVVVATSDEPALVRLRAAFVATRIAESFRESGEDVVLMMDSLTRVAMAQREIGLSVGE 291

Query: 276 LPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGH 335
            P  RGYP S FS L  LLER G S   +G++T + +VLVDGD+HN+PIAD+ RSILDGH
Sbjct: 292 PPATRGYPPSTFSVLAELLERAGTS--ARGSVTGIYTVLVDGDDHNEPIADAARSILDGH 349

Query: 336 IVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGY 395
           +VL+R LA  G +P +D L S+SR+A +  SA ++   ++L  ++      +D+  +G Y
Sbjct: 350 VVLDRRLAVAGHFPSIDALGSISRVATRVTSAAQRADATALRKVMSARRAVQDLVDVGAY 409

Query: 396 RPGVDLILDKAVHQVPIIYDFLKQ 419
             G + ++D A+     I  FL+Q
Sbjct: 410 VQGSNPLVDAALAHQGAIDAFLQQ 433


>gi|170690593|ref|ZP_02881760.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Burkholderia graminis C4D1M]
 gi|170145028|gb|EDT13189.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Burkholderia graminis C4D1M]
          Length = 464

 Score =  283 bits (725), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 165/420 (39%), Positives = 244/420 (58%), Gaps = 13/420 (3%)

Query: 13  EDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNL--GQVIRINLDIV 70
           E  S   + + G +  +      V  L   V LG+    +  N + L   +VI    D+ 
Sbjct: 38  EILSTASIARTGKVLEVIGTLVKVAGLD--VTLGELCELRAANGELLQHAEVIGFTRDVA 95

Query: 71  YICPVGIGEEISLGDLVFHWGRFRISPSA-CWCGRVINALGKPIDGDDSLGKGDLSME-- 127
            + P     +IS    V   GR    P      GRVI++LG+PIDG   LG  D   E  
Sbjct: 96  LLSPFSRLADISRSTRVVGLGRSLTVPVGDALLGRVIDSLGEPIDG---LGPLDTIEERP 152

Query: 128 IMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCF 187
           + +  P  M+R+ ++    TG+R++D    L  GQR+G+FA +G+GKSTLL MFAR    
Sbjct: 153 VFANPPSPMSRRMIDTPLATGVRIVDGMMTLAEGQRMGIFAPAGVGKSTLLGMFARGAQC 212

Query: 188 DKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFS 246
           D  +I+L+GERGREVREF+E  LG + + +S+VV ATSD S I R  A   A  IAE+F 
Sbjct: 213 DVTVIALIGERGREVREFVELILGPEGMARSIVVCATSDRSSIERAKAAYVATAIAEHFR 272

Query: 247 SKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGN 306
            +G  VLL++DS+TRFA + REI   +GE P  RG+P S+F+ELPRLLER G    E G+
Sbjct: 273 DRGQRVLLMMDSLTRFARAQREIGLAAGEPPARRGFPPSIFAELPRLLERAG--MGEHGS 330

Query: 307 ITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWS 366
           ITA+ +VL + ++ NDPIA+ VR I+DGH++L+R +A + +YP +D LAS+SR+  +  +
Sbjct: 331 ITALYTVLAEDESGNDPIAEEVRGIVDGHMILSREIAAKNQYPAIDVLASLSRVMPQVMT 390

Query: 367 ADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
            D  +    L  L+ +  E   +  IG Y+PG + + D+A+ ++  I  F  Q+  +L++
Sbjct: 391 PDYVRAAGRLRELLAKHREVEMLLQIGEYQPGGNPLADEAIRKIDAIRAFFNQATHELAA 450


>gi|229918630|ref|YP_002887276.1| ATPase, FliI/YscN family [Exiguobacterium sp. AT1b]
 gi|229470059|gb|ACQ71831.1| ATPase, FliI/YscN family [Exiguobacterium sp. AT1b]
          Length = 439

 Score =  283 bits (725), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 154/363 (42%), Positives = 229/363 (63%), Gaps = 8/363 (2%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISP-SACWCGRVINALGKPIDGDDSL 119
           +V+  N + V + P G   +I+ G LV   G+    P      G+V++ LG+P+ G+  +
Sbjct: 60  EVVGFNEERVLLMPYGETTQIAPGCLVKGTGKMLQVPVGEELIGQVLDGLGRPLSGERLV 119

Query: 120 -GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLL 178
            GK     ++  K P  +NR R+     TG+R+ID    +  GQR+G+FAGSG+GKSTLL
Sbjct: 120 TGK---RYDVQRKPPNPLNRPRILDALSTGVRMIDGLLTVGKGQRVGLFAGSGVGKSTLL 176

Query: 179 SMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLT 237
            M A+    D  +I+L+GERGREV+EFIE  LG + + +SVV+VATSD+ P++R     T
Sbjct: 177 GMIAKRSSADINVIALIGERGREVKEFIEKELGPEGMARSVVIVATSDQPPLVRLKGAYT 236

Query: 238 AVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERI 297
           A  IAEYF  +G  V+L++DS+TRFA + REI   +GE P ++GY  SVF+ LP+LLER 
Sbjct: 237 ATAIAEYFRDQGKEVVLMMDSVTRFAMAQREIGLATGEPPTSKGYTPSVFAMLPQLLERS 296

Query: 298 GPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASV 357
           G +    G+ITA  +VLVDGD+ N+PIAD+VR ILDGH V++R+LA  G++P +  L S+
Sbjct: 297 GTAAT--GSITAFYTVLVDGDDMNEPIADAVRGILDGHFVMDRALANRGQFPAIHVLKSI 354

Query: 358 SRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFL 417
           SR+ ++  S + K+   +    +  + +  D+  IG Y+ G +  +D AV + P +  FL
Sbjct: 355 SRVMNQIASPEHKEAAQTFRSWLATYIDAEDLINIGAYKKGTNPAIDTAVDKYPYLLTFL 414

Query: 418 KQS 420
           KQS
Sbjct: 415 KQS 417


>gi|296330838|ref|ZP_06873313.1| flagellum-specific ATP synthase [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305674356|ref|YP_003866028.1| flagellum-specific ATP synthase [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296151843|gb|EFG92717.1| flagellum-specific ATP synthase [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305412600|gb|ADM37719.1| flagellum-specific ATP synthase [Bacillus subtilis subsp.
           spizizenii str. W23]
          Length = 438

 Score =  283 bits (725), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 162/380 (42%), Positives = 229/380 (60%), Gaps = 9/380 (2%)

Query: 43  VCLGDFVVHQGKNSDNL-GQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSAC 100
           VCL   +  +G++ + +  +V+    + + + P      I+ G +V   G   R+   A 
Sbjct: 42  VCL---IYAKGQSGNVIKAEVVGFQEESILLMPYLEAASIAPGSIVEATGESLRVKVGAG 98

Query: 101 WCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCH 160
             G+VI+A G+P+DG   L KG   +      P  M R  + +    G+R ID    +  
Sbjct: 99  LIGQVIDAFGEPLDGK-LLPKGLSPVSTEQSPPNPMKRPPIREKMGVGVRSIDSLLTVGK 157

Query: 161 GQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVV 219
           GQRIG+FAGSG+GKSTL+ M A+    D  +I+LVGERGREVREFIE  LGD  LK+S+V
Sbjct: 158 GQRIGIFAGSGVGKSTLMGMIAKQTEADLNVIALVGERGREVREFIEKDLGDEGLKRSIV 217

Query: 220 VVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVA 279
           VVATSD+  ++R  A  TA  IAEYF  KG NV+ ++DS+TR A + REI   +GE P  
Sbjct: 218 VVATSDQPALMRLKAAYTATAIAEYFRDKGQNVMFMMDSVTRVAMAQREIGLAAGEPPTT 277

Query: 280 RGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLN 339
           +GY  SVF+ LPRLLER G +E   G ITA  +VLVDGD+ N+PIAD+VR ILDGHIVL+
Sbjct: 278 KGYTPSVFAILPRLLERTGANEH--GTITAFYTVLVDGDDMNEPIADTVRGILDGHIVLD 335

Query: 340 RSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGV 399
           R+LA +G++P V+ L S+SR+     +       +    L+  ++ + D+  IG Y+ G 
Sbjct: 336 RALANKGQFPAVNILKSISRVMSNISTRQHLDAANKFRELLSTYQNSEDLINIGAYKRGS 395

Query: 400 DLILDKAVHQVPIIYDFLKQ 419
              +D+A+   P +  FLKQ
Sbjct: 396 SREIDEAIQFYPQLIQFLKQ 415


>gi|254474795|ref|ZP_05088181.1| flagellum-specific ATP synthase [Ruegeria sp. R11]
 gi|214029038|gb|EEB69873.1| flagellum-specific ATP synthase [Ruegeria sp. R11]
          Length = 447

 Score =  283 bits (725), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 164/425 (38%), Positives = 251/425 (59%), Gaps = 4/425 (0%)

Query: 2   QKNLETLAQLAEDYS-KNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNL- 59
           Q  +  +  L +D + K L    G ++ I+     V+ L     +GD +V +    D L 
Sbjct: 4   QNMISAINALTQDLANKRLSAAVGRVTEISGGAIAVSGLDGQARIGDRLVLRRGGKDPLQ 63

Query: 60  GQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSL 119
           G+V+RI+   + + P    + +++GD V        +P+  W GRVI+  G P+DG   +
Sbjct: 64  GEVMRISGREISMLPDTAPDRVAVGDPVLLHPTPEFAPADSWIGRVIDPFGAPLDGRPMM 123

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
            +G+ + ++M+  P A  R+ + +   TG+ V +   P+  GQR+G+FAGSG+GKSTLL+
Sbjct: 124 -RGETARDLMAAPPKAAERRPMGERLATGLAVFNTILPIVKGQRVGLFAGSGVGKSTLLA 182

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTA 238
             A++   D V+++L+GERGREV  F+ + LG D +K++VVV ATSD+S ++R+    +A
Sbjct: 183 TLAQNMEADVVVMALIGERGREVNHFVNEVLGPDGMKRAVVVAATSDQSALVRRRCAWSA 242

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
           + +AE+F  +G NVL + DS+TRFA + REIA  SGE P  RGYP SV   +  L ER G
Sbjct: 243 MAVAEHFRDQGKNVLFLADSVTRFAEAHREIAVASGEAPALRGYPPSVTPLITGLCERAG 302

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
           P    +G+ITAV SVLV G + ++PIAD +R +LDGHIVLNR +AE GR+P VD   SVS
Sbjct: 303 PGSDGQGDITAVFSVLVAGSDMDEPIADILRGVLDGHIVLNREIAERGRFPAVDVSRSVS 362

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R    A + +E   +  +   +  +E++  +   G Y  G D+ LD+AV   P +  F  
Sbjct: 363 RSLPAAATEEENAAILDVRKYLGAYEQSEVMIRAGLYSEGNDVTLDQAVKLWPELDSFFG 422

Query: 419 QSPSD 423
           +S  D
Sbjct: 423 KSDPD 427


>gi|225375320|ref|ZP_03752541.1| hypothetical protein ROSEINA2194_00945 [Roseburia inulinivorans DSM
           16841]
 gi|225212809|gb|EEG95163.1| hypothetical protein ROSEINA2194_00945 [Roseburia inulinivorans DSM
           16841]
          Length = 436

 Score =  283 bits (725), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 150/343 (43%), Positives = 224/343 (65%), Gaps = 6/343 (1%)

Query: 79  EEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMN 137
           E I +G +V + G    +S      G  ++ +G+P D D    +      + ++ P  M+
Sbjct: 77  EGIGVGCIVENTGHPLSVSVGNELLGHTLDGIGRPTDIDKL--ETPYEYPVDAQPPDPMS 134

Query: 138 RQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGE 197
           R+ + +    G++ +D    +  GQRIG+FAGSG+GKSTLL MFAR+   D  +I+L+GE
Sbjct: 135 RKIISEVLPLGVKAVDGLITVGKGQRIGIFAGSGVGKSTLLGMFARNTKADINVIALIGE 194

Query: 198 RGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLIL 256
           RGREVREF+E  LG+  +K+S+VVVATSD+  ++RK A +TA +IAEYF  +G +VLL++
Sbjct: 195 RGREVREFVERDLGEEGMKRSIVVVATSDKPALIRKKAAMTATSIAEYFRDQGKDVLLMM 254

Query: 257 DSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVD 316
           DS+TRF+ + REI   SGE PV RGYP SV+SE+P+LLER G S  +KG+IT + +VLVD
Sbjct: 255 DSLTRFSMAQREIGLASGEPPVTRGYPPSVYSEMPKLLERAGTS--DKGSITGLYTVLVD 312

Query: 317 GDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSL 376
           GD+ N+PI D+ RSILDGHI+L+R L  +  YP +D L S+SR+     + + K+L   L
Sbjct: 313 GDDFNEPITDTARSILDGHIMLSRKLGHKNHYPAIDILQSISRVMSSIATPEHKELAGRL 372

Query: 377 THLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
            +++  + E  D+  IG Y+ G +  +D A+ ++  + DFL Q
Sbjct: 373 KNVLATYNEAEDLINIGAYKSGSNRNIDYAIQKIDAVNDFLMQ 415


>gi|160939663|ref|ZP_02087011.1| hypothetical protein CLOBOL_04555 [Clostridium bolteae ATCC
           BAA-613]
 gi|158437454|gb|EDP15218.1| hypothetical protein CLOBOL_04555 [Clostridium bolteae ATCC
           BAA-613]
          Length = 434

 Score =  283 bits (725), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 175/420 (41%), Positives = 253/420 (60%), Gaps = 18/420 (4%)

Query: 25  YISSITSVYYTVTCLSQYVC-LGDF----VVHQGKNSDNLGQVIRINLDIVYICPVGIGE 79
           Y+  I  +  T    +   C LGD     VV  G  S  + +V+    + V + P G  E
Sbjct: 18  YLGKIDKIVGTTVESTGPACRLGDVCTIDVVEGG--SPVMAEVVGFRENKVLLMPYGETE 75

Query: 80  EISLGDLVFHWG-RFRISPSACWCGRVINALGKPIDGDDSLGK-GDLSMEIMSKVPP-AM 136
            I  G  V + G R  I+ S    GR ++A+G PID    LG   D+S   ++  P   M
Sbjct: 76  GIGYGSAVRNTGERLHIAVSNHLIGRTVDAMGNPID---DLGPVEDVSYYSITGRPSNPM 132

Query: 137 NRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVG 196
            R R++   + G++ ID    +  GQR+G+FAGSG+GKSTL+ M A++   D  +I+LVG
Sbjct: 133 TRPRIDTIIQMGVKAIDGLMTVGKGQRMGIFAGSGVGKSTLMGMIAKNVKADVNVIALVG 192

Query: 197 ERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLI 255
           ER REV EFI   LG+  L++SV+VVATS++S ++R    +TA TIAEYF  +G +VLL+
Sbjct: 193 ERSREVVEFIHRDLGEEGLRRSVLVVATSNQSAMMRSKCTMTATTIAEYFKDQGMDVLLM 252

Query: 256 LDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLV 315
           +DS+TRFA + RE+  + GE PVARGY  S++SELP+LLER G    E+G+IT + +VLV
Sbjct: 253 MDSLTRFAMAQREVGLSIGEPPVARGYTPSIYSELPKLLERSG--NFEEGSITGIYTVLV 310

Query: 316 DGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSS 375
           +GD+ N+PI+D+VR I+DGHI+L+R +A    YP +D L+SVSRL +   + + K     
Sbjct: 311 EGDDANEPISDTVRGIIDGHIMLSRKVAARNHYPAIDILSSVSRLMNDIVTPEHKAAAGK 370

Query: 376 LTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS--EDVFQEI 433
           L  L+  +E  RD+  IG Y+ G +  LD A+ ++  IY FL+Q   +  S  E V Q I
Sbjct: 371 LRRLLSVYESNRDLVSIGAYKKGTNPELDDALERIDRIYGFLQQKTDESFSLDESVIQMI 430


>gi|89072274|ref|ZP_01158853.1| putative flagellum-specific ATP synthase [Photobacterium sp. SKA34]
 gi|89051806|gb|EAR57258.1| putative flagellum-specific ATP synthase [Photobacterium sp. SKA34]
          Length = 449

 Score =  283 bits (725), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 153/362 (42%), Positives = 223/362 (61%), Gaps = 5/362 (1%)

Query: 61  QVIRINLDIVYICPV-GIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSL 119
           QV+  + +I Y+ PV  +G   +   ++   G   ++ S  W GRV+N LG+P+D    L
Sbjct: 61  QVVGFDHNIAYLMPVRQLGGLYAGAKVIPIQGGSTVNVSHKWIGRVVNGLGEPLDNGLPL 120

Query: 120 GKGD-LSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLL 178
             G+ LS+E     P  M RQ VE     GI+ I+    +  GQRIG+ AGSG+GKS L+
Sbjct: 121 QGGECLSLEPKPINP--MKRQPVESPLDVGIKAINGLLTVGKGQRIGLMAGSGVGKSVLM 178

Query: 179 SMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPLT 237
            M  +    D +++ L+GERGREVREFIE  LG+   K++V++ A +DESP++R  A   
Sbjct: 179 GMITKYTAADIIVVGLIGERGREVREFIERSLGEEGRKRAVIIAAPADESPLMRLRATKL 238

Query: 238 AVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERI 297
              +AEYF  +G +VLL++DS+TR+A + REIA   GE P +RGYP SVFS LP+LLER 
Sbjct: 239 CHRVAEYFRDQGKDVLLLMDSLTRYAMAQREIALALGEPPASRGYPPSVFSLLPQLLERA 298

Query: 298 GPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASV 357
           G  E   G++TA+ +VL +GD+  DP+ DS R+ILDGHIVL+R+LAE+G YP +D  AS+
Sbjct: 299 GNGENPNGSLTAIYTVLAEGDDQQDPVVDSARAILDGHIVLSRTLAEQGHYPAIDINASI 358

Query: 358 SRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFL 417
           SR            + +    L   +++ +++  +GGY+ G D  LD+AV   P +  FL
Sbjct: 359 SRCMSNCTEQAHVTVANQFRQLNANYQQVKELLPLGGYQQGQDPELDQAVMMQPQLKQFL 418

Query: 418 KQ 419
           +Q
Sbjct: 419 QQ 420


>gi|188586020|ref|YP_001917565.1| type III secretion system ATPase, FliI/YscN [Natranaerobius
           thermophilus JW/NM-WN-LF]
 gi|179350707|gb|ACB84977.1| type III secretion system ATPase, FliI/YscN [Natranaerobius
           thermophilus JW/NM-WN-LF]
          Length = 439

 Score =  283 bits (725), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 162/438 (36%), Positives = 260/438 (59%), Gaps = 13/438 (2%)

Query: 4   NLETLAQLAEDYSKNLVVQGGYISSITSVY-YTVTCLSQYVCLGDFVVHQGKNSDNLGQV 62
           +L+ L+Q   + S  L +QG     +T V   TV        +GD  + +  + +   +V
Sbjct: 7   DLDKLSQTIRN-SNTLPLQG----EVTRVVGLTVEARGPGAKIGDLCLIRSDDQEIECEV 61

Query: 63  IRINLDIVYICPVGIGEEISLGD-LVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGK 121
           +  N   + + P+G    ++ G+ ++       +       GRV++ LG+P+DG   L  
Sbjct: 62  VGFNDGKILLMPLGNLNNVAPGNKVITSRENLSVPVGPGLVGRVLDGLGRPMDGKGPLTN 121

Query: 122 GDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMF 181
                 + +  P  ++R R++K  +TGI+ ID    +  GQR+G+F+GSG+GKSTLL M 
Sbjct: 122 TKCRYPMENTPPAPLDRSRIQKPIQTGIKAIDGVLTIGKGQRMGIFSGSGVGKSTLLGMI 181

Query: 182 ARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVT 240
           AR+      +I L+GERGREVREFIE  LG + L++SV+VVATSD+  +LR    +TA  
Sbjct: 182 ARNTSASVNVIGLIGERGREVREFIEKDLGEEGLQRSVIVVATSDQPALLRIKGAMTATA 241

Query: 241 IAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPS 300
           IAEYF   G++V+L++DS+TRFA + RE+   +GE P  RG+P SVF+ LP+LLER G S
Sbjct: 242 IAEYFRDCGNDVMLMMDSVTRFATAKREVGLATGEPPATRGFPPSVFAMLPQLLERSGTS 301

Query: 301 EKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRL 360
             +KG++T + +VLVDGD+ ++P++D+VR +LDGHIVL+R LA +  YP +D L S+SR+
Sbjct: 302 --DKGSVTGLYTVLVDGDDMDEPVSDTVRGVLDGHIVLSRKLAMQNHYPAIDILQSISRV 359

Query: 361 ADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQS 420
                    +K  + ++  +  +EE RD+  IG Y+ G +  +D A+  +  + +FL+Q 
Sbjct: 360 MVDITDTQHQKAAAKISSALAAYEEARDLIEIGAYKKGSNPKVDWAMELIDDLNEFLRQ- 418

Query: 421 PSDLSSEDVFQEITKKLQ 438
             +++ +    E   KL+
Sbjct: 419 --EITEKTTLDETINKLK 434


>gi|229544396|ref|ZP_04433454.1| ATPase, FliI/YscN family [Bacillus coagulans 36D1]
 gi|229324881|gb|EEN90558.1| ATPase, FliI/YscN family [Bacillus coagulans 36D1]
          Length = 441

 Score =  283 bits (724), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 159/353 (45%), Positives = 217/353 (61%), Gaps = 5/353 (1%)

Query: 70  VYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEI 128
           V + P    +EIS G LV   G+  R+       G+VI+ LG P+D    L  G   + I
Sbjct: 68  VILMPYTNIQEISPGSLVEATGKPMRVKAGPRLLGKVIDPLGVPLD-HSPLPAGLKPIPI 126

Query: 129 MSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFD 188
               P  + R  + +  + G+R ID    +  GQRIG+FAGSG+GKSTLL M AR+   D
Sbjct: 127 DRTPPNPLKRPPIREPIELGVRAIDSLLTVGKGQRIGIFAGSGVGKSTLLGMIARNTNAD 186

Query: 189 KVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSS 247
             +I+L+GERGREVREFIE  LG + LKKS+VVVATSD+  ++R     TA  IAEYF  
Sbjct: 187 LNVIALIGERGREVREFIEQDLGPEGLKKSIVVVATSDQPALMRIKGAYTATAIAEYFRD 246

Query: 248 KGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNI 307
           +G NV+ ++DS+TR A + RE+   +GE P  +GY  SVF+ LP+LLER G    E G I
Sbjct: 247 QGLNVMFMMDSVTRVAMAQREVGLATGEPPATKGYTPSVFAILPKLLERTG--TNESGTI 304

Query: 308 TAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSA 367
           T + +VLVDGD+ N+PIAD+VR ILDGH VL+R LA +G+YP ++ L SVSRL  +  S 
Sbjct: 305 TGIYTVLVDGDDLNEPIADTVRGILDGHFVLDRDLANKGQYPAINILKSVSRLMSQLASP 364

Query: 368 DEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQS 420
             KK    +   +  +  + D+  IG Y+PG    +D+A+ + P I  F+KQS
Sbjct: 365 AHKKAAEKIREQLSTYLNSEDLINIGAYKPGASKEIDEAIERYPKIVSFIKQS 417


>gi|327478790|gb|AEA82100.1| FliI/YscN family ATPase [Pseudomonas stutzeri DSM 4166]
          Length = 444

 Score =  283 bits (724), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 161/375 (42%), Positives = 219/375 (58%), Gaps = 9/375 (2%)

Query: 50  VHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHW---GRFRISPSACWCGRVI 106
           V QG  S    QV+  N DI Y+ P      ++ G  VF      +  I  S  W GRV+
Sbjct: 51  VEQGDGSMLEAQVVGFNRDITYLMPFKKPVGLTAGSRVFPAPDDAKLHIDES--WLGRVV 108

Query: 107 NALGKPIDGDDSLGKGD-LSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIG 165
           N LG+P+D    LG  D L  E+ S  P  + R+ V +    G+R I+    L  GQR+G
Sbjct: 109 NGLGEPLDELGKLGGRDPLPTELPSVNP--LKRKPVSEALDVGVRAINATLTLGKGQRVG 166

Query: 166 VFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATS 224
           +FAGSG+GKS LL M  R    D V++ L+GERGREV+EF+   LG+  LKK+VVVVA +
Sbjct: 167 LFAGSGVGKSVLLGMITRQTKADVVVVGLIGERGREVQEFLLHSLGEEGLKKAVVVVAPA 226

Query: 225 DESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPT 284
           +ESP++R  A     +IA YF  +G +VLL++DS+TR+A + REIA   GE P  +GYP 
Sbjct: 227 NESPLMRLKATELCHSIAAYFRDQGHDVLLLVDSLTRYAMAQREIALALGEPPATKGYPP 286

Query: 285 SVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAE 344
           SVF  LP L+E  G    + G+++A+ +VL +GD+  DPI D  R+ILDGHIVL+R LAE
Sbjct: 287 SVFGMLPELVESAGNGASDNGSLSAIYTVLAEGDDQQDPIVDCARAILDGHIVLSRRLAE 346

Query: 345 EGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILD 404
            G YP +D  ASVSR   +            L      FE+ +++  +GGY PG D+  D
Sbjct: 347 AGHYPAIDVCASVSRCMSQVGQPAHLGAARQLKECYSTFEKIKELIPLGGYTPGADIKTD 406

Query: 405 KAVHQVPIIYDFLKQ 419
           +AV   P I  FL+Q
Sbjct: 407 RAVQLAPTIERFLRQ 421


>gi|237752940|ref|ZP_04583420.1| flagellum-specific ATP synthase [Helicobacter winghamensis ATCC
           BAA-430]
 gi|229375207|gb|EEO25298.1| flagellum-specific ATP synthase [Helicobacter winghamensis ATCC
           BAA-430]
          Length = 432

 Score =  283 bits (724), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 159/394 (40%), Positives = 237/394 (60%), Gaps = 6/394 (1%)

Query: 45  LGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCG 103
           +GD V    +++ ++G V  +  D   I P    E   +GD V+   R  +I       G
Sbjct: 39  IGDIVRILSEDNQSMGMVTALEKDCFKITPFSFIEGTKVGDKVYLNTRGLQIPVGLEILG 98

Query: 104 RVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQR 163
           RVIN LG+ IDG  ++ +   +M I+     AM R  + + F  G++ ID       GQ+
Sbjct: 99  RVINPLGEAIDGKGAI-RAQGAMPIIRAPIEAMKRGMINEVFSVGVKSIDGLLTCGKGQK 157

Query: 164 IGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVAT 223
           +G+FAGSG+GKSTL+ M  R       +I+L+GERGREV EF+E  LG +L  +V++VAT
Sbjct: 158 LGIFAGSGVGKSTLMGMIVRGATAKIKVIALIGERGREVPEFVEKNLGGDLTNTVLIVAT 217

Query: 224 SDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYP 283
           SD+SP++RK     A+++AEYF +KG++VL ++DS+TRFA + REI    GE P ++GYP
Sbjct: 218 SDDSPLMRKYGAFAAMSVAEYFKAKGEDVLFMMDSVTRFAMAQREIGLALGEPPTSKGYP 277

Query: 284 TSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLA 343
            SV + LP+L+ER G  E+ +G+ITA  +VLV+GD+ +DPIAD  RSILDGHIVL+RSL 
Sbjct: 278 PSVLTLLPQLMERAG-KEEGQGSITAYFTVLVEGDDMSDPIADQSRSILDGHIVLDRSLT 336

Query: 344 EEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLIL 403
           + G YPP++ L S SRL     + +  +       L    +E   +  IG Y+ G D  L
Sbjct: 337 DFGIYPPINVLNSASRLMGDVANKEHIEAARKFRRLYAMLKENEVLIRIGAYQAGSDKDL 396

Query: 404 DKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKL 437
           D+A+ +  ++ ++LKQ   D      ++E  +KL
Sbjct: 397 DEAISKKGVMEEYLKQ---DCDVAITYEESVQKL 427


>gi|194015095|ref|ZP_03053712.1| flagellar protein export ATPase FliI [Bacillus pumilus ATCC 7061]
 gi|194014121|gb|EDW23686.1| flagellar protein export ATPase FliI [Bacillus pumilus ATCC 7061]
          Length = 438

 Score =  283 bits (724), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 162/380 (42%), Positives = 229/380 (60%), Gaps = 9/380 (2%)

Query: 43  VCLGDFVVHQGKNSDNL-GQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSAC 100
           VCL   +  +G+  D +  +V+    + + + P      IS G LV   G   ++     
Sbjct: 42  VCL---IHKKGRKHDPIKAEVVGFRDENILLMPYVEASNISPGSLVEATGESLKVKVGTG 98

Query: 101 WCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCH 160
             G V++A G+P+DG   L KG   +      P  M+R  + +    G+RVID    +  
Sbjct: 99  LIGEVVDAFGEPLDGS-MLPKGLAPVSTDQSPPNPMDRPPIREKMGVGVRVIDSLLTVGT 157

Query: 161 GQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVV 219
           GQRIG+FAGSG+GKSTL+ M A+    D  +I+LVGERGREVREFIE  LG + LK+S+V
Sbjct: 158 GQRIGIFAGSGVGKSTLMGMIAKQTEADLNVIALVGERGREVREFIEKDLGTEGLKRSIV 217

Query: 220 VVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVA 279
           VVATSD+  + R  A  TA  IAEYF  +G NV+ ++DS+TR A + REI   +GE P  
Sbjct: 218 VVATSDQPALTRMKAAYTATAIAEYFRDRGKNVMFMMDSVTRVAMAQREIGLATGEPPTT 277

Query: 280 RGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLN 339
           +GY  SVF+ LP+LLER G ++   G+ITA  +VLVDGD+ N+PIAD+VR ILDGHIVL+
Sbjct: 278 KGYTPSVFAILPKLLERTGTNQL--GSITAFYTVLVDGDDMNEPIADTVRGILDGHIVLD 335

Query: 340 RSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGV 399
           R+LA +G++P V+ L S+SR+     S D K+  +    L+  ++   D+  IG Y+ G 
Sbjct: 336 RALANKGQFPAVNILKSISRVMSNIASHDHKEAANRFRQLLSTYQNAEDLINIGAYKKGS 395

Query: 400 DLILDKAVHQVPIIYDFLKQ 419
              +D A+   P +  FLKQ
Sbjct: 396 SKDIDDAMQAYPHLISFLKQ 415


>gi|56695106|ref|YP_165453.1| H+-transporting two-sector ATPase, flagellum-specific [Ruegeria
           pomeroyi DSS-3]
 gi|56676843|gb|AAV93509.1| H+-transporting two-sector ATPase, flagellum-specific [Ruegeria
           pomeroyi DSS-3]
          Length = 445

 Score =  283 bits (724), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 160/416 (38%), Positives = 246/416 (59%), Gaps = 3/416 (0%)

Query: 6   ETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLG-QVIR 64
           + LA  AE  S +LV   G ++ +      +  L++   +GD V  +     +LG +V++
Sbjct: 5   DPLALKAEFDSLSLVRHVGRVTGVAGGVIQIQGLARQAQIGDRVELKRNFGPSLGGEVLQ 64

Query: 65  INLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDL 124
           +    + + P    E +SLG+ V        +P   W GRV++  G+P+DG   L +G  
Sbjct: 65  VEGSTINMLPDSAPEGVSLGNRVVLHPIPGFAPGRHWLGRVVDPFGRPLDGR-PLMRGSK 123

Query: 125 SMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARS 184
           + ++M   PPA+ R+ + +   TG+  ++   P+  GQR+G+FAGSG+GKS+LL+  A+S
Sbjct: 124 ARDLMRAPPPAVQRKPLGQRMATGLAALNTLLPIVRGQRVGLFAGSGVGKSSLLATLAKS 183

Query: 185 DCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAE 243
              D V+++L+GERGREV EF+   LG + L +SV+V ATSD+S ++R+     A+T+AE
Sbjct: 184 MQADAVVVALIGERGREVNEFVAKALGPEGLARSVIVAATSDQSALVRRRCAWAAMTVAE 243

Query: 244 YFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKE 303
               +G NVL + DSITRFA + REI+   GE P  RGYP SV   +  L ER GP  ++
Sbjct: 244 SLRDEGLNVLYLADSITRFAEAHREISAAMGEAPALRGYPPSVTPLITGLCERAGPGTEK 303

Query: 304 KGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADK 363
           +G+IT V SVLV G + ++P+AD +R +LDGHIVLNR +AE GR+P +D   SVSR    
Sbjct: 304 QGDITGVFSVLVAGSDMDEPVADILRGVLDGHIVLNREIAERGRFPAIDISRSVSRSLPD 363

Query: 364 AWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
           A + ++  L+     LI  +E++  +   G Y  G D +LD+AV   P +  FL +
Sbjct: 364 AATPEQNALIGEARRLIGAYEQSEVMIKAGLYSEGADPLLDQAVRVWPELDAFLAR 419


>gi|157692303|ref|YP_001486765.1| flagellum-specific ATP synthase [Bacillus pumilus SAFR-032]
 gi|157681061|gb|ABV62205.1| flagellum-specific ATP synthase [Bacillus pumilus SAFR-032]
          Length = 438

 Score =  283 bits (724), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 162/380 (42%), Positives = 229/380 (60%), Gaps = 9/380 (2%)

Query: 43  VCLGDFVVHQGKNSDNL-GQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSAC 100
           VCL   +  +G+  D +  +V+    + + + P      IS G LV   G   ++     
Sbjct: 42  VCL---IHKKGRKHDPIKAEVVGFRDEHILLMPYVEASNISPGSLVEATGESLKVKVGTG 98

Query: 101 WCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCH 160
             G V++A G+P+DG   L KG   +      P  M+R  + +    G+RVID    +  
Sbjct: 99  LIGEVVDAFGEPLDGS-MLPKGLAPVSTDQSPPNPMDRPPIREKMGVGVRVIDSLLTVGT 157

Query: 161 GQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVV 219
           GQRIG+FAGSG+GKSTL+ M A+    D  +I+LVGERGREVREFIE  LG + LK+S+V
Sbjct: 158 GQRIGIFAGSGVGKSTLMGMIAKQTEADLNVIALVGERGREVREFIEKDLGTEGLKRSIV 217

Query: 220 VVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVA 279
           VVATSD+  + R  A  TA  IAEYF  +G NV+ ++DS+TR A + REI   +GE P  
Sbjct: 218 VVATSDQPALTRMKAAYTATAIAEYFRDRGKNVMFMMDSVTRVAMAQREIGLATGEPPTT 277

Query: 280 RGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLN 339
           +GY  SVF+ LP+LLER G ++   G+ITA  +VLVDGD+ N+PIAD+VR ILDGHIVL+
Sbjct: 278 KGYTPSVFAILPKLLERTGTNQL--GSITAFYTVLVDGDDMNEPIADTVRGILDGHIVLD 335

Query: 340 RSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGV 399
           R+LA +G++P V+ L S+SR+     S D K+  +    L+  ++   D+  IG Y+ G 
Sbjct: 336 RALANKGQFPAVNILKSISRVMSNIASHDHKEAANRFRQLLSTYQNAEDLINIGAYKKGS 395

Query: 400 DLILDKAVHQVPIIYDFLKQ 419
              +D A+   P +  FLKQ
Sbjct: 396 SKDIDDAMQAYPHLISFLKQ 415


>gi|291288213|ref|YP_003505029.1| flagellar protein export ATPase FliI [Denitrovibrio acetiphilus DSM
           12809]
 gi|290885373|gb|ADD69073.1| flagellar protein export ATPase FliI [Denitrovibrio acetiphilus DSM
           12809]
          Length = 435

 Score =  283 bits (723), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 162/382 (42%), Positives = 233/382 (60%), Gaps = 9/382 (2%)

Query: 59  LGQVIRINLDIVYICPVGIGEEISLGDLVFH--WGRFRISPSACWCGRVINALGKPIDGD 116
           L +++    D + + P G  E I+ G  V +  +G   +  S    GRV++ LG P+DG 
Sbjct: 54  LAEIVGFKDDRIILMPYGESEGIAPGSHVTNESYGN-TVKVSDSLLGRVLDGLGNPMDGK 112

Query: 117 DSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKST 176
             +   +L + +    P A+ R+ ++    TGI+ ID    +  GQR+G+FAGSG+GKS 
Sbjct: 113 GPITDFEL-VNVYQSPPQALEREIIKTPVSTGIKAIDNLITIGRGQRVGIFAGSGVGKSV 171

Query: 177 LLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAP 235
            L M AR    D  +I+L+GERGREVREFIE  LG+  LK+SV+V+ATSD+S ++RK+  
Sbjct: 172 TLGMIARDSDADVNVIALIGERGREVREFIERDLGEEGLKRSVLVIATSDQSALIRKLGA 231

Query: 236 LTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLE 295
                IAEYF SKG NV+L++DS+TRFA + REI    GE P  +GY  SVF  LP+LLE
Sbjct: 232 FVGTAIAEYFRSKGLNVMLMMDSVTRFAMAQREIGLTVGEPPTTKGYTPSVFGLLPKLLE 291

Query: 296 RIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLA 355
           R G ++K KGNIT + +VLV+ D+ NDPI DSVRSI+DGHIVL+R LA +  YP +D L+
Sbjct: 292 RAG-TQKGKGNITGLYTVLVEADDMNDPIGDSVRSIIDGHIVLSRGLAAKNHYPAIDVLS 350

Query: 356 SVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYD 415
           S SRL  +  +  +      +  L+  + E  D+  IG Y  G +  +D+++ ++  I  
Sbjct: 351 SASRLMKEIVNDKQYANAGRMRDLLASYNEAEDLINIGAYVKGSNPKIDESIAKIGQIEQ 410

Query: 416 FLKQSPSDLSSEDVFQEITKKL 437
           FL+Q   D  +   F+E TK L
Sbjct: 411 FLRQGIDDSIN---FEESTKLL 429


>gi|256833238|ref|YP_003161965.1| ATPase, FliI/YscN family [Jonesia denitrificans DSM 20603]
 gi|256686769|gb|ACV09662.1| ATPase, FliI/YscN family [Jonesia denitrificans DSM 20603]
          Length = 446

 Score =  283 bits (723), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 159/378 (42%), Positives = 226/378 (59%), Gaps = 5/378 (1%)

Query: 44  CLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFH-WGRFRISPSACWC 102
            +GD V      +    +V+ ++       P+     +  G  V H  G  R+   +   
Sbjct: 41  AVGDVVAVGESGTPARAEVVAVHDGFATCMPLTAIPALRAGAQVRHTGGGIRVPVGSGLL 100

Query: 103 GRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQ 162
           GRVI+ LG+PIDG   L   D  +++ +  P  + RQRV +    G+RV+D  T +  GQ
Sbjct: 101 GRVIDPLGEPIDGLGPLTHVDF-VDVDAAAPHPLARQRVSEPLALGVRVMDTLTSVGRGQ 159

Query: 163 RIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVV 221
           R+G+FAGSG+GKSTLLSM AR       +I+L+GERGREVREF+ED LG + L +S+VV+
Sbjct: 160 RMGLFAGSGVGKSTLLSMIARGTDAQVSVIALIGERGREVREFLEDDLGPEGLARSIVVI 219

Query: 222 ATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARG 281
           ATSD+  ++R+ A  TA  IA++ +  G++V+L++DS+TR A + REI  + GE P  RG
Sbjct: 220 ATSDQPALMRQRAAFTATRIAQWLAQMGNDVVLMMDSLTRVAMAQREIGLSVGEPPATRG 279

Query: 282 YPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRS 341
           YP S FS L  LLER G    E+G +T + +VLVDGD+HN+PIAD+ RSILDGH+VL+R 
Sbjct: 280 YPPSTFSVLANLLERAG--SAEQGTVTGLYTVLVDGDDHNEPIADAARSILDGHVVLDRK 337

Query: 342 LAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDL 401
           LA  G YP +D LAS+SR+A K      +    +L   +      +D+  IG Y  G + 
Sbjct: 338 LAVRGHYPAIDALASISRVASKVNDPANQAHADTLRRFMAAKAGVQDLIDIGAYAAGSNP 397

Query: 402 ILDKAVHQVPIIYDFLKQ 419
            +D A+ Q   I  FL Q
Sbjct: 398 TVDAALAQAQDITSFLCQ 415


>gi|149912828|ref|ZP_01901362.1| flagellum-specific ATP synthase [Roseobacter sp. AzwK-3b]
 gi|149813234|gb|EDM73060.1| flagellum-specific ATP synthase [Roseobacter sp. AzwK-3b]
          Length = 474

 Score =  283 bits (723), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 162/417 (38%), Positives = 245/417 (58%), Gaps = 4/417 (0%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLG-QVIRINLDIVYICPVGIGEEIS 82
           G +S+I S    +  LS+   LGD V    +++  LG +V+R++ D+  + P    + + 
Sbjct: 23  GRVSAIQSQLLGIAGLSRVAKLGDRVEIACRDAVILGGEVLRLDGDLANVMPDFPPDRVH 82

Query: 83  LGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVE 142
           +GD V       I PS  W GR+++  G+P+DG   L KG     + +  P A +R+   
Sbjct: 83  IGDRVRIADSALIRPSDRWIGRIVDPFGQPLDGR-PLPKGATGSALRADPPSAASRRGFG 141

Query: 143 KGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREV 202
              +TG+   +   P+  GQRIG+FAGSG+GKSTLL+   R+   D V+ +L+GERGRE+
Sbjct: 142 PRLETGLAAFNTLLPIVRGQRIGLFAGSGVGKSTLLATLGRNTQADVVVFALIGERGREL 201

Query: 203 REFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITR 261
           R FIE  LG + + +SVVV ATSD+SP+ R+    TA+ +AEYF   G  VLL+ DSITR
Sbjct: 202 RHFIETGLGPEGMLRSVVVAATSDQSPLARRRCAWTAMAVAEYFRDAGKQVLLMFDSITR 261

Query: 262 FAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHN 321
           FA + RE+A  +GELP  RG+P S    +  L ER GP  +   +ITA+ SVLV G + +
Sbjct: 262 FAEAHREVAIAAGELPTMRGFPASTSHMIMSLCERAGPGAQGCADITALFSVLVAGSDLD 321

Query: 322 DPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIH 381
           +P+AD +R +LDGH+VL+R +AE GRYP +D L SVSR   +A S  E +++     L+ 
Sbjct: 322 EPVADILRGVLDGHVVLDRQIAERGRYPAIDLLRSVSRSLPQAASDAENQMILRARALLG 381

Query: 382 RFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
            +  +  +   G Y  G D  LD+A+   P +  FL ++   +S+++ F  +   L+
Sbjct: 382 AYARSETMLRAGLYNEGSDPELDQAIRAWPELDAFLSET-EPVSAQNSFDRLNLILR 437


>gi|332799176|ref|YP_004460675.1| flagellar protein export ATPase FliI [Tepidanaerobacter sp. Re1]
 gi|332696911|gb|AEE91368.1| flagellar protein export ATPase FliI [Tepidanaerobacter sp. Re1]
          Length = 442

 Score =  283 bits (723), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 168/400 (42%), Positives = 244/400 (61%), Gaps = 9/400 (2%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDF-VVHQGKNSDNL-GQVIRINLDIVYICPVGIGEEI 81
           G IS I  V  T+        LG+  ++   KN  ++  +V+    +IV + P+G  E++
Sbjct: 24  GRISKI--VGLTIESEGPPAELGEICIIKSPKNPKSIFSEVVGFRDEIVILMPLGDMEDL 81

Query: 82  SLGDLVFHWGRFRISPSA-CWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQR 140
             G  V   G+   +P      GRV++ LG PID    L K  L   + +  P  + R  
Sbjct: 82  GPGWDVEATGKKMTTPVGDELLGRVLDGLGNPIDDKGPL-KAKLHYPVSNNPPNPVERPI 140

Query: 141 VEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGR 200
           + +    G+R ID       GQR+G+FAGSG+GKSTLL M AR+   D  +I+LVGERGR
Sbjct: 141 ISEPLPVGVRAIDALLTCGIGQRLGIFAGSGVGKSTLLGMIARNTKADVNVIALVGERGR 200

Query: 201 EVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSI 259
           E+  FI   LG+  +K+SV+VVATSD+ P++R  A  TA  IAEYF  +G NVLL++DSI
Sbjct: 201 ELNSFITKDLGEEGVKRSVIVVATSDKPPLVRTRAAFTATAIAEYFRDQGANVLLMMDSI 260

Query: 260 TRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDN 319
           TRFA + RE+   +GE PV RGY  SV++ LP+LLER G S   KG+IT + +VLVDGD+
Sbjct: 261 TRFAMAQREVGLAAGEPPVTRGYTPSVYATLPKLLERAGTS--AKGSITGIYTVLVDGDD 318

Query: 320 HNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHL 379
            N+PI+D+VR ILDGHIVL+R LA +  YP +D +AS+SRL +   + + +KL   + ++
Sbjct: 319 LNEPISDAVRGILDGHIVLSRELANKNHYPAIDVMASISRLMNDIVTPNHRKLAGRVKNI 378

Query: 380 IHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
           +  ++E  D+  IG Y  G +  +D+++  +  I +FLKQ
Sbjct: 379 LSVYKEAEDLINIGAYVKGNNPQIDESIKYIDKIENFLKQ 418


>gi|312126822|ref|YP_003991696.1| atpase, flii/yscn family [Caldicellulosiruptor hydrothermalis 108]
 gi|311776841|gb|ADQ06327.1| ATPase, FliI/YscN family [Caldicellulosiruptor hydrothermalis 108]
          Length = 431

 Score =  282 bits (722), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 156/401 (38%), Positives = 241/401 (60%), Gaps = 13/401 (3%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICP----VGIGE 79
           G+++ +  +  T+      V +G     +   ++ L +V+    + V + P    VG+  
Sbjct: 19  GFVNQVIGL--TIESQGPAVSIGTLCRIKAAKTETLAEVVGFKENKVLLMPYSDLVGV-- 74

Query: 80  EISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQ 139
                 ++     F +       GR+++ LG+PIDG   + K  +   + ++ P  + R 
Sbjct: 75  -FPGCKVIAQDSMFEVKVGKELLGRILDGLGQPIDGKGEI-KSKIKYPVENRAPNPLERP 132

Query: 140 RVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERG 199
           R++     GI+ ID    +  GQR+G+FAGSG+GKSTLL M AR+   D  +++L+GERG
Sbjct: 133 RIDTIMPLGIKAIDALLTIGKGQRVGIFAGSGVGKSTLLGMIARNAKADVNVLALIGERG 192

Query: 200 REVREFIE-DYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDS 258
           RE++EF+E D   + LK+SVVVVATSDES + R  A   A+ IAEYF  +G +VL ++DS
Sbjct: 193 RELKEFLEKDLKEEGLKRSVVVVATSDESALKRVKAAYVAMAIAEYFRDQGLDVLFLMDS 252

Query: 259 ITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGD 318
           +TRFA + REI    GE PV+RGY  SVFS +P+LLER G  + ++G+ITA+ +VLVDGD
Sbjct: 253 LTRFAMAQREIGLAVGEPPVSRGYTPSVFSVMPKLLERAG--KNKRGSITALFTVLVDGD 310

Query: 319 NHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTH 378
           + N+PI D+ R ILDGHIVL+R++A +  YP +D LAS+SR+ +       ++L +    
Sbjct: 311 DFNEPITDTARGILDGHIVLSRAIANKNHYPAIDVLASISRVMNDIVEPSHRELANETKR 370

Query: 379 LIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
           ++  + ET D+  IG Y  G +  +D+A+  VP I  FL+Q
Sbjct: 371 VLAVYRETEDLINIGAYTKGSNPEIDRAIELVPRINQFLRQ 411


>gi|288871077|ref|ZP_06410012.1| flagellar protein export ATPase FliI [Clostridium hathewayi DSM
           13479]
 gi|288864877|gb|EFC97175.1| flagellar protein export ATPase FliI [Clostridium hathewayi DSM
           13479]
          Length = 440

 Score =  282 bits (722), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 171/422 (40%), Positives = 251/422 (59%), Gaps = 11/422 (2%)

Query: 2   QKNLETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQ--GKNSDNL 59
            K +E++ Q  ++   NL    G I  I  V  TV  +     +GD       G +   +
Sbjct: 6   HKMIESVRQAVQN--ANLYTYLGKIDKI--VGTTVESMGPACRIGDVCTIDVPGGSPPVM 61

Query: 60  GQVIRINLDIVYICPVGIGEEISLGDLVFHWG-RFRISPSACWCGRVINALGKPIDGDDS 118
            +V+    + V + P    E I  G  V + G R  I  S    GR ++A+G PIDG   
Sbjct: 62  AEVVGFRENRVLLMPYEETEGIGYGSTVRNTGERLLIPVSNELIGRTVDAMGMPIDGQGP 121

Query: 119 LGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLL 178
           LG+      I  K    M R R++   + G++ ID    +  GQR+G+FAGSG+GKSTL+
Sbjct: 122 LGEVAY-YPITGKRSNPMERPRIDTVIQMGVKAIDGLLTIGKGQRMGIFAGSGVGKSTLM 180

Query: 179 SMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPLT 237
            M A++   D  +I+LVGER REV EFI   LG+  LK+SV+VVATS++S ++R    +T
Sbjct: 181 GMIAKNVKADVNVIALVGERSREVVEFINRDLGEEGLKRSVLVVATSNQSAMMRSKCTMT 240

Query: 238 AVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERI 297
           A TIAEYF  +G +VLL++DS+TRFA + RE+  + GE PVARGY  S++SELP+LLER 
Sbjct: 241 ATTIAEYFKDQGMDVLLMMDSLTRFAMAQREVGLSIGEPPVARGYTPSIYSELPKLLERS 300

Query: 298 GPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASV 357
           G    E G+IT + +VLV+GD+ N+P++D+VR I+DGHI+L+R +A + RYP +D L+SV
Sbjct: 301 G--NFETGSITGIYTVLVEGDDANEPVSDTVRGIIDGHIMLSRKVATQNRYPAIDILSSV 358

Query: 358 SRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFL 417
           SRL       + K+    +  L+  +E   D+  IG Y+ G +  LD A+ ++  IY+FL
Sbjct: 359 SRLMSDIVMPEHKEAAGKIRKLLSVYESNIDLVSIGAYKKGTNKELDDALMRIDKIYEFL 418

Query: 418 KQ 419
           +Q
Sbjct: 419 QQ 420


>gi|182412243|ref|YP_001817309.1| flagellar protein export ATPase FliI [Opitutus terrae PB90-1]
 gi|177839457|gb|ACB73709.1| flagellar protein export ATPase FliI [Opitutus terrae PB90-1]
          Length = 441

 Score =  282 bits (722), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 160/343 (46%), Positives = 215/343 (62%), Gaps = 5/343 (1%)

Query: 97  PSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFT 156
           P     GRV++ALG+P DG   L   D S+   +  P  + RQR+   F+TG+R +D FT
Sbjct: 101 PGPEMLGRVLDALGRPYDGLGML-PVDRSVGRDATPPHPLRRQRIHHSFQTGVRALDAFT 159

Query: 157 PLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLK 215
           P   GQR+G+FAGSG+GKSTL+ M AR    D V+++LVGERGREVREFIE  LG + LK
Sbjct: 160 PFGRGQRLGLFAGSGVGKSTLMGMIARGSEADVVVVALVGERGREVREFIEKDLGPEGLK 219

Query: 216 KSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGE 275
           +++VVVATSD    LR  A  TA  IAE + ++G NVL ++DS+TRFA + REI    GE
Sbjct: 220 RAIVVVATSDTPAPLRLRAAFTATAIAEAWRAEGKNVLFMMDSVTRFAMAQREIGLAVGE 279

Query: 276 LPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGH 335
               RGY  SVF+ LPRLLER G    E G ITA+ +VLV+GD+ N+P+AD+VR ILDGH
Sbjct: 280 PAATRGYTPSVFALLPRLLERTGAG--ELGAITALYTVLVEGDDMNEPVADAVRGILDGH 337

Query: 336 IVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGY 395
           +VL+R+LA    YP +D L SVSRL     + DE  L +     +  + +  D+  IG Y
Sbjct: 338 VVLSRALAHFNHYPAIDVLESVSRLIRDVCTPDEVALAAKAREHLALYRKNEDLISIGAY 397

Query: 396 RPGVDLILDKAVHQVPIIYDFLKQSPSDLSS-EDVFQEITKKL 437
           + G +  LD+A+     +  FL+Q   + +  E  FQ + K L
Sbjct: 398 QKGANAALDRAIALHEPLRGFLRQPIEEHTPREQSFQLLKKIL 440


>gi|168180916|ref|ZP_02615580.1| flagellar protein export ATPase FliI [Clostridium botulinum NCTC
           2916]
 gi|182668289|gb|EDT80268.1| flagellar protein export ATPase FliI [Clostridium botulinum NCTC
           2916]
          Length = 438

 Score =  282 bits (722), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 167/392 (42%), Positives = 238/392 (60%), Gaps = 9/392 (2%)

Query: 49  VVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVIN 107
           +++  KN     +V+    + V + P+G    I+ G  V   G+   +  S    G+V++
Sbjct: 49  IIYNEKNQTIPCEVVGFKEENVILMPLGELIGIAPGCKVIPQGKPLSVICSENILGKVLD 108

Query: 108 ALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVF 167
            LG P++G++ +     +++  S  P  M R+R++    TGI+ ID F  +  GQRIG+F
Sbjct: 109 GLGNPLEGEELMEGSPYALD--SDPPDPMKRRRIKDVIPTGIKAIDGFITVGEGQRIGIF 166

Query: 168 AGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDE 226
           AGSG+GKST L M A+    D  +I+L+GERGREVR+FIE  LG+  LKKSV+V ATSD+
Sbjct: 167 AGSGVGKSTTLGMIAKYAEADINVIALIGERGREVRDFIEKDLGEEGLKKSVIVCATSDK 226

Query: 227 SPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSV 286
             ++R     TA  IAEYF  +G  V+L++DS+TRFA + REI    GE P  +GY  SV
Sbjct: 227 PALVRLKGAFTATAIAEYFRDQGKKVILMMDSVTRFAMAQREIGLAIGEPPATKGYTPSV 286

Query: 287 FSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEG 346
           F++LPRL+ER G S K  G+ITA  +VLVDGD+ N+PIAD+VR ILDGHIVL+RSLA + 
Sbjct: 287 FAKLPRLMERSGMSNK--GSITAFYTVLVDGDDFNEPIADAVRGILDGHIVLSRSLAAKN 344

Query: 347 RYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKA 406
            YP +D L+SVSRL  +  S + K        L+  ++ + D+  IG Y  G +  +D A
Sbjct: 345 HYPAIDILSSVSRLMSEIASKEHKNAAGMARDLLATYKNSEDLINIGAYVKGSNPKVDMA 404

Query: 407 VHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
           +H    I  FLKQ    +  +  F+E T  LQ
Sbjct: 405 IHYHESILSFLKQG---IGEQHSFEESTSILQ 433


>gi|187778751|ref|ZP_02995224.1| hypothetical protein CLOSPO_02346 [Clostridium sporogenes ATCC
           15579]
 gi|187772376|gb|EDU36178.1| hypothetical protein CLOSPO_02346 [Clostridium sporogenes ATCC
           15579]
          Length = 436

 Score =  282 bits (722), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 168/396 (42%), Positives = 239/396 (60%), Gaps = 17/396 (4%)

Query: 49  VVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWC-----G 103
           +++  KN     +V+    + V + P+G    I+ G  V   G+    P +  C     G
Sbjct: 47  IIYNEKNQTIPCEVVGFKEENVILMPLGELIGIAPGCRVIPQGK----PLSVICSENILG 102

Query: 104 RVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQR 163
           +V++ LGKP++G++ +     +++  S  P  M R+R++    TGI+ ID F  +  GQR
Sbjct: 103 KVLDGLGKPLEGEELMEGSPYALD--SDPPDPMKRRRIKDVIPTGIKAIDGFMTVGEGQR 160

Query: 164 IGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVA 222
           IG+FAGSG+GKST L M A+    D  +I+L+GERGREVR+FIE  LG+  LKKSV+V A
Sbjct: 161 IGIFAGSGVGKSTTLGMIAKYAEADINVIALIGERGREVRDFIEKDLGEEGLKKSVIVCA 220

Query: 223 TSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGY 282
           TSD+  ++R     TA  IAEYF  +G  V+L++DS+TRFA + REI    GE P  +GY
Sbjct: 221 TSDKPALVRLKGAFTATAIAEYFRDQGKKVILMMDSVTRFAMAQREIGLAIGEPPATKGY 280

Query: 283 PTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSL 342
             SVF++LPRL+ER G S K  G+ITA  +VLVDGD+ N+PIAD+VR ILDGHIVL+RSL
Sbjct: 281 TPSVFAKLPRLMERSGMSNK--GSITAFYTVLVDGDDFNEPIADAVRGILDGHIVLSRSL 338

Query: 343 AEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLI 402
           A +  YP +D L+SVSRL  +    + K        L+  ++ + D+  IG Y  G +  
Sbjct: 339 AAKNHYPAIDVLSSVSRLMSEIALKEHKDAAGMARDLLATYKNSEDLINIGAYAKGSNPK 398

Query: 403 LDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
           +D A+H    I  FLKQ    +  +  F+E T  LQ
Sbjct: 399 VDMAIHYHEPILSFLKQG---IGEQHSFEESTSILQ 431


>gi|166714020|ref|ZP_02245227.1| type III secretion system ATPase [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 442

 Score =  282 bits (722), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 158/367 (43%), Positives = 220/367 (59%), Gaps = 5/367 (1%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISP-SACWCGRVINALGKPIDGDDSL 119
           +V+  + D+  + P G    +S    V   GR    P      GRV++ LG+P DG  ++
Sbjct: 63  EVVGFSRDLALLAPFGELIGLSRETRVIGLGRPLAVPVGPALLGRVLDGLGEPSDGQGAI 122

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
              D  + I ++ P  M R+ +E    TG+R++D    L  GQR+G+FA +G+GKSTL+ 
Sbjct: 123 AC-DTWVPIQAQAPDPMRRRLIEHPMPTGVRIVDGLMTLGEGQRMGIFAAAGVGKSTLMG 181

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTA 238
           MFAR    D  +I L+GERGREVREFIE  LG D L +SVVV ATSD S I R  A    
Sbjct: 182 MFARGTQCDVNVIVLIGERGREVREFIELILGADGLARSVVVCATSDRSSIERAKAAYVG 241

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
             IAEYF  +G  VLL++DS+TRFA + REI   +GE P  RG+P SVF+ELPRLLER G
Sbjct: 242 TAIAEYFRDRGLRVLLMMDSLTRFARAQREIGLAAGEPPTRRGFPPSVFAELPRLLERAG 301

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
             E   G+ITA  +VL + D  +DPIA+ VR ILDGH++L+R +A + +YP +D LAS+S
Sbjct: 302 MGES--GSITAFYTVLAEDDTGSDPIAEEVRGILDGHLILSREIAAKNQYPAIDVLASLS 359

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+  +   +   +    L  L+ ++ E   +  +G YR G D + D+A+ ++  I DFL 
Sbjct: 360 RVMSQIVPSYHSQAAGRLRRLLAKYNEVETLVQVGEYRQGSDAVADEAIDRIDAIRDFLS 419

Query: 419 QSPSDLS 425
           Q    LS
Sbjct: 420 QPTDQLS 426


>gi|153938471|ref|YP_001391960.1| flagellar protein export ATPase FliI [Clostridium botulinum F str.
           Langeland]
 gi|152934367|gb|ABS39865.1| flagellar protein export ATPase FliI [Clostridium botulinum F str.
           Langeland]
 gi|295319979|gb|ADG00357.1| flagellar protein export ATPase FliI [Clostridium botulinum F str.
           230613]
          Length = 438

 Score =  282 bits (722), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 167/392 (42%), Positives = 238/392 (60%), Gaps = 9/392 (2%)

Query: 49  VVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVIN 107
           +++  KN     +V+    + V + P+G    I+ G  V   G+   +  S    G+V++
Sbjct: 49  IIYNEKNQTIPCEVVGFKEENVILMPLGELIGIAPGCKVIPQGKPLSVICSENILGKVLD 108

Query: 108 ALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVF 167
            LG P++G++ +     +++  S  P  M R+R++    TGI+ ID F  +  GQRIG+F
Sbjct: 109 GLGNPLEGEELMEGSPYALD--SDPPDPMKRRRIKDVIPTGIKAIDGFITVGEGQRIGIF 166

Query: 168 AGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDE 226
           AGSG+GKST L M A+    D  +I+L+GERGREVR+FIE  LG+  LKKSV+V ATSD+
Sbjct: 167 AGSGVGKSTTLGMIAKYAEADINVIALIGERGREVRDFIEKDLGEEGLKKSVIVCATSDK 226

Query: 227 SPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSV 286
             ++R     TA  IAEYF  +G  V+L++DS+TRFA + REI    GE P  +GY  SV
Sbjct: 227 PALVRLKGAFTATAIAEYFRDQGKKVILMMDSVTRFAMAQREIGLAIGEPPATKGYTPSV 286

Query: 287 FSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEG 346
           F++LPRL+ER G S K  G+ITA  +VLVDGD+ N+PIAD+VR ILDGHIVL+RSLA + 
Sbjct: 287 FAKLPRLMERSGMSNK--GSITAFYTVLVDGDDFNEPIADAVRGILDGHIVLSRSLAAKN 344

Query: 347 RYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKA 406
            YP +D L+SVSRL  +  S + K        L+  ++ + D+  IG Y  G +  +D A
Sbjct: 345 HYPAIDVLSSVSRLMSEIASKEHKDAAGMARDLLATYKNSEDLINIGAYVKGSNPKVDMA 404

Query: 407 VHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
           +H    I  FLKQ    +  +  F+E T  LQ
Sbjct: 405 IHYHESILSFLKQG---IGEQHSFEESTSILQ 433


>gi|307725651|ref|YP_003908864.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Burkholderia sp. CCGE1003]
 gi|307586176|gb|ADN59573.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Burkholderia sp. CCGE1003]
          Length = 467

 Score =  282 bits (722), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 158/388 (40%), Positives = 233/388 (60%), Gaps = 7/388 (1%)

Query: 43  VCLGDFVVHQGKNSDNL--GQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSA- 99
           V LG+    +  N   L   +VI    D+  + P     +IS    V   GR    P   
Sbjct: 66  VTLGELCELRAANGALLQHAEVIGFTRDVALLSPFSRLADISRSTRVVGLGRSLTVPVGD 125

Query: 100 CWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLC 159
              GRVI++LG+PIDG   L +      + +  P  M+R+ ++    TG+RV+D    L 
Sbjct: 126 TLLGRVIDSLGEPIDGLGPL-EATEQRPVFANPPSPMSRRMIDTPLATGVRVVDGMMTLA 184

Query: 160 HGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSV 218
            GQR+G+FA +G+GKSTLL MFAR    D  +I+L+GERGREVREF+E  LG + + +SV
Sbjct: 185 EGQRMGIFAPAGVGKSTLLGMFARGAQCDVAVIALIGERGREVREFVELILGPEGMARSV 244

Query: 219 VVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPV 278
           VV ATSD S I R  A   A  IAE+F  +G  VLL++DS+TRFA + REI   +GE P 
Sbjct: 245 VVCATSDRSSIERAKAAYVATAIAEHFRDRGQRVLLMMDSLTRFARAQREIGLAAGEPPA 304

Query: 279 ARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVL 338
            RG+P S+F+ELPRLLER G    E G+ITA+ +VL + ++ NDPIA+ VR I+DGH++L
Sbjct: 305 RRGFPPSIFAELPRLLERAG--MGEHGSITALYTVLAEDESGNDPIAEEVRGIVDGHMIL 362

Query: 339 NRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPG 398
           +R +A + +YP +D LAS+SR+  +  + +  +  + L  L+ +  E   +  IG Y+PG
Sbjct: 363 SREIAAKNQYPAIDVLASLSRVMPQVMTPEYVRAAARLRELLAKHREVELLLQIGEYQPG 422

Query: 399 VDLILDKAVHQVPIIYDFLKQSPSDLSS 426
            + + D+A+ ++  I  F  Q+  +L++
Sbjct: 423 GNPLADEAIRKIDAIRAFFNQATHELAA 450


>gi|319795604|ref|YP_004157244.1| type III secretion apparatus h+-transporting two-sector atpase
           [Variovorax paradoxus EPS]
 gi|315598067|gb|ADU39133.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Variovorax paradoxus EPS]
          Length = 457

 Score =  282 bits (722), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 162/365 (44%), Positives = 219/365 (60%), Gaps = 5/365 (1%)

Query: 59  LGQVIRINLDIVYICPVGIGEEIS-LGDLVFHWGRFRISPSACWCGRVINALGKPIDGDD 117
           L +V+    +   + P+G    IS L ++V   G       +   GRV++A+G+PIDG  
Sbjct: 72  LAEVVGFRGNTAVLTPLGPITGISALTEVVPTGGGHSCPVGSQLLGRVLDAMGQPIDGRG 131

Query: 118 SLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
            L            V P + R+ ++    TGIR ID    L  GQRIGVF+  G+GKSTL
Sbjct: 132 GLAAAARQPVHREPVNP-LARRMIDAPLPTGIRAIDALLTLGEGQRIGVFSPPGVGKSTL 190

Query: 178 LSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPL 236
           L M AR    D  +I+L+GERGREV+EFIE  LG + + KSV+VV+TS+  P+ R  +  
Sbjct: 191 LGMLARGSSADVNVIALIGERGREVKEFIEHSLGPEGMAKSVIVVSTSERPPMERIKSAH 250

Query: 237 TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLER 296
            A TIAEYF  +G  VLL++DS++RFA + REI   SGE P  R YP S+FS LP+LLER
Sbjct: 251 VATTIAEYFRDQGKKVLLLMDSLSRFARAQREIGLASGEPPTRRSYPPSIFSMLPQLLER 310

Query: 297 IGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLAS 356
            G  + E G+ITA+ SVL +GD  NDPIA+ VRSILDGH+VL+R LA   RYP +D LAS
Sbjct: 311 AG--QGESGSITAIYSVLTEGDEENDPIAEEVRSILDGHVVLSRKLAAANRYPAIDVLAS 368

Query: 357 VSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDF 416
           +SR+         +   + L  L+ +++E   +  IG Y+PG D   D AV   P I +F
Sbjct: 369 ISRVMPLVTDPAHRAAAAHLRELLSKYQEMELLVQIGEYKPGGDAQADAAVRARPAILEF 428

Query: 417 LKQSP 421
           L Q+P
Sbjct: 429 LAQAP 433


>gi|302670721|ref|YP_003830681.1| flagellar protein export ATPase FliI [Butyrivibrio proteoclasticus
           B316]
 gi|302395194|gb|ADL34099.1| flagellar protein export ATPase FliI [Butyrivibrio proteoclasticus
           B316]
          Length = 452

 Score =  282 bits (722), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 169/411 (41%), Positives = 242/411 (58%), Gaps = 25/411 (6%)

Query: 45  LGDFVVHQGKNSDN-----------LGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR- 92
           LGD  +   K  DN           + +V+    + V + P      I  G +V +    
Sbjct: 43  LGDICLIYPKKKDNETMSDSKGRPAMAEVVGFKDNHVQLMPYENTSGIGNGSIVENTDSP 102

Query: 93  FRISPSACWCGRVINALGKPIDGDDSLGKG-----DLSMEIMSKVPPAMNRQRVEKGFKT 147
            R++      G+ ++ LG+ IDG  S GKG      ++  + ++ P  M R  + +    
Sbjct: 103 LRVNVGEGLLGQTLDGLGR-IDGT-SYGKGVMLEDGVAYSVENQPPDPMTRDPISEVLSL 160

Query: 148 GIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIE 207
           G++ +D    +  GQRIG+FAGSG+GKSTLL MFAR+   D  +I+L+GERGREVREFIE
Sbjct: 161 GVKAVDGLLTVGKGQRIGIFAGSGVGKSTLLGMFARNTQADINVIALIGERGREVREFIE 220

Query: 208 DYLGDN-LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSI 266
             LG+  +K+S+VV ATSD+  + R  A  TA +IAEYF  KG +VLL++DS+TRF+ + 
Sbjct: 221 RDLGEEGMKRSIVVCATSDKPALERLKAAKTATSIAEYFRDKGKDVLLMMDSLTRFSMAQ 280

Query: 267 REIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIAD 326
           REI   SGE PV+RGYP SV++E+P+LLER G S K  G+IT + +VLVDGD+ N+PI D
Sbjct: 281 REIGLASGEPPVSRGYPPSVYAEMPKLLERAGRSRK--GSITGLYTVLVDGDDMNEPITD 338

Query: 327 SVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEET 386
           + R ILDGHIVLNR LA++  YP +D LAS+SR        + KK    L +++  + + 
Sbjct: 339 TARGILDGHIVLNRKLAQKNHYPAIDVLASISRCMSAIADPEHKKAAGKLKNVLATYNDA 398

Query: 387 RDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKL 437
            D+  IG YR G +  +D AV ++  +  FL Q   +  S   F+EI   L
Sbjct: 399 EDLINIGAYRSGANKNIDYAVSKIEQVNAFLTQETDEKFS---FEEIRDML 446


>gi|310659042|ref|YP_003936763.1| flagellum-specific ATP synthase [Clostridium sticklandii DSM 519]
 gi|308825820|emb|CBH21858.1| flagellum-specific ATP synthase [Clostridium sticklandii]
          Length = 436

 Score =  282 bits (721), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 161/382 (42%), Positives = 236/382 (61%), Gaps = 8/382 (2%)

Query: 59  LGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDD 117
           L +V+    D V + P+G  E I  G +V   G    +       GR+++ +G PID D 
Sbjct: 57  LAEVVGFKEDTVLLMPLGEMEGIGPGSMVVATGNTLEVDVGEQLLGRILDGMGNPID-DF 115

Query: 118 SLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
                + S  + ++ P  ++R ++ +    G++ ID F     GQRIG+FAGSG+GKSTL
Sbjct: 116 EPPSLNYSYPVNNQPPNPLSRTKISEPLPLGVKAIDGFLTCGRGQRIGIFAGSGVGKSTL 175

Query: 178 LSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPL 236
           L M AR+   D  +I+L+GERGREV+EFI++ L +  LKKSVV+V TSD+ P++R    L
Sbjct: 176 LGMIARNTLADINVIALIGERGREVKEFIDNDLEEEGLKKSVVIVVTSDQPPLVRMKGAL 235

Query: 237 TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLER 296
            A +IAEYF   G NV+L++DS+TRF+ + RE+    GE PV +GY  SVF+ LP+LLER
Sbjct: 236 LATSIAEYFRDCGKNVVLMMDSLTRFSMAQREVGLAIGEPPVTKGYTPSVFAVLPKLLER 295

Query: 297 IGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLAS 356
            G S K  G+IT + +VLVDGD+ N+PIAD+VR ILDGHIVL+R+LA +  YP +D LAS
Sbjct: 296 AGNSSK--GSITGLYTVLVDGDDMNEPIADAVRGILDGHIVLSRNLANKNHYPAIDILAS 353

Query: 357 VSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDF 416
           VSR+       +   +V  +  L+  + ++ D+  IG Y  G +  +D A+ ++ II +F
Sbjct: 354 VSRVMPNIVDKEHIDIVGRIKDLMATYRDSEDLINIGAYIKGTNKKVDMAIEKIEIINEF 413

Query: 417 LKQSPSDLSSEDVFQEITKKLQ 438
           L+Q   D  +   F EI + L+
Sbjct: 414 LRQGIHDRLT---FDEIVELLR 432


>gi|52080226|ref|YP_079017.1| flagellum-specific ATP synthase [Bacillus licheniformis ATCC 14580]
 gi|52785603|ref|YP_091432.1| flagellum-specific ATP synthase [Bacillus licheniformis ATCC 14580]
 gi|319645995|ref|ZP_08000225.1| FliI protein [Bacillus sp. BT1B_CT2]
 gi|52003437|gb|AAU23379.1| flagellar-specific ATP synthase [Bacillus licheniformis ATCC 14580]
 gi|52348105|gb|AAU40739.1| FliI [Bacillus licheniformis ATCC 14580]
 gi|317391745|gb|EFV72542.1| FliI protein [Bacillus sp. BT1B_CT2]
          Length = 437

 Score =  282 bits (721), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 153/359 (42%), Positives = 219/359 (61%), Gaps = 5/359 (1%)

Query: 70  VYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEI 128
           + + P      I+ G +V   G   R+   +   G+V++A G P+DG   L KG   +  
Sbjct: 66  ILLMPYLEAANIAPGSIVEATGESLRVKVGSGLIGQVVDAFGNPLDGS-VLPKGLAQVST 124

Query: 129 MSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFD 188
               P  M R  + +    G+R ID    +  GQR+G+FAGSG+GKSTL+ M AR    D
Sbjct: 125 DQAPPNPMKRPPIREKMAVGVRSIDSLLTVGKGQRVGIFAGSGVGKSTLMGMIARETAAD 184

Query: 189 KVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSS 247
             +I+LVGERGREVREFIE  LG+  LK+++VVVATSD+  ++R  A  TA  IAEYF  
Sbjct: 185 LNVIALVGERGREVREFIEKDLGEEGLKRTIVVVATSDQPALMRLKAAYTATAIAEYFRD 244

Query: 248 KGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNI 307
           KG NV+ ++DS+TR A + REI   +GE P  +GY  SVF+ LP+LLER G +E   G+I
Sbjct: 245 KGQNVMFMMDSVTRVAMAQREIGLATGEPPTTKGYTPSVFAILPKLLERTGTTES--GSI 302

Query: 308 TAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSA 367
           TA  +VLVDGD+ N+PIAD+VR ILDGHIVL+R+LA +G++P V+ L S+SR+       
Sbjct: 303 TAFYTVLVDGDDMNEPIADTVRGILDGHIVLDRALANKGQFPAVNILKSISRVMSNIAEK 362

Query: 368 DEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
           D  +  +    ++  ++ + D+  IG Y+ G    +D+A+   P +  FLKQ   + +S
Sbjct: 363 DHIRAANRFREMLSTYQNSEDLINIGAYKKGSSREIDEAIQFHPKLISFLKQEVDEAAS 421


>gi|168183272|ref|ZP_02617936.1| flagellar protein export ATPase FliI [Clostridium botulinum Bf]
 gi|237796099|ref|YP_002863651.1| flagellar protein export ATPase FliI [Clostridium botulinum Ba4
           str. 657]
 gi|182673660|gb|EDT85621.1| flagellar protein export ATPase FliI [Clostridium botulinum Bf]
 gi|229261134|gb|ACQ52167.1| flagellar protein export ATPase FliI [Clostridium botulinum Ba4
           str. 657]
          Length = 438

 Score =  282 bits (721), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 167/392 (42%), Positives = 238/392 (60%), Gaps = 9/392 (2%)

Query: 49  VVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVIN 107
           +++  KN     +V+    + V + P+G    I+ G  V   G+   +  S    G+V++
Sbjct: 49  IIYNEKNQTIPCEVVGFKEENVILMPLGELIGIAPGCKVIPQGKPLSVICSENILGKVLD 108

Query: 108 ALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVF 167
            LG P++G++ +     +++  S  P  M R+R++    TGI+ ID F  +  GQRIG+F
Sbjct: 109 GLGNPLEGEELMEGSPYALD--SDPPDPMKRRRIKDVIPTGIKAIDGFITVGEGQRIGIF 166

Query: 168 AGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDE 226
           AGSG+GKST L M A+    D  +I+L+GERGREVR+FIE  LG+  LKKSV+V ATSD+
Sbjct: 167 AGSGVGKSTTLGMIAKYAEADINVIALIGERGREVRDFIEKDLGEEGLKKSVIVCATSDK 226

Query: 227 SPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSV 286
             ++R     TA  IAEYF  +G  V+L++DS+TRFA + REI    GE P  +GY  SV
Sbjct: 227 PALVRLKGAFTATAIAEYFRDQGKKVILMMDSVTRFAMAQREIGLAIGEPPATKGYTPSV 286

Query: 287 FSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEG 346
           F++LPRL+ER G S K  G+ITA  +VLVDGD+ N+PIAD+VR ILDGHIVL+RSLA + 
Sbjct: 287 FAKLPRLMERSGMSNK--GSITAFYTVLVDGDDFNEPIADAVRGILDGHIVLSRSLAAKN 344

Query: 347 RYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKA 406
            YP +D L+SVSRL  +  S + K        L+  ++ + D+  IG Y  G +  +D A
Sbjct: 345 HYPAIDILSSVSRLMSEIASKEHKDAAGMARDLLATYKNSEDLINIGAYVKGSNPKVDMA 404

Query: 407 VHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
           +H    I  FLKQ    +  +  F+E T  LQ
Sbjct: 405 IHYHESILSFLKQG---IGEQHSFEESTSILQ 433


>gi|148269842|ref|YP_001244302.1| flagellar protein export ATPase FliI [Thermotoga petrophila RKU-1]
 gi|147735386|gb|ABQ46726.1| type III secretion system ATPase, FliI/YscN [Thermotoga petrophila
           RKU-1]
          Length = 427

 Score =  282 bits (721), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 165/390 (42%), Positives = 242/390 (62%), Gaps = 11/390 (2%)

Query: 50  VHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINA 108
           +  GKN+  L +V+    + V + P      + +   V    +   +  S    GRV + 
Sbjct: 38  LQNGKNA--LAEVVGFREESVILMPYEDVSGLKMSCEVIRTNKVLEVGVSRKMIGRVFDG 95

Query: 109 LGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFA 168
           LG+PIDG   + +      + +  P  + R+R++     GIR ID    +  GQRIG+FA
Sbjct: 96  LGRPIDGKPFVPED--RYPLTNNPPNPLKRRRIKDPLPVGIRSIDGLITVGKGQRIGIFA 153

Query: 169 GSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDES 227
           GSG+GKSTLL M AR+   D  +++L+GERGREVREFIE  LG+  LK+S++VV+TSD+ 
Sbjct: 154 GSGVGKSTLLGMIARNTTADVNVLALIGERGREVREFIERDLGEEGLKRSILVVSTSDQP 213

Query: 228 PILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVF 287
            + R  + LTA +IAE+F   G +VLL++DS+TR+A + RE+    GE P  RGYP SVF
Sbjct: 214 ALARVKSLLTATSIAEFFRDLGYDVLLMVDSLTRWAMAQREVGLAVGEPPTTRGYPPSVF 273

Query: 288 SELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGR 347
           + LP++LER G S+K  G+ITA+ +VLV+ D+ N+PI+D+VRSI+DGHI+L+R LAE   
Sbjct: 274 AGLPKILERAGNSDK--GSITAIYTVLVEADDFNEPISDTVRSIVDGHIILSRRLAESNH 331

Query: 348 YPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAV 407
           YP VD LASVSRL +   + + ++  + L  L+  +E  +D+  IG Y+ G + ++DKAV
Sbjct: 332 YPAVDVLASVSRLMNDIVTEEHREAANRLRSLMSAYESAKDLIEIGAYKSGTNPLVDKAV 391

Query: 408 HQVPIIYDFLKQSPSDLSSEDVFQEITKKL 437
                I  FLKQ   + SS   F+E  +KL
Sbjct: 392 EMKDEIDSFLKQGVFEKSS---FEETLQKL 418


>gi|304438475|ref|ZP_07398415.1| flagellar protein export ATPase FliI [Selenomonas sp. oral taxon
           149 str. 67H29BP]
 gi|304368558|gb|EFM22243.1| flagellar protein export ATPase FliI [Selenomonas sp. oral taxon
           149 str. 67H29BP]
          Length = 458

 Score =  282 bits (721), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 165/371 (44%), Positives = 230/371 (61%), Gaps = 10/371 (2%)

Query: 70  VYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDS-LGKGDLSME 127
           V + PVG  + I  G  V   GR  R+       GRV++ LG PIDG    L K +  ++
Sbjct: 80  VLLMPVGEMQGIGPGCEVVATGRQLRVKVGMELLGRVLDGLGNPIDGKGPILAKEEYPLQ 139

Query: 128 IMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCF 187
             +  PP + R R+      G+R ID    +  GQRIG+ AGSG+GKSTLLSM AR+   
Sbjct: 140 --APPPPPLTRPRIHDNLYVGVRAIDGLITMGDGQRIGIMAGSGVGKSTLLSMIARNTEA 197

Query: 188 DKVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFS 246
           D  +I+LVGERGREVR+FIE  LG+  LK+SVVVVATSD+  ++R    +T   IAEYF 
Sbjct: 198 DISVITLVGERGREVRDFIERDLGEEGLKRSVVVVATSDQPALVRIKGAMTGTAIAEYFR 257

Query: 247 SKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGN 306
            +G  V+L++DS+TRFA + RE+    GE P  RGY  SVF+ LPRLLER G SEK  G+
Sbjct: 258 DQGRKVVLMMDSVTRFAMAQREVGLTIGEPPATRGYTPSVFAMLPRLLERAGTSEK--GS 315

Query: 307 ITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWS 366
           IT + +VLVDGD+ N+PIAD+VRSILDGHIVL+R +A +  +P +D L+SVSR+  +  +
Sbjct: 316 ITGIYTVLVDGDDMNEPIADAVRSILDGHIVLSRRIAAQNHFPAIDVLSSVSRVMYEVVA 375

Query: 367 ADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
            +  +    +  L+  ++E  D+  IG Y  G    +D A+ ++  I DFL Q   +++S
Sbjct: 376 KNHLEAAQEMRQLMAVYQEAEDLIHIGAYVKGSSPKIDAAIQKIDGINDFLCQGIYEVTS 435

Query: 427 EDVFQEITKKL 437
              + E  ++L
Sbjct: 436 ---YAETEQQL 443


>gi|317407757|gb|EFV87684.1| BscN protein [Achromobacter xylosoxidans C54]
          Length = 455

 Score =  282 bits (721), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 157/388 (40%), Positives = 232/388 (59%), Gaps = 10/388 (2%)

Query: 43  VCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISP-SACW 101
           VCL   + + G++ +  G+V+    D   + PVG    IS    V   GR  + P  A  
Sbjct: 60  VCL---LRNPGEDFEMKGEVVGFVKDAALLTPVGDMHGISSSTEVIPTGRSHMVPVGAGL 116

Query: 102 CGRVINALGKPIDGDDSLGKGDLS--MEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLC 159
            GRV++ LG+P+D D  LG  + S    + +  P  + R+ + +  + G+R +D      
Sbjct: 117 LGRVLDGLGRPLDAD-RLGPLEASKFYPVFADAPDPLTRRIIHEPLELGVRALDGLLTCG 175

Query: 160 HGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSV 218
            GQR+G+FA +G GKSTL+ M  +    D  +++L+GERGREVREF+E  LG D  ++SV
Sbjct: 176 EGQRMGIFAAAGGGKSTLMGMLVKGAAVDVTVVALIGERGREVREFLEHELGEDGRRRSV 235

Query: 219 VVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPV 278
           +V ATSD+S + R  A   A  IAEYF  +G  VL ++DS+TRFA + REI   +GE P 
Sbjct: 236 IVCATSDKSSMERAKAAYVATAIAEYFRDQGKKVLFLMDSVTRFARAQREIGLAAGEPPT 295

Query: 279 ARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVL 338
            RGYP SVF+ LPRL+ER+G ++K  G+ITA+ +VLV+GD+  +P+AD  RSILDGHIVL
Sbjct: 296 RRGYPPSVFATLPRLMERVGMNDK--GSITALYTVLVEGDDMTEPVADETRSILDGHIVL 353

Query: 339 NRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPG 398
           +R LA    YP +D LAS SR+ +     + K     +  L+ +++E   +  IG Y+PG
Sbjct: 354 SRKLAASNHYPAIDVLASASRVMNAVVRPEHKAAAGRIRELMAKYQEVELLVKIGEYKPG 413

Query: 399 VDLILDKAVHQVPIIYDFLKQSPSDLSS 426
            D   D+A+ ++  I  FL+Q   + S+
Sbjct: 414 GDAATDEALRKIDAIRGFLRQRTEERST 441


>gi|167750727|ref|ZP_02422854.1| hypothetical protein EUBSIR_01705 [Eubacterium siraeum DSM 15702]
 gi|167656406|gb|EDS00536.1| hypothetical protein EUBSIR_01705 [Eubacterium siraeum DSM 15702]
 gi|291532062|emb|CBK97647.1| type III secretion system ATPase, FliI/YscN [Eubacterium siraeum
           70/3]
 gi|291558201|emb|CBL35318.1| type III secretion system ATPase, FliI/YscN [Eubacterium siraeum
           V10Sc8a]
          Length = 434

 Score =  282 bits (721), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 158/380 (41%), Positives = 233/380 (61%), Gaps = 18/380 (4%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWG-RFRISPSACWCGRVINALGKPIDGDDSL 119
           +V+  N   V + P    E I  G +V + G +  +       GR+I+ALG P+D  + +
Sbjct: 57  EVVGFNEHKVLLMPYTDLEGIGPGSIVDNTGDKLNVRVGDKLIGRIIDALGNPLDDGEPI 116

Query: 120 GKGDLSMEIMSKVPPA------MNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIG 173
                  E    VP A      + R ++ +  + G++ ID    +  GQR+G+FAGSG+G
Sbjct: 117 -------EYTDTVPIAGIPVNPLTRPKIHEPIELGVKAIDGLLTMGKGQRMGIFAGSGVG 169

Query: 174 KSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATSDESPILRK 232
           KSTL+ M AR    D  +I+LVGERGREVREFIE+ LG+  + +SVVVVATSD+  ++R 
Sbjct: 170 KSTLMGMIARKVKADLNVIALVGERGREVREFIENDLGEEGMARSVVVVATSDQPAMMRN 229

Query: 233 MAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPR 292
             P+TA  IAEYF S+G +VLL++D++TRFA + REI  ++GE PVARGY  S+++ +P+
Sbjct: 230 KCPMTATAIAEYFCSQGKDVLLMMDNLTRFAMAQREIGLSTGEPPVARGYTPSIYAAMPK 289

Query: 293 LLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVD 352
           LLER G    EKG+IT + +VLV+GD+ N+PI+D+VR I+DGHIVL+R +A +  YP +D
Sbjct: 290 LLERAG--NFEKGSITGIYAVLVEGDDTNEPISDTVRGIIDGHIVLSRKIAAQNHYPAID 347

Query: 353 PLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPI 412
            L S+SRL       +  K    L +L+  +    D+  IG Y+ G +  LD+A+ ++  
Sbjct: 348 ILPSISRLMSAIADPEHNKAAGKLRNLLALYNNNADLISIGAYKKGTNPALDEAIKKIDK 407

Query: 413 IYDFLKQSPSD-LSSEDVFQ 431
           I DFL Q   +  S ED  +
Sbjct: 408 INDFLMQGMYESFSMEDTIK 427


>gi|332559808|ref|ZP_08414130.1| FliI2 [Rhodobacter sphaeroides WS8N]
 gi|332277520|gb|EGJ22835.1| FliI2 [Rhodobacter sphaeroides WS8N]
          Length = 436

 Score =  281 bits (720), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 169/414 (40%), Positives = 244/414 (58%), Gaps = 2/414 (0%)

Query: 11  LAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIV 70
           LAE  +  L  + G ++ I     +V  L Q   LGD V   G      G+V+R++   V
Sbjct: 9   LAEIAAIPLSRRYGRVTGIGRGTLSVGGLEQGTALGDRVEICGAGGILGGEVLRLSSHEV 68

Query: 71  YICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMS 130
            I P G  E +++GD V   G   I+P   W GR+++ LG+P+DG   L +G  +  + +
Sbjct: 69  AILPDGSPEGLAIGDAVALVGPAEIAPDDSWIGRIVDPLGRPLDGR-PLFRGPRARPLRA 127

Query: 131 KVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKV 190
             PPA  R+ +     TG+ V D   PL  GQRIG+FAGSG+GKS+LL+ FARS   D V
Sbjct: 128 AAPPAAARRSLGPRLPTGVAVFDTLLPLVQGQRIGLFAGSGVGKSSLLAKFARSVVADVV 187

Query: 191 IISLVGERGREVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKG 249
           +I LVGERGRE+REF E  LG   + ++VVV ATSD+SP++R+     A+ +AE+F  +G
Sbjct: 188 VIGLVGERGRELREFTERVLGPAGMARAVVVTATSDQSPLVRRRCGWAAMAVAEHFRDQG 247

Query: 250 DNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITA 309
            +VLL++DSITRFA + RE+A   GE    RG+P S    +  L ER GP  +  G+ITA
Sbjct: 248 LHVLLLVDSITRFAEAHREVALAGGEAASMRGFPPSTAHTIMALAERAGPGAEGTGDITA 307

Query: 310 VISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADE 369
           V+SVLV G +  +P+AD +R +LDGH+V++R +AE GR+P +D L SVSR   +A S  E
Sbjct: 308 VLSVLVAGSDMEEPVADILRGVLDGHVVMDRKIAERGRFPAIDLLRSVSRALPEAASMAE 367

Query: 370 KKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSD 423
             L++    L+  ++    +   G Y  G D ++D A+   P +  FL +   D
Sbjct: 368 NALIAEARRLLGAWDRAEMMIQAGLYARGSDPLVDAAIRVWPALDAFLAEDAPD 421


>gi|294500936|ref|YP_003564636.1| flagellum-specific ATP synthase [Bacillus megaterium QM B1551]
 gi|294350873|gb|ADE71202.1| flagellum-specific ATP synthase [Bacillus megaterium QM B1551]
          Length = 437

 Score =  281 bits (720), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 166/388 (42%), Positives = 239/388 (61%), Gaps = 9/388 (2%)

Query: 44  CLGDF-VVHQGKNSDNL-GQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSAC 100
            +GD   +H  +  D +  +V+  N + V + P      I  G LV    +  ++S    
Sbjct: 38  SIGDVCFIHLSERGDKIRAEVVGFNGEHVILMPYTSVRYIGPGCLVETTEKPLQVSVGKE 97

Query: 101 WCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPP-AMNRQRVEKGFKTGIRVIDIFTPLC 159
             G+V+++LG P+DG +      L   +  + PP  + R  +E+  + G+R ID    + 
Sbjct: 98  LIGQVLDSLGNPLDGSEL--SHYLPFVLTDQDPPNPLERPPIEQPIEVGVRTIDSLLTVG 155

Query: 160 HGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSV 218
            GQRIG+FAGSG+GKSTLL M AR+   D  +I+LVGERGREVREFIE  LG+  LK+SV
Sbjct: 156 QGQRIGIFAGSGVGKSTLLGMIARNTKADINVIALVGERGREVREFIERDLGEEGLKRSV 215

Query: 219 VVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPV 278
           VVVATSD+  +LR  A  TA +IAEYF  +G +V++++DS+TR A + REI    GE P 
Sbjct: 216 VVVATSDQPALLRMKAAYTATSIAEYFRDEGLSVMMMMDSVTRVAMAQREIGLAVGEPPT 275

Query: 279 ARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVL 338
            +GY  SVF+ LPRLLER G ++   G+ITA  +VLVDGD+ N+PI+D+VR I+DGHIVL
Sbjct: 276 TKGYTPSVFASLPRLLERTGTNQH--GSITAFYTVLVDGDDMNEPISDTVRGIIDGHIVL 333

Query: 339 NRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPG 398
           +R LA +G+YP ++ L SVSR+ +   S   K+    L  L+  +  + D+  IG Y+ G
Sbjct: 334 DRELANKGQYPAINVLKSVSRVMNHIVSERHKEAAEKLRSLMATYANSEDLINIGAYKRG 393

Query: 399 VDLILDKAVHQVPIIYDFLKQSPSDLSS 426
               +D+A+H  P+I  FLKQ  ++  S
Sbjct: 394 SSAYIDEAIHYHPVIDAFLKQKTNEHPS 421


>gi|302872568|ref|YP_003841204.1| ATPase, FliI/YscN family [Caldicellulosiruptor obsidiansis OB47]
 gi|302575427|gb|ADL43218.1| ATPase, FliI/YscN family [Caldicellulosiruptor obsidiansis OB47]
          Length = 434

 Score =  281 bits (720), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 148/328 (45%), Positives = 214/328 (65%), Gaps = 4/328 (1%)

Query: 93  FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVI 152
           F I       GR+++ LG+PIDG   + K  +   + ++ P  + R R++     GI+ I
Sbjct: 90  FEIKVGNELLGRILDGLGQPIDGKGEI-KSKIKYPVENRAPNPLERPRIDTIMPLGIKAI 148

Query: 153 DIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIE-DYLG 211
           D    +  GQR+G+FAGSG+GKSTLL M AR+   D  +++L+GERGRE++EF+E D   
Sbjct: 149 DALLTIGRGQRVGIFAGSGVGKSTLLGMIARNAKADVNVLALIGERGRELKEFLEKDLKE 208

Query: 212 DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIAT 271
           + LK+SVVVVATSDES + R  A   A+ IAEYF  +G +VL ++DS+TRFA + REI  
Sbjct: 209 EGLKRSVVVVATSDESALKRVKAAYVAMAIAEYFRDQGLDVLFLMDSLTRFAMAQREIGL 268

Query: 272 NSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSI 331
             GE PV+RGY  SVFS +P+LLER G  + +KG+ITA+ +VLVDGD+ N+PI D+ R I
Sbjct: 269 AIGEPPVSRGYTPSVFSIMPKLLERAG--KNQKGSITALFTVLVDGDDFNEPITDTARGI 326

Query: 332 LDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRL 391
           LDGHIVL+R++A +  YP VD LAS+SR+ +    +  ++L +    ++  + E  D+  
Sbjct: 327 LDGHIVLSRAIANKNHYPAVDVLASISRVMNDIVESSHRELANETKRILAVYREAEDLIN 386

Query: 392 IGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
           IG Y  G +  +D+A+  VP I  FL+Q
Sbjct: 387 IGAYTKGSNPEIDRAIELVPRINQFLRQ 414


>gi|170758369|ref|YP_001787980.1| flagellar protein export ATPase FliI [Clostridium botulinum A3 str.
           Loch Maree]
 gi|169405358|gb|ACA53769.1| flagellar protein export ATPase FliI [Clostridium botulinum A3 str.
           Loch Maree]
          Length = 438

 Score =  281 bits (720), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 168/392 (42%), Positives = 238/392 (60%), Gaps = 9/392 (2%)

Query: 49  VVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVIN 107
           +++  KN     +V+    + V + P+G    I+ G  V   G+   +  S    G+V++
Sbjct: 49  IIYNEKNQTIPCEVVGFKEENVILMPLGELIGIAPGCKVIPQGKPLSVICSENILGKVLD 108

Query: 108 ALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVF 167
            LG P++G++ +     +++  S  P  M R+R++    TGI+ ID F  +  GQRIG+F
Sbjct: 109 GLGNPLEGEELMEGSPYALD--SDPPDPMKRRRIKDVIPTGIKAIDGFITVGEGQRIGIF 166

Query: 168 AGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDE 226
           AGSG+GKST L M A+    D  +I+L+GERGREVR+FIE  LG+  LKKSV+V ATSD+
Sbjct: 167 AGSGVGKSTTLGMIAKYAEADINVIALIGERGREVRDFIEKDLGEEGLKKSVIVCATSDK 226

Query: 227 SPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSV 286
             ++R     TA  IAEYF  +G  V+L++DS+TRFA + REI    GE P  +GY  SV
Sbjct: 227 PALVRLKGAFTATAIAEYFRDQGKKVILMMDSVTRFAMAQREIGLAIGEPPATKGYTPSV 286

Query: 287 FSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEG 346
           F++LPRL+ER G S K  G+ITA  +VLVDGD+ N+PIAD+VR ILDGHIVL+RSLA + 
Sbjct: 287 FAKLPRLMERSGMSNK--GSITAFYTVLVDGDDFNEPIADAVRGILDGHIVLSRSLAAKN 344

Query: 347 RYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKA 406
            YP +D L+SVSRL  +  S + K        L+  ++ + D+  IG Y  G +  +D A
Sbjct: 345 HYPAIDILSSVSRLMSEIASKEHKNAAGMARDLLATYKNSEDLINIGAYVKGSNPKVDMA 404

Query: 407 VHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
           +H    I  FLKQ   +  S   F+E T  LQ
Sbjct: 405 IHYHESIISFLKQGIGEHHS---FKESTSILQ 433


>gi|311695214|gb|ADP98087.1| flagellum-specific ATP synthase FliI [marine bacterium HP15]
          Length = 464

 Score =  281 bits (720), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 155/391 (39%), Positives = 229/391 (58%), Gaps = 4/391 (1%)

Query: 32  VYYTVTCLSQYVCLGDFVVHQGKNSDNL-GQVIRINLDIVYICPVGIGEEISLGDLVFHW 90
           V  T+ C+   + +GD  V  G+N+ N+  +V+    D VY+ P+   E +  G  V   
Sbjct: 32  VGLTLECVGCPMVVGDRCVIFGQNTGNVEAEVVGFEDDRVYLMPLTAIEGLKPGARVVPL 91

Query: 91  -GRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGI 149
               R+       GRV++  G+P+DG   L + +  + +   +   +NR  V +    GI
Sbjct: 92  SAASRVPVGPQLLGRVVDGSGEPLDGKGPL-QAEARVALTGDIINPLNRAPVRQSMDVGI 150

Query: 150 RVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDY 209
           R I+    +  GQR+G+FAGSG+GKS LL M  R    D  ++ L+GERGREV+EFIED 
Sbjct: 151 RAINALMTVGQGQRLGLFAGSGVGKSMLLGMMTRFTDADITVVGLIGERGREVKEFIEDI 210

Query: 210 LGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIRE 268
           LG+  L +SVVV A +D+SP++R  A +    IAEY+  +G  VLL++DS+TR+A + RE
Sbjct: 211 LGEEGLSRSVVVAAPADDSPLMRLRAAMLTTRIAEYYRDQGKRVLLLMDSLTRYAQAQRE 270

Query: 269 IATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSV 328
           IA   GE P  +GYP SVF++LP+L+ER G      G+ITA  +VL +GD+  DPIAD+ 
Sbjct: 271 IALAVGEPPATKGYPPSVFAKLPQLVERTGNGRPGGGSITAFYTVLTEGDDQQDPIADAA 330

Query: 329 RSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRD 388
           R+ILDGHIVL+R LAEEG YP +D  AS+SR+  +    +          +  R+++ RD
Sbjct: 331 RAILDGHIVLSRRLAEEGHYPAIDVEASISRVMPQVTETEHFSRAQRFKQVYSRYQQARD 390

Query: 389 IRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
           +  +G Y  G D   D A+  +  +  FL+Q
Sbjct: 391 LISVGAYVKGSDPETDFAITHIGNMRQFLQQ 421


>gi|157364752|ref|YP_001471519.1| flagellar protein export ATPase FliI [Thermotoga lettingae TMO]
 gi|157315356|gb|ABV34455.1| flagellar protein export ATPase FliI [Thermotoga lettingae TMO]
          Length = 436

 Score =  281 bits (720), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 150/328 (45%), Positives = 215/328 (65%), Gaps = 4/328 (1%)

Query: 92  RFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRV 151
           R  +  S    GR+++ LG+PIDG   + K      +++  P  + R R+      G+R 
Sbjct: 92  RLDVGVSEDMKGRIVDGLGRPIDGKPLIAKH--RYPLINSAPHPLKRSRITAPLPVGVRA 149

Query: 152 IDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG 211
           ID F  +  GQRIG+FAGSG+GKSTLL M AR+   D  +I+L+GERGREVREFIE  L 
Sbjct: 150 IDGFITIGKGQRIGIFAGSGVGKSTLLGMIARNTVADVNVIALIGERGREVREFIEKDLA 209

Query: 212 DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIAT 271
             ++KS+VVV+TSD+  ++R  A  TA +IAEYF   G +VLL++DS+TR+A + REI  
Sbjct: 210 KGIEKSIVVVSTSDQPALMRSKALYTATSIAEYFRDLGYDVLLMVDSLTRWAMAQREIGL 269

Query: 272 NSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSI 331
             GE P ARGYP SVF+ +P +LER G S  +KG+ITA+ +VLV+ D+ N+PI+D+VRS+
Sbjct: 270 AIGEPPTARGYPPSVFAGIPGILERAGNS--DKGSITAIYTVLVEADDFNEPISDTVRSV 327

Query: 332 LDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRL 391
           +DGHI+L+R L+E   YP +D LASVSRL       D  +   +L +L+  + E +D+  
Sbjct: 328 VDGHIMLSRRLSELNHYPAIDVLASVSRLMVDIVGHDHLEASRNLRNLMATYYEAKDLID 387

Query: 392 IGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
           +G Y+PG +  +D+A+  +  I  FLKQ
Sbjct: 388 VGAYKPGSNPQIDRAIKMIDPINSFLKQ 415


>gi|15895428|ref|NP_348777.1| flagellar-Type ATPase [Clostridium acetobutylicum ATCC 824]
 gi|15025152|gb|AAK80117.1|AE007716_6 Flagellar-Type ATPase [Clostridium acetobutylicum ATCC 824]
 gi|325509574|gb|ADZ21210.1| Flagellar-Type ATPase [Clostridium acetobutylicum EA 2018]
          Length = 438

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 164/392 (41%), Positives = 238/392 (60%), Gaps = 9/392 (2%)

Query: 49  VVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWG-RFRISPSACWCGRVIN 107
           +++  +N     +V+  N   V + P+G  E IS G  V   G    +  S    G+V++
Sbjct: 47  IIYNERNRPIKCEVVGFNEGRVILMPLGELEGISPGCRVVQTGIPLSVKCSDELLGKVLD 106

Query: 108 ALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVF 167
            LG P+ G++   K  +  ++  + P  + R+R++   +TG+R ID F     GQRIG+F
Sbjct: 107 GLGAPLRGEEV--KSGVLYQLDREPPDPLKRRRIKNSIETGVRAIDGFLTCGEGQRIGIF 164

Query: 168 AGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDE 226
           AGSG+GKST L M AR    D  +I+L+GERGREV +FIE  LG+  +K+SV+V ATSD+
Sbjct: 165 AGSGVGKSTTLGMIAREAKADVNVIALIGERGREVLDFIEKDLGEEGMKRSVIVCATSDK 224

Query: 227 SPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSV 286
             ++R     TA  IAEYF  KG  V+L++DS+TRFA + RE+   +GE P  +GY  SV
Sbjct: 225 PALVRLKGAFTATAIAEYFRDKGKKVILMMDSVTRFAMAQREVGLATGEPPATKGYTPSV 284

Query: 287 FSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEG 346
           F+ LPRL+ER G +E   G+ITA  +VLVDGD+ N+PIAD+VRSILDGHIVL+R+LA + 
Sbjct: 285 FAMLPRLMERSGMAET--GSITAFYTVLVDGDDFNEPIADAVRSILDGHIVLSRNLAAQN 342

Query: 347 RYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKA 406
            YP +D L+SVSRL  +   +D KK       L+  +++  D+  IG Y  G +  +D A
Sbjct: 343 HYPAIDVLSSVSRLMSEIADSDHKKAAGLARDLLAEYKKNEDLINIGAYVKGTNNKVDAA 402

Query: 407 VHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
           ++    I  +LKQ   + SS   F+E    L+
Sbjct: 403 INYNDRIISYLKQGIEEKSS---FEESINSLK 431


>gi|170756099|ref|YP_001782276.1| flagellar protein export ATPase FliI [Clostridium botulinum B1 str.
           Okra]
 gi|169121311|gb|ACA45147.1| flagellar protein export ATPase FliI [Clostridium botulinum B1 str.
           Okra]
          Length = 438

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 166/392 (42%), Positives = 238/392 (60%), Gaps = 9/392 (2%)

Query: 49  VVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVIN 107
           +++  KN     +V+    + V + P+G    I+ G  V   G+   +  S    G+V++
Sbjct: 49  IIYNEKNQTIPCEVVGFKEENVILMPLGELIGIAPGCKVIPQGKPLSVICSENILGKVLD 108

Query: 108 ALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVF 167
            LG P++G++ +     +++  S  P  M R+R++    TGI+ ID F  +  GQRIG+F
Sbjct: 109 GLGNPLEGEELMEGSPYALD--SDPPDPMKRRRIKDVIPTGIKAIDGFITVGEGQRIGIF 166

Query: 168 AGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDE 226
           AGSG+GKST L M A+    D  +I+L+GERGREVR+FIE  LG+  LKKSV+V ATSD+
Sbjct: 167 AGSGVGKSTTLGMIAKYAEADINVIALIGERGREVRDFIEKDLGEEGLKKSVIVCATSDK 226

Query: 227 SPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSV 286
             ++R     TA  IAEYF  +G  V+L++DS+TRFA + REI    GE P  +GY  SV
Sbjct: 227 PALVRLKGAFTATAIAEYFRDQGKKVILMMDSVTRFAMAQREIGLAIGEPPATKGYTPSV 286

Query: 287 FSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEG 346
           F++LPRL+ER G S K  G+ITA  +VLVDGD+ N+PIAD+VR ILDGHIVL+RSLA + 
Sbjct: 287 FAKLPRLMERSGMSNK--GSITAFYTVLVDGDDFNEPIADAVRGILDGHIVLSRSLAAKN 344

Query: 347 RYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKA 406
            YP +D L+SVSRL  +  S + K        L+  ++ + D+  IG Y  G +  +D +
Sbjct: 345 HYPAIDILSSVSRLMSEIASKEHKNAAGMARDLLATYKNSEDLINIGAYVKGSNPKVDMS 404

Query: 407 VHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
           +H    I  FLKQ    +  +  F+E T  LQ
Sbjct: 405 IHYHESILSFLKQG---IGEQHSFEESTSILQ 433


>gi|302389661|ref|YP_003825482.1| type III secretion system ATPase, FliI/YscN [Thermosediminibacter
           oceani DSM 16646]
 gi|302200289|gb|ADL07859.1| type III secretion system ATPase, FliI/YscN [Thermosediminibacter
           oceani DSM 16646]
          Length = 439

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 159/363 (43%), Positives = 226/363 (62%), Gaps = 5/363 (1%)

Query: 59  LGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISP-SACWCGRVINALGKPIDGDD 117
           L +V+    D + + P+G  E I  GD V   G+    P      GR+++ LG PIDG  
Sbjct: 58  LAEVVGFRDDTLILMPLGDMEGIGPGDEVEATGKKLTVPVGEQLLGRILDGLGTPIDGKG 117

Query: 118 SLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
            + K  +   + +  P  + R  +      GI+VID       GQR+G+FAGSG+GKSTL
Sbjct: 118 PV-KSHIHYPLFNSPPNPVERAPITSPLPLGIKVIDTLLTCGRGQRVGIFAGSGVGKSTL 176

Query: 178 LSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPL 236
           L M AR+   D  +I+L+GERGRE+  F+   LG+  LK+SVVVVATSD+SP++R  A  
Sbjct: 177 LGMIARNTKADVNVIALIGERGRELNSFLMKDLGEEGLKRSVVVVATSDKSPLIRTKAAF 236

Query: 237 TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLER 296
           TA  IAEYF  +G +V+L++DS+TRFA + RE+   +GE PV +GY  SVF+ LP+LLER
Sbjct: 237 TATAIAEYFRDQGLDVMLMMDSVTRFAMAQREVGLAAGEPPVTKGYTPSVFAILPKLLER 296

Query: 297 IGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLAS 356
            G S    G+IT + +VLV+GD+ N+PI+D+VR ILDGHIVL+R+LA    YP +D LAS
Sbjct: 297 AGTS--SAGSITGIYTVLVEGDDLNEPISDTVRGILDGHIVLSRTLANRNHYPAIDVLAS 354

Query: 357 VSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDF 416
           +SRL +   S + +KL + +  LI  + E  D+  IG Y  G +  +D+A+  +  I +F
Sbjct: 355 ISRLMNDVISDEHRKLAAKVKSLISIYNEAEDLINIGAYVRGSNPKIDEALKYIDDIRNF 414

Query: 417 LKQ 419
           L Q
Sbjct: 415 LVQ 417


>gi|212639564|ref|YP_002316084.1| flagellum-specific ATP synthase [Anoxybacillus flavithermus WK1]
 gi|212561044|gb|ACJ34099.1| Flagellar biosynthesis/type III secretory pathway ATPase FliI
           [Anoxybacillus flavithermus WK1]
          Length = 437

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 154/362 (42%), Positives = 225/362 (62%), Gaps = 5/362 (1%)

Query: 60  GQVIRINLDIVYICPVGIGEEISLGDLV-FHWGRFRISPSACWCGRVINALGKPIDGDDS 118
            +V+    + V + P    ++I+ G +V    G   +   +   GRVI+ALG P+D D  
Sbjct: 57  AEVVGFRDEYVLLMPYATVQDIAPGCIVEATGGPLEMKVGSALVGRVIDALGAPLD-DQP 115

Query: 119 LGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLL 178
             KG  ++ I  + P  M R  + +  + G+++ID    +  GQR+G+FAGSG+GKSTL+
Sbjct: 116 FPKGLTAVPIDRQPPNPMTRPPISEPIEVGVKMIDSLLTVGKGQRVGIFAGSGVGKSTLM 175

Query: 179 SMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLT 237
            M AR+   D  +I+L+GERGREVREFIE  LG + LK+S+V+VATSD+  ++R     T
Sbjct: 176 GMIARNTNADLNVIALIGERGREVREFIERDLGPEGLKRSIVIVATSDQPALMRIKGAYT 235

Query: 238 AVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERI 297
           A  IAEYF  +G NV+ ++DS+TR A + RE+    GE P  +GY  SVF+ LP+LLER 
Sbjct: 236 ATAIAEYFRDQGLNVMFMMDSVTRVAMAQREVGLAVGEPPTTKGYTPSVFAILPKLLERT 295

Query: 298 GPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASV 357
           G +E   G ITA  +VLVDGD+ N+PIAD+VR ILDGH VL R LA +G+YP ++ L SV
Sbjct: 296 GTNEH--GTITAFYTVLVDGDDMNEPIADTVRGILDGHFVLERQLANKGQYPAINVLKSV 353

Query: 358 SRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFL 417
           SR+ +   + + +K+   L  L+  + ++ D+  IG Y+ G    +D+A+   P I  FL
Sbjct: 354 SRVMNYIVTPEHRKVAEKLRELLATYVQSEDLIQIGAYKRGSSREIDEAIRYYPKIISFL 413

Query: 418 KQ 419
           KQ
Sbjct: 414 KQ 415


>gi|218673217|ref|ZP_03522886.1| flagellum-specific ATP synthase [Rhizobium etli GR56]
          Length = 175

 Score =  281 bits (719), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 129/175 (73%), Positives = 153/175 (87%)

Query: 136 MNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLV 195
           M RQRV  GFKTG+R IDIF+PLC GQR+G+FAGSG+GKSTLLSM AR+D FDKV+I+LV
Sbjct: 1   MTRQRVGTGFKTGVRAIDIFSPLCLGQRLGIFAGSGVGKSTLLSMLARADAFDKVVIALV 60

Query: 196 GERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLI 255
           GERGREVREFIED LG N+KK++ +VATSDESP+LRKMAPLTA+TIAE+F  KG+NVL I
Sbjct: 61  GERGREVREFIEDTLGSNMKKAIAIVATSDESPMLRKMAPLTAITIAEHFRDKGENVLFI 120

Query: 256 LDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAV 310
           +DS+TRFAH+IRE+AT SGE P+ARGYP SVF+ELPRLLER GP  +  G ITA+
Sbjct: 121 VDSVTRFAHAIREVATASGEPPIARGYPASVFTELPRLLERAGPGPEGAGTITAI 175


>gi|222530136|ref|YP_002574018.1| FliI/YscN family ATPase [Caldicellulosiruptor bescii DSM 6725]
 gi|222456983|gb|ACM61245.1| ATPase, FliI/YscN family [Caldicellulosiruptor bescii DSM 6725]
          Length = 431

 Score =  281 bits (719), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 156/401 (38%), Positives = 240/401 (59%), Gaps = 13/401 (3%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICP----VGIGE 79
           G+++ +  +  T+      V +G     +   ++ L +V+    + V + P    VG+  
Sbjct: 19  GFVNQVIGL--TIESQGPAVSIGTLCRIKAAKTETLAEVVGFKENKVLLMPYSDLVGV-- 74

Query: 80  EISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQ 139
                 ++     F +       GR+++ LG+PIDG   + K  +   + ++ P  + R 
Sbjct: 75  -FPGCKVIAQDSMFEVKVGKELLGRILDGLGQPIDGKGEI-KSKIKYPVENRAPNPLERP 132

Query: 140 RVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERG 199
           R++     GI+ ID    +  GQR+G+FAGSG+GKSTLL M AR+   D  +++L+GERG
Sbjct: 133 RIDTIMPLGIKAIDTLLTIGKGQRVGIFAGSGVGKSTLLGMIARNAKADVNVLALIGERG 192

Query: 200 REVREFIE-DYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDS 258
           RE++EF+E D   + LK+SVVVVATSDES + R  A   A+ IAEYF  +G +VL ++DS
Sbjct: 193 RELKEFLEKDLKEEGLKRSVVVVATSDESALKRVKAAYVAMAIAEYFRDQGLDVLFLMDS 252

Query: 259 ITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGD 318
           +TRFA + REI    GE PV+RGY  SVFS +P+LLER G  + +KG+ITA+ +VLVDGD
Sbjct: 253 LTRFAMAQREIGLAIGEPPVSRGYTPSVFSIMPKLLERAG--KNQKGSITALFTVLVDGD 310

Query: 319 NHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTH 378
           + N+PI D+ R ILDGHIVL+R++A +  YP +D LAS+SR+ +       ++L +    
Sbjct: 311 DFNEPITDTARGILDGHIVLSRAIANKNHYPAIDVLASISRVMNDIVEPSHRELANETKR 370

Query: 379 LIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
           ++  + E  D+  IG Y  G +  +D+A+  VP I  FL+Q
Sbjct: 371 VLAVYREAEDLINIGAYTKGSNPEIDRAIELVPRINQFLRQ 411


>gi|269836579|ref|YP_003318807.1| ATPase, FliI/YscN family [Sphaerobacter thermophilus DSM 20745]
 gi|269785842|gb|ACZ37985.1| ATPase, FliI/YscN family [Sphaerobacter thermophilus DSM 20745]
          Length = 442

 Score =  281 bits (718), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 152/327 (46%), Positives = 210/327 (64%), Gaps = 4/327 (1%)

Query: 103 GRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQ 162
           GRVI+ LG+PIDG   L   D    + S  P  ++R  +E    TGIR ID       GQ
Sbjct: 107 GRVIDGLGRPIDGQGPLLCRD-ETRLSSSPPDPLSRMPIEHPLPTGIRAIDALITCGRGQ 165

Query: 163 RIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVV 221
           R+G+FAGSG+GKSTLL M  R+   D  +++L+GERGREV+EFIE  LG + L +SVVVV
Sbjct: 166 RLGIFAGSGVGKSTLLGMICRNADCDVRVVALIGERGREVQEFIERDLGPEGLARSVVVV 225

Query: 222 ATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARG 281
           +TSD+  +LR  A  TA  IAEYF  +G NV L++DS+TR A + REI    GE P  RG
Sbjct: 226 STSDQPALLRLKAAWTATMIAEYFRDRGLNVALLMDSVTRLAMAQREIGLAVGEPPTTRG 285

Query: 282 YPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRS 341
           Y  SVF+ LPRLLER G    E+G+ITA  +VLV+GD+  +P+ D+VR ILDGHI L+R 
Sbjct: 286 YTPSVFALLPRLLERAG--NAERGSITAFYTVLVEGDDLTEPVTDAVRGILDGHIYLSRK 343

Query: 342 LAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDL 401
           LA+ G +P ++ L SVSRL +       ++L + +  L+  +E  RD+  IG Y  G + 
Sbjct: 344 LADSGHFPAIEVLGSVSRLMNAIVDERHRRLAAEVRELMAAYEGARDLIEIGAYAAGSNP 403

Query: 402 ILDKAVHQVPIIYDFLKQSPSDLSSED 428
           ++D+A+  +P I +FL+Q+P + +  D
Sbjct: 404 VVDRAIAHMPRIREFLRQAPDEPARMD 430


>gi|326791540|ref|YP_004309361.1| ATPase, FliI/YscN family [Clostridium lentocellum DSM 5427]
 gi|326542304|gb|ADZ84163.1| ATPase, FliI/YscN family [Clostridium lentocellum DSM 5427]
          Length = 433

 Score =  281 bits (718), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 161/401 (40%), Positives = 241/401 (60%), Gaps = 9/401 (2%)

Query: 25  YISSITSVY-YTVTCLSQYVCLGD--FVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEI 81
           Y   +T V   ++  L     +GD  ++  +GK      +V+    + + + P+G  E I
Sbjct: 18  YKGRVTRVVGMSIETLGPIANIGDICYIQPRGKKELVTAEVVGFKDEYLLLMPLGNLEGI 77

Query: 82  SLGDLVFHWG-RFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQR 140
             G  V  +G +  +       G+V++   KPI+GD+   +    + I +  P  + R R
Sbjct: 78  GPGCEVLAYGDKLSVKVDESLLGKVVDWRAKPINGDELHCR--YQVPIDNTAPNPLTRNR 135

Query: 141 VEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGR 200
           +    + G+R ID    +  GQRIG+FAGSG+GKSTL+ M AR+   D  II+L+GERGR
Sbjct: 136 ITIPLQLGVRAIDGMLTVGKGQRIGIFAGSGVGKSTLMGMIARNALSDINIIALIGERGR 195

Query: 201 EVREFIE-DYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSI 259
           EVREFIE D   + LK+S+VVVATSD+  ++R  A +TA  +AE+F ++G +VLL++DS+
Sbjct: 196 EVREFIENDLQAEGLKRSIVVVATSDQPALMRLKAAMTATALAEHFRAQGKDVLLMMDSL 255

Query: 260 TRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDN 319
           TRF+ + REI    GE PV+RGY  SVF+++P+LLER G S  +KG+IT + +VLVDGD+
Sbjct: 256 TRFSMAQREIGLAIGEPPVSRGYTPSVFAQMPKLLERAGNS--DKGSITGMYTVLVDGDD 313

Query: 320 HNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHL 379
            N+PI D+ R ILDGHIVL+R LA +G YP +D LAS+SR+     S   K     +   
Sbjct: 314 FNEPITDTARGILDGHIVLSRKLANKGHYPAIDVLASISRVMSNIVSDQHKTYAREIKKH 373

Query: 380 IHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQS 420
           +  ++E  D+  +G Y  G    +D A+ ++  I +FL QS
Sbjct: 374 MAVYKEAEDLINVGAYNKGSSEEIDAAIDKMKFINEFLCQS 414


>gi|153953781|ref|YP_001394546.1| hypothetical protein CKL_1156 [Clostridium kluyveri DSM 555]
 gi|219854397|ref|YP_002471519.1| hypothetical protein CKR_1054 [Clostridium kluyveri NBRC 12016]
 gi|146346662|gb|EDK33198.1| FliI [Clostridium kluyveri DSM 555]
 gi|219568121|dbj|BAH06105.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 439

 Score =  281 bits (718), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 173/414 (41%), Positives = 248/414 (59%), Gaps = 9/414 (2%)

Query: 18  NLVVQGGYISSITSVYYTVTCLSQYVCLGDFV-VHQGKNSDNLGQVIRINLDIVYICPVG 76
           N   Q G +  +  +   V  +  +V  G+   V+  +N +   +V+      V + P+G
Sbjct: 17  NFTYQEGIVKKVIGLTIEVEGIKAFV--GEVCNVYSEENGNIACEVVGFKEKDVILMPLG 74

Query: 77  IGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPA 135
               IS G  V    R   +  S    G+V++ LG P+ G+D +  G L  E+ ++ P  
Sbjct: 75  ELIGISPGCRVVPGRRPLSVKCSEELFGKVLDGLGNPL-GEDEISSGVL-YELDAEPPDP 132

Query: 136 MNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLV 195
           + R+R+++   TGIR ID F     GQRIG+FAGSG+GKST L M AR    D  +I+L+
Sbjct: 133 LKRKRIKQVISTGIRAIDGFLTCGEGQRIGIFAGSGVGKSTTLGMIARYAEADVNVIALI 192

Query: 196 GERGREVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLL 254
           GERGREVR+FIE  LG+  LKKS++V ATSD+  ++R     TA  IAEYF  KG  V+L
Sbjct: 193 GERGREVRDFIEKDLGEEGLKKSIIVCATSDKPALVRLKGAFTATAIAEYFRDKGKKVIL 252

Query: 255 ILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVL 314
           ++DS+TRFA + REI    GE P  +GY  SVF++LPRL+ER G S+K  G+ITA  +VL
Sbjct: 253 MMDSVTRFAMAQREIGLAVGEPPATKGYTPSVFAKLPRLMERSGMSDK--GSITAFYTVL 310

Query: 315 VDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVS 374
           VDGD+ N+PIAD+VR ILDGHIVL+RSLA +  YP +D L+S+SRL  +      KK  S
Sbjct: 311 VDGDDLNEPIADAVRGILDGHIVLSRSLANKNHYPAIDVLSSISRLMSEITEKSHKKSAS 370

Query: 375 SLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSED 428
               ++  ++ + D+  IG Y  G +  +D A++    I ++LKQ+  + SS D
Sbjct: 371 FARDMLSVYKNSEDLINIGAYIRGNNPNIDMAINYYDGIINYLKQNMDEYSSFD 424


>gi|126460779|ref|YP_001041893.1| FliI/YscN family ATPase [Rhodobacter sphaeroides ATCC 17029]
 gi|126102443|gb|ABN75121.1| ATPase, FliI/YscN family [Rhodobacter sphaeroides ATCC 17029]
          Length = 436

 Score =  281 bits (718), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 167/414 (40%), Positives = 242/414 (58%), Gaps = 2/414 (0%)

Query: 11  LAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIV 70
           LAE  +  L  + G ++ I     +V  L Q   LGD V   G      G+V+R++   V
Sbjct: 9   LAEIAAIPLSRRYGRVTGIGRGTLSVGGLEQGTALGDRVEICGAGGILGGEVLRLSAHEV 68

Query: 71  YICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMS 130
            I P G  E +++GD V   G   I+P   W GR+++ LG+P+DG   L +G  +  + +
Sbjct: 69  TILPDGSPEGLAIGDAVALVGPAEIAPDDSWIGRIVDPLGRPLDGR-PLFRGPRARPLRA 127

Query: 131 KVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKV 190
             P A  R+ +     TG+ V D   PL  GQRIG+FAGSG+GKS+LL+ FARS   D V
Sbjct: 128 AAPAAAARRSLGPRLPTGVAVFDTLLPLVQGQRIGLFAGSGVGKSSLLAKFARSVVADVV 187

Query: 191 IISLVGERGREVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKG 249
           +I LVGERGRE+R+F E  LG   + ++VVV ATSD+SP++R+     A+ +AE+F  +G
Sbjct: 188 VIGLVGERGRELRDFTERVLGPAGMARAVVVTATSDQSPLVRRRCGWAAMAVAEHFRDQG 247

Query: 250 DNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITA 309
            +VLL++DSITRFA + RE+A   GE    RG+P S    +  L ER GP  +  G+ITA
Sbjct: 248 LHVLLLVDSITRFAEAHREVALAGGEAASMRGFPPSTAHTIMALAERAGPGAEGTGDITA 307

Query: 310 VISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADE 369
           V SVLV G +  +P+AD +R +LDGH+V++R +AE GR+P +D L SVSR   +A S  E
Sbjct: 308 VFSVLVAGSDMEEPVADILRGVLDGHVVMDRKIAERGRFPAIDLLRSVSRALPEAASTAE 367

Query: 370 KKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSD 423
             L++    L+  ++    +   G Y  G D ++D A+   P +  FL +   D
Sbjct: 368 NALIAEARRLLGAWDRAEMMIQAGLYARGSDPLVDAAIRVWPALDAFLAEDAPD 421


>gi|313673741|ref|YP_004051852.1| type iii secretion system atpase, flii/yscn [Calditerrivibrio
           nitroreducens DSM 19672]
 gi|312940497|gb|ADR19689.1| type III secretion system ATPase, FliI/YscN [Calditerrivibrio
           nitroreducens DSM 19672]
          Length = 434

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 158/392 (40%), Positives = 238/392 (60%), Gaps = 6/392 (1%)

Query: 49  VVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLV--FHWGRFRISPSACWCGRVI 106
           ++  G  +  L ++I    D + + P G  E I+ G  V    +G   +  +    GR++
Sbjct: 44  LIENGSRNGILAEIIGFKDDRIVLMPYGESEGIAPGSRVRNVSYGN-SVKVTEKLLGRIL 102

Query: 107 NALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGV 166
           + LG PID    +   +L   + ++ P  + R+ ++    TG++ ID    + +GQR+G+
Sbjct: 103 DGLGNPIDDKGPITDFEL-WPVYNEPPKPLEREIIKDVIPTGVKAIDGLITVGNGQRVGI 161

Query: 167 FAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATSD 225
           FAGSG+GKS LL M AR+   +  +I+L+GERGREVREFIE  LG+  LK+SV+VVATSD
Sbjct: 162 FAGSGVGKSVLLGMIARNTSAEVNVIALIGERGREVREFIERDLGEEGLKRSVIVVATSD 221

Query: 226 ESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTS 285
           +SP++RK+    A TIAEYF S G NV+ ++DS+TRFA + REI    GE P ++GY  S
Sbjct: 222 QSPLVRKLGAFVATTIAEYFRSTGKNVMFMMDSVTRFAMAQREIGLTVGEPPTSKGYTPS 281

Query: 286 VFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEE 345
           VF+ LP+LLER G ++K +G +T + +VLV+GD+  DPIADSVRSI+DGHIVL+R LA  
Sbjct: 282 VFALLPKLLERAG-TKKGEGAVTGLYTVLVEGDDLTDPIADSVRSIIDGHIVLSRLLAAR 340

Query: 346 GRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDK 405
             +P +D L S SRL  +  + +  +L   +  L+  + E  D+  IG Y  G +  +D 
Sbjct: 341 NHFPAIDVLMSASRLMKEIVTDEHFRLAGMMRDLMAAYNEAEDLINIGAYAKGSNKRIDT 400

Query: 406 AVHQVPIIYDFLKQSPSDLSSEDVFQEITKKL 437
           A+ ++  I  FL+Q   +        E+ KK+
Sbjct: 401 AIAKIDAINSFLRQGIDEKFDFTTTYELIKKI 432


>gi|222824465|ref|YP_002576039.1| flagellum-specific ATP synthase FliI [Campylobacter lari RM2100]
 gi|222539686|gb|ACM64787.1| flagellum-specific ATP synthase FliI [Campylobacter lari RM2100]
          Length = 436

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 160/412 (38%), Positives = 235/412 (57%), Gaps = 8/412 (1%)

Query: 16  SKNLVVQGGYISSITSVYYTVTCLSQYVCLGDF---VVHQGKNSDNLGQVIRINLDIVYI 72
           S+NL    G I+ I+S    +  L     +GD    V  + ++ + +  V+ ++ ++ Y+
Sbjct: 12  SQNLTSVFGQITKISSTSIEINGLK--TSIGDIIKIVSSEDESKEAMAMVVEVDENLSYL 69

Query: 73  CPVGIGEEISLGDLVF-HWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSK 131
            P G  E   +GD  F +    +I  S    GRV++   +P DG   +      M IM  
Sbjct: 70  SPFGFVEGFKIGDRAFINDAGMQIGVSDELLGRVVDPFMRPKDGKGPIEASKF-MPIMRA 128

Query: 132 VPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVI 191
              AM R  +E+ F  G++ ID       GQ++G+FAGSG+GKSTL+ M  ++      +
Sbjct: 129 PIDAMKRGLIEEVFPVGVKTIDALLTCGVGQKLGIFAGSGVGKSTLMGMIVKNSKAPIKV 188

Query: 192 ISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDN 251
           I+L+GERGRE+ EFI+  LG  L  +V++VATSD+S ++RK     A+++AEYF  +G +
Sbjct: 189 IALIGERGREIPEFIQKNLGGKLDDTVIIVATSDDSALMRKYGAFCAMSVAEYFKEQGKD 248

Query: 252 VLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVI 311
           VL I+DS+TRFA + REI    GE P  +GYP SV S LP+L+ER G  E+ KG ITA  
Sbjct: 249 VLFIMDSVTRFAMAQREIGLALGEPPTTKGYPPSVLSLLPQLMERTG-KEEGKGTITAFF 307

Query: 312 SVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKK 371
           +VLVDGD+ +DPIAD  RSILDGHIVL+R L + G YPP++   S SR+     S + K 
Sbjct: 308 TVLVDGDDMSDPIADQSRSILDGHIVLSRELTDFGIYPPINIQNSASRVMGDIISDEHKL 367

Query: 372 LVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSD 423
                  L    +E   +  IG Y+ G D  LD+A+ +   +  FL Q+P +
Sbjct: 368 AARKFKRLNSLLKENEVLLRIGAYQKGTDKELDQAIAKKDFMQQFLSQNPEE 419


>gi|61219459|gb|AAX40636.1| HrpB6 [Xanthomonas oryzae pv. oryzicola]
          Length = 486

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 158/367 (43%), Positives = 220/367 (59%), Gaps = 5/367 (1%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISP-SACWCGRVINALGKPIDGDDSL 119
           +V+  + D+  + P G    +S    V   GR    P      GRV++ LG+P DG  ++
Sbjct: 107 EVVGFSRDLALLAPFGELIGLSRETRVIGLGRPLAVPVGPALLGRVLDGLGEPSDGQGAI 166

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
              D  + I ++ P  M R+ +E    TG+R++D    L  GQR+G+FA +G+GKSTL+ 
Sbjct: 167 AC-DTWVPIQAQAPDPMRRRLIEHPMPTGVRIVDGLMTLGEGQRMGIFAAAGVGKSTLMG 225

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTA 238
           MFAR    D  +I L+GERGREVREFIE  LG D L +SVVV ATSD S I R  A    
Sbjct: 226 MFARGTQCDVNVIVLIGERGREVREFIELILGADGLARSVVVCATSDRSSIERAKAAYVG 285

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
             IAEYF  +G  VLL++DS+TRFA + REI   +GE P  RG+P SVF+ELPRLLER G
Sbjct: 286 TAIAEYFRDRGLRVLLMMDSLTRFARAQREIGLAAGEPPTRRGFPPSVFAELPRLLERAG 345

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
               E G+ITA  +VL + D  +DPIA+ VR ILDGH++L+R +A + +YP +D LAS+S
Sbjct: 346 --MGESGSITAFYTVLAEDDTGSDPIAEEVRGILDGHLILSREIAAKNQYPAIDVLASLS 403

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+  +   +   +    L  L+ ++ E   +  +G YR G D + D+A+ ++  I DFL 
Sbjct: 404 RVMSQIVPSYHSQAAGRLRRLLAKYNEVETLVQVGEYRQGSDAVADEAIDRIDAIRDFLS 463

Query: 419 QSPSDLS 425
           Q    LS
Sbjct: 464 QPTDQLS 470


>gi|260778617|ref|ZP_05887509.1| Type III secretion cytoplasmic ATP synthase [Vibrio coralliilyticus
           ATCC BAA-450]
 gi|260604781|gb|EEX31076.1| Type III secretion cytoplasmic ATP synthase [Vibrio coralliilyticus
           ATCC BAA-450]
          Length = 439

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 171/387 (44%), Positives = 239/387 (61%), Gaps = 16/387 (4%)

Query: 56  SDNLGQVIRINLDIVYICP----VGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGK 111
           +D   +V+ I  +  ++ P     GIG ++++ + + H  R  +       GRV++ LG 
Sbjct: 58  NDLKAEVVAIKGEEAWLSPFRSTTGIGTDMNV-EPMGHGHRVMVGEE--LLGRVVDGLGH 114

Query: 112 PIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSG 171
           P+D  + +GK     E   + P  + R+ + K   TGIR ID    L  GQR+G+FA +G
Sbjct: 115 PMDESNWVGK---WRENHGEAPDPLKRKLISKIMPTGIRAIDSTLALGVGQRVGIFAAAG 171

Query: 172 IGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLK-KSVVVVATSDESPIL 230
            GKSTLL M A     D ++++LVGERGREVREFIE  L    K K+V+VVATSD+ P+ 
Sbjct: 172 GGKSTLLGMLAGHCEADVIVLALVGERGREVREFIEYCLPPAAKEKTVLVVATSDKPPLE 231

Query: 231 RKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSEL 290
           R  A +TA TIAEYF  +G NVLL++DS+TRFA + REI   +GE PVA G+P SVF +L
Sbjct: 232 RMKAAVTATTIAEYFRDQGKNVLLMVDSLTRFARAGREIGLAAGEPPVANGFPPSVFVQL 291

Query: 291 PRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPP 350
             LLER GP+    G+ITA+ +VLV+GDN N+P+AD VRSILDGHIVL+R LA  G YP 
Sbjct: 292 ASLLERAGPAPV--GSITAIYTVLVEGDNMNEPVADEVRSILDGHIVLSRKLAGAGHYPA 349

Query: 351 VDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQV 410
           +D  ASVSR+ D+  +A  K     L HL+  ++E + +  +G Y+PG D   D+AV + 
Sbjct: 350 IDVNASVSRVMDQIVTAQHKDDAKHLRHLLSLYQEVQLLIRVGEYQPGQDPATDEAVAKF 409

Query: 411 PIIYDFLKQSPSDLSSEDVFQEITKKL 437
             I  FL Q  ++ S    F+E  ++L
Sbjct: 410 DSIERFLCQRANEPSP---FKETLQQL 433


>gi|296133046|ref|YP_003640293.1| flagellar protein export ATPase FliI [Thermincola sp. JR]
 gi|296031624|gb|ADG82392.1| flagellar protein export ATPase FliI [Thermincola potens JR]
          Length = 440

 Score =  280 bits (717), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 158/363 (43%), Positives = 226/363 (62%), Gaps = 9/363 (2%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSL 119
           +V+    + + + P+G    I  G  V   G  F+I  S+   GRVI+ LG PIDG   L
Sbjct: 58  EVVGFKENRILLMPLGDLTGIGPGCEVVATGHSFKIGVSSKMLGRVIDGLGNPIDG---L 114

Query: 120 GKGDLSMEIMSKVPPA--MNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
           G  +   E     PP   + R+R+ +    G++ +D       GQR+G+F+GSG+GKSTL
Sbjct: 115 GPIEWETEYPVSGPPPNPLERKRITEPLSVGVKAVDGLLTCGKGQRVGIFSGSGVGKSTL 174

Query: 178 LSMFARSDCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPL 236
           L M AR+   D  +I+L+GERGREVREF+E  LG+  L++SVVVVATSD+  ++R    L
Sbjct: 175 LGMIARNTAADINVIALIGERGREVREFLEKDLGEEGLRRSVVVVATSDQPALVRLKGAL 234

Query: 237 TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLER 296
            A +IAEYF  +G +V+L++DS+TRFA + RE+    GE P  RGY  SVF+ LP+LLER
Sbjct: 235 VATSIAEYFRDQGKDVMLMMDSVTRFAMAQREVGLAVGEPPATRGYTPSVFALLPKLLER 294

Query: 297 IGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLAS 356
            G S    G IT + +VLVDGD+HN+PIAD+VR ILDGHIVL+R LA + +YP +D LAS
Sbjct: 295 SGTSRH--GTITGLYTVLVDGDDHNEPIADAVRGILDGHIVLSRDLAMQNQYPAIDILAS 352

Query: 357 VSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDF 416
           VSR+     S + +K    +  ++  + + +D+  IG Y  G +  +D A+ ++    +F
Sbjct: 353 VSRVMPDIVSEEHRKAAQEIKSILATYRDAKDLIDIGAYHKGSNPKIDYALSKLDDTLNF 412

Query: 417 LKQ 419
           LKQ
Sbjct: 413 LKQ 415


>gi|319649564|ref|ZP_08003720.1| flagellum-specific ATP synthase [Bacillus sp. 2_A_57_CT2]
 gi|317398726|gb|EFV79408.1| flagellum-specific ATP synthase [Bacillus sp. 2_A_57_CT2]
          Length = 438

 Score =  280 bits (716), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 163/386 (42%), Positives = 237/386 (61%), Gaps = 10/386 (2%)

Query: 44  CLGDF-VVHQGKNSDN--LGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSA 99
            +GD  ++H GK        +V+    + V + P    ++IS G LV    R   +    
Sbjct: 38  SIGDVCIIHIGKGRTRRIQAEVVGFKNENVILMPYTDVQDISPGSLVETTSRPLEVKIGP 97

Query: 100 CWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPP-AMNRQRVEKGFKTGIRVIDIFTPL 158
              G+ I++LG+P+DG + L KG L+  +  + PP  + R  + +  + G+R+ID    +
Sbjct: 98  ALIGKAIDSLGQPLDGGN-LPKG-LTPVLTEQTPPNPLKRPPISEPIEVGVRMIDSMLTV 155

Query: 159 CHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKS 217
            +GQR+G+FAGSG+GKSTLL M AR+   D  +I+L+GERGREVREFIE  LG + LK+S
Sbjct: 156 GNGQRVGIFAGSGVGKSTLLGMIARNTNADLNVIALIGERGREVREFIERDLGPEGLKRS 215

Query: 218 VVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELP 277
           +VV ATSD+  ++R     TA  IAEYF  KG NV+L++DS+TR A + RE+    GE P
Sbjct: 216 IVVAATSDQPALMRIKGAYTATAIAEYFRDKGLNVMLMMDSVTRVAMAQREVGLAVGEPP 275

Query: 278 VARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIV 337
             +GY  SVF+ LP+LLER G +E   G+ITA  +VLVDGD+ N+PIAD+VR ILDGH V
Sbjct: 276 TTKGYTPSVFAVLPKLLERTGTNEY--GSITAFYTVLVDGDDMNEPIADTVRGILDGHFV 333

Query: 338 LNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRP 397
           L+R+LA +G+YP ++ L SVSR+ +    A   K    +  L+  +    D+  IG Y+ 
Sbjct: 334 LDRALANKGQYPAINVLKSVSRVMNHIADASHIKSAEKVRELLSTYINAEDLINIGAYKR 393

Query: 398 GVDLILDKAVHQVPIIYDFLKQSPSD 423
           G  + +D+A+   P I  FLKQ  ++
Sbjct: 394 GSSMEIDEAIRLYPSIISFLKQETNE 419


>gi|295706282|ref|YP_003599357.1| flagellum-specific ATP synthase [Bacillus megaterium DSM 319]
 gi|294803941|gb|ADF41007.1| flagellum-specific ATP synthase [Bacillus megaterium DSM 319]
          Length = 437

 Score =  280 bits (716), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 164/388 (42%), Positives = 239/388 (61%), Gaps = 12/388 (3%)

Query: 43  VCLGDFVVHQGKNSDNL-GQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSAC 100
           VC     +H  +  D +  +V+  N + V + P      I  G LV    +  ++S    
Sbjct: 42  VCF----IHLSEQGDKIRAEVVGFNGEHVVLMPYTSVRYIGPGCLVETTEKPLQVSVGKE 97

Query: 101 WCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPP-AMNRQRVEKGFKTGIRVIDIFTPLC 159
             G+V+++LG P+DG +      L   +  + PP  + R  +E+  + G+R ID    + 
Sbjct: 98  LIGQVLDSLGNPLDGSEF--SHYLPFVLTDQDPPNPLERPPIEQPIEVGVRTIDSLLTVG 155

Query: 160 HGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSV 218
            GQRIG+FAGSG+GKSTLL M AR+   D  +I+LVGERGREVREFIE  LG+  LK+SV
Sbjct: 156 QGQRIGIFAGSGVGKSTLLGMIARNTKADINVIALVGERGREVREFIERDLGEEGLKRSV 215

Query: 219 VVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPV 278
           VVVATSD+  +LR  A  TA +IAEYF ++G +V++++DS+TR A + REI    GE P 
Sbjct: 216 VVVATSDQPALLRMKAAYTATSIAEYFRNEGLSVMMMMDSVTRVAMAQREIGLAVGEPPT 275

Query: 279 ARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVL 338
            +GY  SVF+ LPRLLER G ++   G+ITA  +VLVDGD+ N+PI+D+VR I+DGHIVL
Sbjct: 276 TKGYTPSVFASLPRLLERTGTNQH--GSITAFYTVLVDGDDMNEPISDTVRGIIDGHIVL 333

Query: 339 NRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPG 398
           +R LA +G+YP ++ L SVSR+ +   S   ++    L  L+  +  + D+  IG Y+ G
Sbjct: 334 DRELANKGQYPAINVLKSVSRVMNHIVSEQHREAAGKLRSLMATYANSEDLINIGAYKRG 393

Query: 399 VDLILDKAVHQVPIIYDFLKQSPSDLSS 426
               +D+A++  P+I  FLKQ  ++  S
Sbjct: 394 SSAYIDEAIYYHPVIDAFLKQKTNEHPS 421


>gi|254228795|ref|ZP_04922218.1| ATPase FliI/YscN family [Vibrio sp. Ex25]
 gi|262396486|ref|YP_003288339.1| flagellum-specific ATP synthase FliI [Vibrio sp. Ex25]
 gi|151938742|gb|EDN57577.1| ATPase FliI/YscN family [Vibrio sp. Ex25]
 gi|262340080|gb|ACY53874.1| flagellum-specific ATP synthase FliI [Vibrio sp. Ex25]
          Length = 448

 Score =  280 bits (716), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 147/367 (40%), Positives = 228/367 (62%), Gaps = 5/367 (1%)

Query: 60  GQVIRINLDIVYICPVG-IGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDS 118
            QV+     I Y+ P+  +G   +   ++   G   +  SA W GRV+N LG+P+D    
Sbjct: 66  AQVVGFEHTIAYLMPIRRLGGLFAGAKVIPLDGDSTVQLSAQWLGRVLNGLGEPLDDGAP 125

Query: 119 LGKGD-LSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
           L  GD +S+E     P  + R+ V+     G+R I+    +  GQRIG+ AGSG+GKS L
Sbjct: 126 LKGGDRVSLEPKPINP--LKRRPVDTPLNVGVRAINGLLTVGKGQRIGLMAGSGVGKSVL 183

Query: 178 LSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPL 236
           + M  ++   D +++ L+GERGREVREFIE  L  +  KK++++ A +DESP++R  A L
Sbjct: 184 MGMITKNTEADVIVVGLIGERGREVREFIERNLTPEARKKAIIIAAPADESPLMRLRATL 243

Query: 237 TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLER 296
               ++EYF  +G +VLL++DS+TR+A + REIA + GE P +RGYP SVFS LP+LLER
Sbjct: 244 LCHRVSEYFRDQGKDVLLLMDSLTRYAMAQREIALSLGEPPASRGYPPSVFSVLPQLLER 303

Query: 297 IGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLAS 356
            G SE + G++TA+ +VL +GD+  DP+ DS R+ILDGH+VL+R LAE+G YP +D  AS
Sbjct: 304 AGNSENQHGSLTAIYTVLAEGDDQQDPVVDSARAILDGHVVLSRQLAEQGHYPAIDINAS 363

Query: 357 VSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDF 416
           +SR            + ++   +   + + +++  +GGY+PG D  LD++V   P +  +
Sbjct: 364 ISRCMSTCTQEAHSTIANNFRQMYSNYLQVKELLPLGGYQPGQDPELDQSVAMYPNLRAY 423

Query: 417 LKQSPSD 423
           L+Q+ ++
Sbjct: 424 LQQAANE 430


>gi|156976205|ref|YP_001447111.1| flagellum-specific ATP synthase [Vibrio harveyi ATCC BAA-1116]
 gi|156527799|gb|ABU72884.1| hypothetical protein VIBHAR_04976 [Vibrio harveyi ATCC BAA-1116]
          Length = 450

 Score =  280 bits (716), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 148/367 (40%), Positives = 228/367 (62%), Gaps = 5/367 (1%)

Query: 60  GQVIRINLDIVYICPVG-IGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDS 118
            QV+  +  + Y+ P+  +G   +   ++   G   +  S+ W GRV+N LG+P D    
Sbjct: 66  AQVVGFDHTVAYLMPIRRLGGLFAGAKVIPLDGDSTVQLSSQWLGRVVNGLGEPFDDGAP 125

Query: 119 LGKGD-LSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
           L  GD +S+E     P  + R+ V+     G+R I+    +  GQRIG+ AGSG+GKS L
Sbjct: 126 LKGGDRVSLEPKPINP--LKRRPVDTPLDVGVRAINGLLTVGKGQRIGLMAGSGVGKSVL 183

Query: 178 LSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPL 236
           + M  ++   D +++ L+GERGREVREF+E  L  +  KK+++V A +DESP++R  A L
Sbjct: 184 MGMITQNTEADVIVVGLIGERGREVREFVERNLTPEARKKAIIVAAPADESPLMRLRATL 243

Query: 237 TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLER 296
               +AEYF  +G +VLL++DS+TR+A + REIA + GE P +RGYP SVFS LP+LLER
Sbjct: 244 LCHRVAEYFRDQGKDVLLLMDSLTRYAMAQREIALSLGEPPASRGYPPSVFSVLPQLLER 303

Query: 297 IGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLAS 356
            G SE   G++TA+ +VL +GD+  DP+ DS R+ILDGH+VL+R LAE+G YP +D  AS
Sbjct: 304 AGNSENPNGSLTAIYTVLAEGDDQQDPVVDSARAILDGHVVLSRQLAEQGHYPAIDINAS 363

Query: 357 VSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDF 416
           +SR  +         + ++   L   + + +++  +GGY+PG D  LD++V   P +  +
Sbjct: 364 ISRCMNACTHEAHSTIANNFRQLYSNYLQVKELLPLGGYQPGQDPELDQSVSMYPHLRAY 423

Query: 417 LKQSPSD 423
           L+QS ++
Sbjct: 424 LQQSANE 430


>gi|323341383|ref|ZP_08081627.1| flagellum-specific ATP synthase [Lactobacillus ruminis ATCC 25644]
 gi|323091260|gb|EFZ33888.1| flagellum-specific ATP synthase [Lactobacillus ruminis ATCC 25644]
          Length = 451

 Score =  280 bits (716), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 174/436 (39%), Positives = 244/436 (55%), Gaps = 16/436 (3%)

Query: 12  AEDY-----SKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRIN 66
           AEDY             G +S +  +      LS +V     V  +G +   L +V+   
Sbjct: 10  AEDYLYQAEHHKFYTTYGKVSEVVGLVIKAEGLSVFVGEICEVAVKGSDKVALAEVVGFV 69

Query: 67  LDIVYICPVGIGEEISLGDLVFHWGR---FRISPSACWCGRVINALGKPIDGDDSLGKGD 123
            + V + P+   E I  G +V   G+    R+ P     G  ++ LG+P D  D      
Sbjct: 70  KETVLLMPLDELEGIGPGCIVKPTGKTLQVRVGPQ--LLGHTLDGLGRPFDDSDIDNDKL 127

Query: 124 LSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFAR 183
           +   ++   P    R+R+     TG+R ID    +  GQR+G+FAGSG+GKSTLL M AR
Sbjct: 128 VDYPVIQDSPDPFRRKRISNVMPTGVRTIDGLLTVGEGQRMGIFAGSGVGKSTLLGMIAR 187

Query: 184 SDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIA 242
               D ++I L+GERGREV EFIE  LG +   KSVVV ATSD  P++R     TA  IA
Sbjct: 188 YCQADVIVIGLIGERGREVMEFIEKDLGKEGYAKSVVVCATSDTPPLVRLKGAHTATAIA 247

Query: 243 EYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEK 302
           EYF  +G  V+L++DS+TRFA + REI  ++GE P  +GY  SVF+ELP+LLER G SEK
Sbjct: 248 EYFRDQGKKVVLMMDSVTRFAMAQREIGLSTGEPPTTKGYTPSVFAELPKLLERSGMSEK 307

Query: 303 EKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLAD 362
             G+ITA  +VLV+GD+ N+PIAD+VR ILDGHIVL+R +A +  YP +D   S+SRL  
Sbjct: 308 --GSITAFYTVLVEGDDMNEPIADAVRGILDGHIVLSRKIASQNHYPAIDVQVSLSRLMK 365

Query: 363 KAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPS 422
           +  S +  K    L   +  + +++D+  IG Y+ G + ++D AV     I DFLKQ   
Sbjct: 366 ELVSEEHTKDAGELRENMGVYNDSKDLIDIGAYKKGSNAVIDYAVSLHVPIEDFLKQRVE 425

Query: 423 DLSSEDVFQEITKKLQ 438
           + SS   F+E   +L 
Sbjct: 426 EYSS---FEETESRLH 438


>gi|170737022|ref|YP_001778282.1| FliI/YscN family ATPase [Burkholderia cenocepacia MC0-3]
 gi|169819210|gb|ACA93792.1| ATPase, FliI/YscN family [Burkholderia cenocepacia MC0-3]
          Length = 435

 Score =  280 bits (716), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 168/421 (39%), Positives = 244/421 (57%), Gaps = 17/421 (4%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNL-GQVIRINLDIVYICPVGIGEEIS 82
           G +S+++ +   VT  +     G     +  ++D L  +V+     + Y+ P    E ++
Sbjct: 21  GRLSAVSGLLLEVTGYAFET--GQLARIETASNDWLDARVVGFREGVSYLMPFRPAEGLA 78

Query: 83  LGDLVF-HWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMN---R 138
            G  VF   G   +S  A W GR+++ LG+PID    L  GD  +++    PP +N   +
Sbjct: 79  AGARVFGDDGARMLSIGAAWRGRIVDGLGEPIDDRGPL-VGDAVLDL---APPRVNPLRK 134

Query: 139 QRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGER 198
           Q VE     G+R ID    L  GQR+G+FAGSG+GKS LL M AR    D V++ ++GER
Sbjct: 135 QPVEGVMDVGVRAIDGMLTLGRGQRVGLFAGSGVGKSVLLGMIARQTAADVVVVGMIGER 194

Query: 199 GREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILD 257
           GREVREFIE  LG + L K++VVVA +DESP++R MA      IA +F   G++VLL++D
Sbjct: 195 GREVREFIEHSLGPEGLSKAIVVVAPADESPLMRLMATELCHAIATHFRDAGNDVLLMID 254

Query: 258 SITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDG 317
           S+TR+A + REIA   GE P  RGYP SVF  LPRL+ER G  E   G+++A+ +VL +G
Sbjct: 255 SLTRYAMAQREIALALGEPPATRGYPPSVFGMLPRLVERAGNGEG-VGSMSAIYTVLAEG 313

Query: 318 DNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLT 377
           D+  DP+ D+ R+ILDGHI+L+R LA +G YP +D L SVSR        ++   V  + 
Sbjct: 314 DDEQDPVVDTARAILDGHIMLSRDLASQGHYPAIDVLRSVSRCMSLVAPREQIDAVHKVK 373

Query: 378 HLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSE----DVFQEI 433
            ++ R+   RD+  +GGY  G DL+ D AV     I  FL Q+  +++      D+  EI
Sbjct: 374 QMMSRYANVRDLIPLGGYVAGADLVTDHAVKMHDRIEAFLCQAQDEVAPRQATLDILTEI 433

Query: 434 T 434
            
Sbjct: 434 A 434


>gi|225569976|ref|ZP_03779001.1| hypothetical protein CLOHYLEM_06071 [Clostridium hylemonae DSM
           15053]
 gi|225161446|gb|EEG74065.1| hypothetical protein CLOHYLEM_06071 [Clostridium hylemonae DSM
           15053]
          Length = 435

 Score =  280 bits (715), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 152/347 (43%), Positives = 219/347 (63%), Gaps = 4/347 (1%)

Query: 92  RFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRV 151
           R +I       GR+I+ALG PID                K+ P ++R  + +    G++ 
Sbjct: 88  RLKIPVGQFLRGRIIDALGNPIDDKGPFESERYYYVESPKINP-LSRPPISEELHFGVKA 146

Query: 152 IDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG 211
           ID    +  GQRIG+FAGSG+GKSTLL M AR+   D  +I+LVGERGREVREF+E  LG
Sbjct: 147 IDGLNTIGKGQRIGIFAGSGVGKSTLLGMIARNVETDINVIALVGERGREVREFVEKDLG 206

Query: 212 -DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIA 270
            + +K+SV+VVATSD+  +LR   P+ A TIAEYF  +G +VLL++DS+TRFA + REI 
Sbjct: 207 PEGMKRSVLVVATSDQPAMLRMKCPIVATTIAEYFKDQGKDVLLMMDSLTRFAMAQREIG 266

Query: 271 TNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRS 330
             +GE PVARGY  S+++E P+LLER G  + E G+IT V +VLV+GD+ N+P+AD+VR 
Sbjct: 267 LATGEPPVARGYTPSIYAEFPKLLERSG--KFENGSITGVYTVLVEGDDTNEPVADTVRG 324

Query: 331 ILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIR 390
           ILDGHIVL+R LA    +P +D  AS+SRL     + + ++L S L  ++  +E+  D+ 
Sbjct: 325 ILDGHIVLSRKLANANHFPAIDVSASISRLMTDIVTEEHRELASKLRDILSVYEQNEDLI 384

Query: 391 LIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKL 437
            IG Y+ G +  LD A+ ++  +  FL Q       +D   ++ +K+
Sbjct: 385 SIGAYKSGTNEKLDHAISKIEQVNRFLMQEIDRKYEKDEMLDVMRKI 431


>gi|291484176|dbj|BAI85251.1| flagellum-specific ATP synthase [Bacillus subtilis subsp. natto
           BEST195]
          Length = 438

 Score =  280 bits (715), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 156/361 (43%), Positives = 218/361 (60%), Gaps = 5/361 (1%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSL 119
           +V+    + + + P      I+ G +V   G   R+       G+VI+A G+P+DG   L
Sbjct: 58  EVVGFQEENILLMPYLEAASIAPGSIVEATGESLRVKVGTGLIGQVIDAFGEPLDGK-LL 116

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
            KG   +      P  M R  + +    G+R ID    +  GQRIG+FAGSG+GKSTL+ 
Sbjct: 117 PKGLSPVSTEQSPPNPMKRPPIREKMGVGVRSIDSLLTVGKGQRIGIFAGSGVGKSTLMG 176

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTA 238
           M A+    D  +I+LVGERGREVREFIE  LG + LK+S+VVVATSD+  ++R  A  TA
Sbjct: 177 MIAKQTEADLNVIALVGERGREVREFIEKDLGKEGLKRSIVVVATSDQPALMRLKAAYTA 236

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
             IAEYF  KG NV+ ++DS+TR A + REI   +GE P  +GY  SVF+ LPRLLER G
Sbjct: 237 TAIAEYFRDKGQNVMFMMDSVTRVAMAQREIGLAAGEPPTTKGYTPSVFAILPRLLERTG 296

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
            +E   G ITA  +VLVDGD+ N+PIAD+VR ILDGHIVL+R+LA +G++P V+ L S+S
Sbjct: 297 ANEH--GTITAFYTVLVDGDDMNEPIADTVRGILDGHIVLDRALANKGQFPAVNVLKSIS 354

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+     +       +    L+  ++ + D+  IG Y+ G    +D+A+   P +  FLK
Sbjct: 355 RVMSNISTKQHLDAANKFRELLSTYQNSEDLINIGAYKRGSSREIDEAIQFYPQLIQFLK 414

Query: 419 Q 419
           Q
Sbjct: 415 Q 415


>gi|289663768|ref|ZP_06485349.1| type III secretion system ATPase [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 442

 Score =  280 bits (715), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 154/367 (41%), Positives = 221/367 (60%), Gaps = 5/367 (1%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISP-SACWCGRVINALGKPIDGDDSL 119
           +V+  + D+  + P G    +S    V   GR    P      GRV++ LG+P DG  ++
Sbjct: 63  EVVGFSRDLALLAPFGELVGLSRETRVIGLGRPLAVPVGPALLGRVLDGLGEPADGLGAV 122

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
            + +  + + ++ P  M R+ +E+   TG+R++D    L  GQR+G+FA +G+GKSTL+ 
Sbjct: 123 -ECETWVRVQAQAPDPMRRRLIEQPMPTGVRIVDGLMTLGEGQRMGIFAAAGVGKSTLMG 181

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTA 238
           MFAR    D  +I L+GERGREVREFIE  LG D L +SVVV ATSD S I R  A    
Sbjct: 182 MFARGTQCDVNVIVLIGERGREVREFIEMILGEDGLSRSVVVCATSDRSSIERAKAAYVG 241

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
             IAEYF  +G  VLL++DS+TRFA + REI   +GE P  RG+P SVF+ELPRLLER G
Sbjct: 242 TAIAEYFRDQGMRVLLMMDSLTRFARAQREIGLAAGEPPTRRGFPPSVFAELPRLLERAG 301

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
               E G+ITA  +VL + D  +DPIA+ VR ILDGH++L+R +A + +YP +D L S+S
Sbjct: 302 MG--ESGSITAFYTVLAEDDTGSDPIAEEVRGILDGHLILSREIAAKNQYPAIDVLGSLS 359

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+  +    ++ +    L  L+ ++ +   +  +G YR G D   D+A+ ++  I DFL 
Sbjct: 360 RVMSQIVPPEQSQAAGQLRRLLAKYNDVETLLQVGEYREGSDATADEAIARIDAIRDFLC 419

Query: 419 QSPSDLS 425
           Q    LS
Sbjct: 420 QPTDQLS 426


>gi|321315390|ref|YP_004207677.1| flagellum-specific ATP synthase [Bacillus subtilis BSn5]
 gi|320021664|gb|ADV96650.1| flagellum-specific ATP synthase [Bacillus subtilis BSn5]
          Length = 438

 Score =  280 bits (715), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 156/361 (43%), Positives = 218/361 (60%), Gaps = 5/361 (1%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSL 119
           +V+    + + + P      I+ G +V   G   R+       G+VI+A G+P+DG   L
Sbjct: 58  EVVGFQEENILLMPYLEAASIAPGSIVEATGESLRVKVGTGLIGQVIDAFGEPLDGK-LL 116

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
            KG   +      P  M R  + +    G+R ID    +  GQRIG+FAGSG+GKSTL+ 
Sbjct: 117 PKGLSPVSTEQSPPNPMKRPPIREKMGVGVRSIDSLLTVGKGQRIGIFAGSGVGKSTLMG 176

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTA 238
           M A+    D  +I+LVGERGREVREFIE  LG + LK+S+VVVATSD+  ++R  A  TA
Sbjct: 177 MIAKQTEADLNVIALVGERGREVREFIEKDLGKEGLKRSIVVVATSDQPALMRLKAAYTA 236

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
             IAEYF  KG NV+ ++DS+TR A + REI   +GE P  +GY  SVF+ LPRLLER G
Sbjct: 237 TAIAEYFRDKGQNVMFMMDSVTRVAMAQREIGLAAGEPPTTKGYTPSVFAILPRLLERTG 296

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
            +E   G ITA  +VLVDGD+ N+PIAD+VR ILDGHIVL+R+LA +G++P V+ L S+S
Sbjct: 297 ANEH--GTITAFYTVLVDGDDMNEPIADTVRGILDGHIVLDRALANKGQFPAVNVLKSIS 354

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+     +       +    L+  ++ + D+  IG Y+ G    +D+A+   P +  FLK
Sbjct: 355 RVMSNISTKQHLDAANKFRELLSTYQNSEDLINIGAYKRGSSREIDEAIQFYPQLIQFLK 414

Query: 419 Q 419
           Q
Sbjct: 415 Q 415


>gi|221640831|ref|YP_002527093.1| ATPase, FliI/YscN family [Rhodobacter sphaeroides KD131]
 gi|221161612|gb|ACM02592.1| ATPase, FliI/YscN family [Rhodobacter sphaeroides KD131]
          Length = 436

 Score =  280 bits (715), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 168/414 (40%), Positives = 242/414 (58%), Gaps = 2/414 (0%)

Query: 11  LAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIV 70
           LAE  +  L  + G ++ I     +V  L Q   LGD V   G      G+V+R++   V
Sbjct: 9   LAEIAAIPLSRRYGRVTGIGRGTLSVGGLEQGTALGDRVEICGAGGILGGEVLRLSSHEV 68

Query: 71  YICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMS 130
            I P G  E +++GD V   G   I+P   W GR+++ LG+P+DG   L +G  +  + +
Sbjct: 69  TILPDGSPEGLAIGDAVALIGPAEIAPDDSWIGRIVDPLGRPLDGR-PLFRGPRARPLRA 127

Query: 131 KVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKV 190
             PPA  R+ +     TG+ V D   PL  GQRIG+FAGSG+GKS+LL+ FARS   D V
Sbjct: 128 AAPPAAARRSLGPRLPTGVAVFDTLLPLVQGQRIGLFAGSGVGKSSLLAKFARSVVADVV 187

Query: 191 IISLVGERGREVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKG 249
           +I LVGERGRE+REF E  LG   + ++VVV ATSD+SP++R+     A+ +AE+F  +G
Sbjct: 188 VIGLVGERGRELREFTERVLGPAGMARAVVVTATSDQSPLVRRRCGWAAMAVAEHFRDQG 247

Query: 250 DNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITA 309
            +VLL++DSITRFA + RE+A   GE    RG+P S    +  L ER GP     G+ITA
Sbjct: 248 LHVLLLVDSITRFAEAHREVALAGGEAASMRGFPPSTAHTIMALAERAGPGADGTGDITA 307

Query: 310 VISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADE 369
           V SVLV G +  +P+AD +R +LDGH+V++R +AE GR+P +D L S+SR   +A S  E
Sbjct: 308 VFSVLVAGSDMEEPVADILRGVLDGHVVMDRKIAERGRFPAIDLLRSMSRALPEAASTAE 367

Query: 370 KKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSD 423
             L++    L+  ++    +   G Y  G D ++D A+   P +  FL +   D
Sbjct: 368 NALIAEARRLLGAWDRAEMMIQAGLYARGSDPLVDAAIRVWPALDAFLAEDAPD 421


>gi|254462370|ref|ZP_05075786.1| flagellum-specific ATP synthase [Rhodobacterales bacterium
           HTCC2083]
 gi|206678959|gb|EDZ43446.1| flagellum-specific ATP synthase [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 447

 Score =  280 bits (715), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 155/412 (37%), Positives = 247/412 (59%), Gaps = 4/412 (0%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLG-QVIRINLDIVYICPVGIGEEIS 82
           G ++ + +    +  L Q   LGD V    +  D +G +VI ++ D+  I P      +S
Sbjct: 23  GTVTHVGAGLIELDGLGQNARLGDQVNLSSRMGDAMGGEVISLSKDVTIIQPDAPLTGVS 82

Query: 83  LGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVE 142
           LGD     G F+ISPS  W GR+++A G P+DG   L +G+    I+   P    R+ + 
Sbjct: 83  LGDEALLDGPFQISPSDAWIGRIVDANGGPMDGR-FLPRGETPRSILGAPPNPAQRRALG 141

Query: 143 KGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREV 202
           +  +T + V +   P+  GQR+G+F+G G+GKS+LL+ FA     D ++I+L+GERGRE+
Sbjct: 142 RRLETSMSVFNTLLPIVRGQRLGLFSGFGVGKSSLLAHFASHMEADVIVIALIGERGREL 201

Query: 203 REFIEDYLGDN-LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITR 261
           R F+E  LG   + +SV+V ATSD++P+LR+   LTA+++AE+F  +G +VL + +SITR
Sbjct: 202 RHFVETTLGKKGMARSVIVAATSDQNPLLRRRCALTAMSVAEHFRDQGKHVLFLANSITR 261

Query: 262 FAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHN 321
            A + REIA  +GE P  RG+P S    +  L ER GP     G+ITA+ SVLV   + +
Sbjct: 262 LAEAHREIAVAAGEAPALRGFPASTSHLIMSLCERAGPGLDGGGDITALFSVLVAASDMD 321

Query: 322 DPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIH 381
           +PIAD +R +LDGH+VL+R++AE GRYP +D + SVSR   +A +  E +L+++   L+ 
Sbjct: 322 EPIADIMRGVLDGHVVLDRTIAERGRYPAIDAVRSVSRSLPEAANEKENELIATARRLLG 381

Query: 382 RFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEI 433
            ++E   +   G Y  G D +LD A+     + +F+  +   L++++ FQ +
Sbjct: 382 AYDENALMIRAGLYNAGSDPLLDIAIKAYSELDNFIA-TLERLNTDNSFQRL 432


>gi|312792650|ref|YP_004025573.1| atpase, flii/yscn family [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312876500|ref|ZP_07736483.1| flagellar protein export ATPase FliI [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311796711|gb|EFR13057.1| flagellar protein export ATPase FliI [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|312179790|gb|ADQ39960.1| ATPase, FliI/YscN family [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 431

 Score =  280 bits (715), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 157/403 (38%), Positives = 242/403 (60%), Gaps = 17/403 (4%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICP----VGI-- 77
           G+++ +  +  T+      V +G     +   ++ L +V+    + V + P    VG+  
Sbjct: 19  GFVNQVIGL--TIESQGPAVSIGTLCRIKAAKTETLAEVVGFKENKVLLMPYSDLVGVFP 76

Query: 78  GEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMN 137
           G ++   D +F      +       GR+++ LG+PIDG   + K  +   + ++ P  + 
Sbjct: 77  GCKVIAQDSIFE-----VKVGKELLGRILDGLGQPIDGKGEI-KSKIKYPVENRAPNPLE 130

Query: 138 RQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGE 197
           R R++     GI+ ID    +  GQR+G+FAGSG+GKSTLL M AR+   D  +++L+GE
Sbjct: 131 RPRIDTIMPLGIKAIDTLLTIGKGQRVGIFAGSGVGKSTLLGMIARNAKADVNVLALIGE 190

Query: 198 RGREVREFIE-DYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLIL 256
           RGRE++EF+E D   + LK+SVVVVATSDES + R  A   A+ IAEYF  +G +VL ++
Sbjct: 191 RGRELKEFLEKDLKEEGLKRSVVVVATSDESALKRVKAAYVAMAIAEYFRDQGLDVLFLM 250

Query: 257 DSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVD 316
           DS+TRFA + REI    GE PV+RGY  SVFS +P+LLER G  +  KG+ITA+ +VLVD
Sbjct: 251 DSLTRFAMAQREIGLAVGEPPVSRGYTPSVFSVMPKLLERAG--KNRKGSITALFTVLVD 308

Query: 317 GDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSL 376
           GD+ N+PI D+ R ILDGHIVL+R++A +  YP +D LAS+SR+ +       ++L +  
Sbjct: 309 GDDFNEPITDTARGILDGHIVLSRAIANKNHYPAIDVLASISRVMNDIVDPSHRELANET 368

Query: 377 THLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
             ++  + E  D+  IG Y  G +  +D+A+  +P I  FL+Q
Sbjct: 369 KRVLAVYREAEDLINIGAYTKGSNPEIDRAIELLPRINQFLRQ 411


>gi|172057885|ref|YP_001814345.1| FliI/YscN family ATPase [Exiguobacterium sibiricum 255-15]
 gi|171990406|gb|ACB61328.1| ATPase, FliI/YscN family [Exiguobacterium sibiricum 255-15]
          Length = 437

 Score =  280 bits (715), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 156/372 (41%), Positives = 233/372 (62%), Gaps = 8/372 (2%)

Query: 50  VHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINA 108
           +H+G   +   +V+      V + P G    I+ G +V   G+   +       G V++ 
Sbjct: 52  IHRGDEIE--AEVVGFREGHVLLMPYGETTAIAPGSIVIATGKPLHVPVGDDLIGTVLDG 109

Query: 109 LGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFA 168
           LG+ +DG  SL     +  I+ K P  ++R R+++   TGIR ID    +  GQR+G+FA
Sbjct: 110 LGRSLDGK-SLAHLR-TTSIVRKPPSPLDRPRIDEVLSTGIRAIDGLLTVGQGQRVGLFA 167

Query: 169 GSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDES 227
           GSG+GKSTLL M A+    D  +I+L+GERGREV+EFIE  LG+  + +S++VVATSD+ 
Sbjct: 168 GSGVGKSTLLGMIAKRSMADINVIALIGERGREVKEFIEAELGEEGMSRSIIVVATSDQP 227

Query: 228 PILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVF 287
           P++R     TA  IAEYF  +G NV+L++DS+TRFA + REI   +GE P ++GY  SVF
Sbjct: 228 PLVRLKGAYTATAIAEYFRDQGKNVVLMMDSVTRFAMAQREIGLATGEPPASKGYTPSVF 287

Query: 288 SELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGR 347
           + LP+LLER G + +  G+ITA  +VLVDGD+ N+PIAD+VR ILDGH VL+R+LA +G+
Sbjct: 288 ALLPQLLERSGKTTE--GSITAFYTVLVDGDDMNEPIADAVRGILDGHFVLDRNLANKGQ 345

Query: 348 YPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAV 407
           YP +  L S+SR+ ++  S + K    +   L+  + +  D+  IG Y+ G +  +D+AV
Sbjct: 346 YPAIHILRSISRVMNQITSTEHKDSAITFRQLLSTYLDAEDLINIGAYKSGTNPDIDRAV 405

Query: 408 HQVPIIYDFLKQ 419
            + P +  FLKQ
Sbjct: 406 EKYPELIGFLKQ 417


>gi|255767366|ref|NP_389506.2| flagellum-specific ATP synthase [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|238054284|sp|P23445|FLII_BACSU RecName: Full=Flagellum-specific ATP synthase
 gi|225184993|emb|CAB13497.2| flagellar-specific ATPase [Bacillus subtilis subsp. subtilis str.
           168]
          Length = 438

 Score =  280 bits (715), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 156/361 (43%), Positives = 218/361 (60%), Gaps = 5/361 (1%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSL 119
           +V+    + + + P      I+ G +V   G   R+       G+VI+A G+P+DG   L
Sbjct: 58  EVVGFQEENILLMPYLEAASIAPGSIVEATGESLRVKVGTGLIGQVIDAFGEPLDGK-LL 116

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
            KG   +      P  M R  + +    G+R ID    +  GQRIG+FAGSG+GKSTL+ 
Sbjct: 117 PKGLSPVSTEQSPPNPMKRPPIREKMGVGVRSIDSLLTVGKGQRIGIFAGSGVGKSTLMG 176

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTA 238
           M A+    D  +I+LVGERGREVREFIE  LG + LK+S+VVVATSD+  ++R  A  TA
Sbjct: 177 MIAKQTEADLNVIALVGERGREVREFIEKDLGKEGLKRSIVVVATSDQPALMRLKAAYTA 236

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
             IAEYF  KG NV+ ++DS+TR A + REI   +GE P  +GY  SVF+ LPRLLER G
Sbjct: 237 TAIAEYFRDKGQNVMFMMDSVTRVAMAQREIGLAAGEPPTTKGYTPSVFAILPRLLERTG 296

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
            +E   G ITA  +VLVDGD+ N+PIAD+VR ILDGHIVL+R+LA +G++P V+ L S+S
Sbjct: 297 ANEH--GTITAFYTVLVDGDDMNEPIADTVRGILDGHIVLDRALANKGQFPAVNVLKSIS 354

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+     +       +    L+  ++ + D+  IG Y+ G    +D+A+   P +  FLK
Sbjct: 355 RVMSNISTKQHLDAANKFRELLSTYQNSEDLINIGAYKRGSSREIDEAIQFYPQLIQFLK 414

Query: 419 Q 419
           Q
Sbjct: 415 Q 415


>gi|312621571|ref|YP_004023184.1| atpase, flii/yscn family [Caldicellulosiruptor kronotskyensis 2002]
 gi|312202038|gb|ADQ45365.1| ATPase, FliI/YscN family [Caldicellulosiruptor kronotskyensis 2002]
          Length = 431

 Score =  279 bits (714), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 156/401 (38%), Positives = 239/401 (59%), Gaps = 13/401 (3%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICP----VGIGE 79
           G+++ +  +  T+      V +G     +   ++ L +V+    + V + P    VG+  
Sbjct: 19  GFVNQVIGL--TIESQGPAVSIGTLCRIKAAKTETLAEVVGFKENKVLLMPYSDLVGV-- 74

Query: 80  EISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQ 139
                 ++     F +       GR+++ LG+PIDG   + K  +   + ++ P  + R 
Sbjct: 75  -FPGCKVIAQDSMFEVKVGKELLGRILDGLGQPIDGKGEI-KSKIKYPVENRAPNPLERP 132

Query: 140 RVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERG 199
           R++     GI+ ID    +  GQR+G+FAGSG+GKSTLL M AR+   D  +++L+GERG
Sbjct: 133 RIDTIMPLGIKAIDTLLTIGKGQRVGIFAGSGVGKSTLLGMIARNAKADVNVLALIGERG 192

Query: 200 REVREFIE-DYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDS 258
           RE++EF+E D   + LK+SVVVVATSDES + R  A   A+ IAEYF  +G +VL ++DS
Sbjct: 193 RELKEFLEKDLKEEGLKRSVVVVATSDESALKRVKAAYVAMAIAEYFRDQGLDVLFLMDS 252

Query: 259 ITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGD 318
           +TRFA + REI    GE PV+RGY  SVFS +P+LLER G  + +KG+ITA+ +VLVDGD
Sbjct: 253 LTRFAMAQREIGLAIGEPPVSRGYTPSVFSIMPKLLERAG--KNQKGSITALFTVLVDGD 310

Query: 319 NHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTH 378
           + N+PI D+ R ILDGHIVL+R++A +  YP +D LAS+SR+ +       + L +    
Sbjct: 311 DFNEPITDTARGILDGHIVLSRAIANKNHYPAIDVLASISRVMNDIVEPFHRDLANETKR 370

Query: 379 LIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
           ++  + E  D+  IG Y  G +  +D+A+  VP I  FL+Q
Sbjct: 371 VLAVYREAEDLINIGAYTKGSNPEIDRAIELVPRINQFLRQ 411


>gi|325288781|ref|YP_004264962.1| type III secretion system ATPase, FliI/YscN [Syntrophobotulus
           glycolicus DSM 8271]
 gi|324964182|gb|ADY54961.1| type III secretion system ATPase, FliI/YscN [Syntrophobotulus
           glycolicus DSM 8271]
          Length = 437

 Score =  279 bits (714), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 167/415 (40%), Positives = 241/415 (58%), Gaps = 9/415 (2%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISL 83
           G +S +T +   +      V +G +       S+   +V+    +   + P+G  E +S 
Sbjct: 21  GLVSKVTGLL--IEANGPKVSVGRYCCIVSSKSEIPAEVVGFKDNKTLLMPLGELEGVSP 78

Query: 84  GDLVF-HWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVE 142
           GD V     +  +   +   GRV++ LG P++G     K ++   + +  P A+ R RV 
Sbjct: 79  GDKVIPQKEKLAVKVGSELLGRVLDGLGNPLEGRPL--KSNIDYPLQNAPPHALLRPRVS 136

Query: 143 KGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREV 202
           +    G+R +D    +  GQR+G+FAGSG+GKSTLL M AR+   D  +I+LVGERGRE+
Sbjct: 137 EPLSVGVRSVDGLLTIGRGQRMGIFAGSGVGKSTLLGMMARNTQADINVIALVGERGREL 196

Query: 203 REFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITR 261
           REFIE  LG + + +SV+VVATSD+  ++R  A  TA  IAEYF   G NVLL++DS+TR
Sbjct: 197 REFIEKDLGPEGISRSVIVVATSDQPALVRIKAAFTATAIAEYFRDTGKNVLLMMDSVTR 256

Query: 262 FAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHN 321
           FA + RE+    GE P  RGYP SVF+ LP+LLER G +  EKG+IT + +VLVDGD+HN
Sbjct: 257 FAMAQREVGLTIGEPPATRGYPPSVFAMLPKLLERAGMA--EKGSITGLYTVLVDGDDHN 314

Query: 322 DPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIH 381
           +PIAD+VR ILDGHIVL+R LA    +P +D L SVSR        +   L   +  L+ 
Sbjct: 315 EPIADAVRGILDGHIVLSRDLAARNHFPSIDILQSVSRCMSDVAEPEMIGLAGKVRELLA 374

Query: 382 RFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSD-LSSEDVFQEITK 435
            ++  +D+  IG Y  G +  +D A+  +  I  FL QS  +  +  D+  EI K
Sbjct: 375 VYQGAKDLIDIGAYVRGSNAKIDTALKYMEKITLFLCQSTDEKFNGIDMVAEIKK 429


>gi|322806989|emb|CBZ04559.1| flagellum-specific ATP synthase FliI [Clostridium botulinum H04402
           065]
          Length = 438

 Score =  279 bits (714), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 166/392 (42%), Positives = 237/392 (60%), Gaps = 9/392 (2%)

Query: 49  VVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVIN 107
           +++  KN     +V+    + V + P+G    I+ G  V   G+   +  S    G+V++
Sbjct: 49  IIYNEKNQTIPCEVVGFKEENVILMPLGELIGIAPGCKVIPQGKPLSVICSENILGKVLD 108

Query: 108 ALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVF 167
            LG P++G++ +     +++  S  P  M R+R++    TGI+ ID F  +  GQRIG+F
Sbjct: 109 GLGNPLEGEELMEGSPYALD--SDPPDPMKRRRIKDVIPTGIKAIDGFITVGEGQRIGIF 166

Query: 168 AGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDE 226
           AGSG+GKST L M A+    D  +I+L+GERGREVR+FIE  LG+  LKKSV+V ATSD+
Sbjct: 167 AGSGVGKSTTLGMIAKYAEADINVIALIGERGREVRDFIEKDLGEEGLKKSVIVCATSDK 226

Query: 227 SPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSV 286
             ++R     TA  IAEYF  +G  V+L++DS+TRFA + REI    GE P  +GY  SV
Sbjct: 227 PALVRLKGAFTATAIAEYFRDQGKKVILMMDSVTRFAMAQREIGLAIGEPPATKGYTPSV 286

Query: 287 FSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEG 346
           F++LPRL+ER G S K  G+ITA  +VLVDGD+ N+PIAD+VR ILDGHIVL+RSLA + 
Sbjct: 287 FAKLPRLMERSGMSNK--GSITAFYTVLVDGDDFNEPIADAVRGILDGHIVLSRSLAAKN 344

Query: 347 RYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKA 406
            YP +D L+SVSRL  +  S + K        L+  ++ + D+  IG Y    +  +D A
Sbjct: 345 HYPAIDVLSSVSRLMSEIASKEHKDAAGMARDLLATYKNSEDLINIGAYVKRSNPKVDMA 404

Query: 407 VHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
           +H    I  FLKQ    +  +  F+E T  LQ
Sbjct: 405 IHYHESILSFLKQG---IGEQHSFEESTSILQ 433


>gi|57505593|ref|ZP_00371520.1| flagellum-specific ATP synthase [Campylobacter upsaliensis RM3195]
 gi|57016140|gb|EAL52927.1| flagellum-specific ATP synthase [Campylobacter upsaliensis RM3195]
          Length = 450

 Score =  279 bits (714), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 166/422 (39%), Positives = 237/422 (56%), Gaps = 10/422 (2%)

Query: 4   NLETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFV---VHQGKNSDNLG 60
           +LE L +  +D  +NL    G I+ I++    +  L   V  GD V    ++ +N   L 
Sbjct: 2   SLEKLRKKLKD--ENLASVFGEITKISATNIEIQGLKTGV--GDIVRLISNENENLQTLA 57

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVF-HWGRFRISPSACWCGRVINALGKPIDGDDSL 119
            V+ +     Y+ P    E   +GD  F      +I  S    GRV++   KP DG  ++
Sbjct: 58  MVVEVKAQFSYLSPFSFIEGFKIGDRAFLSDAGMQIGVSDALLGRVVDPFMKPKDGKGAI 117

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
                 M IM     AM R  +E+ F TG++ ID       GQ++G+FAGSG+GKSTL+ 
Sbjct: 118 EISKF-MPIMRSPIDAMKRGLIEEIFPTGVKTIDGLLTCGVGQKLGIFAGSGVGKSTLMG 176

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAV 239
           M  ++      +I+L+GERGRE+ EFI+  LG  L  +V++VATSD+S ++RK     A+
Sbjct: 177 MIVKNSKAPVKVIALIGERGREIPEFIQKNLGGKLDNTVIIVATSDDSALMRKYGAFCAM 236

Query: 240 TIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGP 299
           ++AEYF  +G +VL I+DS+TRFA + REI    GE P  +GYP SV S LP+L+ER G 
Sbjct: 237 SVAEYFKEQGKDVLFIMDSVTRFAMAQREIGLALGEPPTTKGYPPSVLSLLPQLMERTG- 295

Query: 300 SEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSR 359
            E+ KG ITA  +VLVDGD+ +DPIAD  RSILDGHIVL+R L + G YPP++   S SR
Sbjct: 296 KEEGKGTITAFFTVLVDGDDMSDPIADQSRSILDGHIVLSRELTDFGIYPPINIQNSASR 355

Query: 360 LADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
           +     S   K        L    +E   +  IG Y+ G D  LD+A+ +  ++  FL Q
Sbjct: 356 VMSDIISDTHKNNARKFKRLSSLLKENEVLLRIGAYQKGSDKELDEAIMKKDLMQKFLSQ 415

Query: 420 SP 421
           +P
Sbjct: 416 TP 417


>gi|29423534|gb|AAO73596.1| lateral flagellar FliI-like assembly ATPase protein [Vibrio
           parahaemolyticus]
          Length = 451

 Score =  279 bits (714), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 146/367 (39%), Positives = 227/367 (61%), Gaps = 5/367 (1%)

Query: 60  GQVIRINLDIVYICPVG-IGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDS 118
            QV+  +  + Y+ P+  +G   +   ++   G   +  S+ W GRV+N LG+P+D    
Sbjct: 68  AQVVGFDHTVAYLMPIRRLGGLFAGAKVIPLDGDSTVQLSSQWMGRVVNGLGEPLDDGMP 127

Query: 119 LGKGD-LSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
           L  GD +S+E     P  + R+ V+     G+R I+    +  GQRIG+ AGSG+GKS L
Sbjct: 128 LKGGDRVSLEPKPINP--LKRRPVDTPLNVGVRAINGLLTVGKGQRIGLMAGSGVGKSVL 185

Query: 178 LSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLK-KSVVVVATSDESPILRKMAPL 236
           + M  ++   D +++ L+GERGREVREFIE  L    + K++++ A +DESP++R  A L
Sbjct: 186 MGMITKNTEADVIVVGLIGERGREVREFIERNLTPEAREKAIIIAAPADESPLMRLRATL 245

Query: 237 TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLER 296
               +AEYF  +G +VLL++DS+TR+A + REIA + GE P +RGYP SVFS LP+LLER
Sbjct: 246 LCHRVAEYFRDQGKDVLLLMDSLTRYAMAQREIALSLGEPPASRGYPPSVFSVLPQLLER 305

Query: 297 IGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLAS 356
            G SE   G++TA+ +VL +GD+  DP+ DS R+ILDGH+VL+R LAE+G YP +D  AS
Sbjct: 306 AGNSENPHGSLTAIYTVLAEGDDQQDPVVDSARAILDGHVVLSRQLAEQGHYPAIDINAS 365

Query: 357 VSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDF 416
           +SR            + ++   +   + + +++  +GGY+PG D  LD++V   P +  +
Sbjct: 366 ISRCMSTCTQPAHSTIANNFRQMYSNYLQVKELLPLGGYQPGQDPELDQSVSMYPHLRSY 425

Query: 417 LKQSPSD 423
           L+QS ++
Sbjct: 426 LQQSANE 432


>gi|225871930|ref|YP_002753384.1| flagellar protein export ATPase FliI [Acidobacterium capsulatum
           ATCC 51196]
 gi|225793979|gb|ACO34069.1| flagellar protein export ATPase FliI [Acidobacterium capsulatum
           ATCC 51196]
          Length = 450

 Score =  279 bits (713), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 153/351 (43%), Positives = 220/351 (62%), Gaps = 11/351 (3%)

Query: 74  PVGIGEEISLGDLVFHWGRFRISPS----ACWCGRVINALGKPIDGDDSLGKGDLSMEIM 129
           PV     I  GD V   G   + PS        GRV+NALG+P+D   SL   D ++ + 
Sbjct: 82  PVESSSGIRYGDTVAALG---VQPSIDVGEGLIGRVLNALGQPLDRAGSLRATD-ALPLE 137

Query: 130 SKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDK 189
             VP  ++R  +     TGIR ID    +  GQR+G+F GSG+GKSTL+ M  R+   D 
Sbjct: 138 RAVPHPLDRTPIRMPLGTGIRAIDSMLTVGRGQRVGIFGGSGVGKSTLIGMMTRNSDADV 197

Query: 190 VIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSK 248
           +++ LVGERGREV EF+ED LG +  K+SVVVV+TSD++P+LR  A L A T+AEYF+ +
Sbjct: 198 IVVGLVGERGREVGEFLEDSLGPEGRKRSVVVVSTSDQTPLLRMRAALAATTVAEYFADQ 257

Query: 249 GDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNIT 308
           G +VLL+LDS+TRFA + RE+   +GE P A+GY  SVFS L +L+ER G  +  +G+IT
Sbjct: 258 GKHVLLVLDSLTRFAMAAREVGLAAGEPPTAKGYTPSVFSRLAQLVERAG--QFREGSIT 315

Query: 309 AVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSAD 368
           A  +VL++GD+  D + D+VRS LDGH+VL+R+LA +G YPP++ L S+SRL     S +
Sbjct: 316 AFYTVLMEGDDQQDTLVDAVRSYLDGHVVLSRTLASQGWYPPIELLDSISRLMPSVASGE 375

Query: 369 EKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
            +   +++  ++  +  + D+  IG Y+ G D  LD A+     +  FL Q
Sbjct: 376 HRGAAATVRRMLAAYARSEDLVRIGAYKAGTDPELDDALRTREAVRAFLMQ 426


>gi|91223214|ref|ZP_01258480.1| putative flagellum-specific ATP synthase [Vibrio alginolyticus
           12G01]
 gi|91192027|gb|EAS78290.1| putative flagellum-specific ATP synthase [Vibrio alginolyticus
           12G01]
          Length = 448

 Score =  279 bits (713), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 146/367 (39%), Positives = 229/367 (62%), Gaps = 5/367 (1%)

Query: 60  GQVIRINLDIVYICPVG-IGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDS 118
            QV+     I Y+ P+  +G   +   ++   G   +  S+ W GRV+N LG+P+D    
Sbjct: 66  AQVVGFEHTIAYLMPIRRLGGLFAGAKVIPLDGDSTVQLSSQWLGRVLNGLGEPLDDGAP 125

Query: 119 LGKGD-LSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
           L  GD +S+E     P  + R+ V+     G+R I+    +  GQRIG+ AGSG+GKS L
Sbjct: 126 LKGGDRVSLEPKPINP--LKRRPVDTPLNVGVRAINGLLTVGKGQRIGLMAGSGVGKSVL 183

Query: 178 LSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPL 236
           + M  ++   D +++ L+GERGREVREFIE  L  +  KK++++ A +DESP++R  A L
Sbjct: 184 MGMITKNTEADVIVVGLIGERGREVREFIERNLTPEARKKAIIIAAPADESPLMRLRATL 243

Query: 237 TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLER 296
               ++EYF  +G +VLL++DS+TR+A + REIA + GE P +RGYP SVFS LP+LLER
Sbjct: 244 LCHRVSEYFRDQGKDVLLLMDSLTRYAMAQREIALSLGEPPASRGYPPSVFSVLPQLLER 303

Query: 297 IGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLAS 356
            G SE + G++TA+ +VL +GD+  DP+ DS R+ILDGH+VL+R LAE+G YP +D  AS
Sbjct: 304 AGNSENQHGSLTAIYTVLAEGDDQQDPVVDSARAILDGHVVLSRQLAEQGHYPAIDINAS 363

Query: 357 VSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDF 416
           +SR  +         + ++   +   + + +++  +GGY+PG D  LD++V   P +  +
Sbjct: 364 ISRCMNTCTQDAHSTIANNFRQMYSNYLQVKELLPLGGYQPGQDPELDQSVAMYPNLRAY 423

Query: 417 LKQSPSD 423
           L+Q+ ++
Sbjct: 424 LQQAANE 430


>gi|28901388|ref|NP_801043.1| putative flagellum-specific ATP synthase [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|260362942|ref|ZP_05775811.1| flagellar protein export ATPase FliI [Vibrio parahaemolyticus
           K5030]
 gi|260880229|ref|ZP_05892584.1| flagellar protein export ATPase FliI [Vibrio parahaemolyticus
           AN-5034]
 gi|260895346|ref|ZP_05903842.1| flagellar protein export ATPase FliI [Vibrio parahaemolyticus
           Peru-466]
 gi|260901171|ref|ZP_05909566.1| flagellar protein export ATPase FliI [Vibrio parahaemolyticus
           AQ4037]
 gi|28809935|dbj|BAC62876.1| putative flagellum-specific ATP synthase [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|308085703|gb|EFO35398.1| flagellar protein export ATPase FliI [Vibrio parahaemolyticus
           Peru-466]
 gi|308091672|gb|EFO41367.1| flagellar protein export ATPase FliI [Vibrio parahaemolyticus
           AN-5034]
 gi|308109341|gb|EFO46881.1| flagellar protein export ATPase FliI [Vibrio parahaemolyticus
           AQ4037]
 gi|308112402|gb|EFO49942.1| flagellar protein export ATPase FliI [Vibrio parahaemolyticus
           K5030]
 gi|328469322|gb|EGF40268.1| putative flagellum-specific ATP synthase [Vibrio parahaemolyticus
           10329]
          Length = 449

 Score =  279 bits (713), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 146/367 (39%), Positives = 227/367 (61%), Gaps = 5/367 (1%)

Query: 60  GQVIRINLDIVYICPVG-IGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDS 118
            QV+  +  + Y+ P+  +G   +   ++   G   +  S+ W GRV+N LG+P+D    
Sbjct: 66  AQVVGFDHTVAYLMPIRRLGGLFAGAKVIPLDGDSTVQLSSQWMGRVVNGLGEPLDDGMP 125

Query: 119 LGKGD-LSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
           L  GD +S+E     P  + R+ V+     G+R I+    +  GQRIG+ AGSG+GKS L
Sbjct: 126 LKGGDRVSLEPKPINP--LKRRPVDTPLNVGVRAINGLLTVGKGQRIGLMAGSGVGKSVL 183

Query: 178 LSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLK-KSVVVVATSDESPILRKMAPL 236
           + M  ++   D +++ L+GERGREVREFIE  L    + K++++ A +DESP++R  A L
Sbjct: 184 MGMITKNTEADVIVVGLIGERGREVREFIERNLTPEAREKAIIIAAPADESPLMRLRATL 243

Query: 237 TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLER 296
               +AEYF  +G +VLL++DS+TR+A + REIA + GE P +RGYP SVFS LP+LLER
Sbjct: 244 LCHRVAEYFRDQGKDVLLLMDSLTRYAMAQREIALSLGEPPASRGYPPSVFSVLPQLLER 303

Query: 297 IGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLAS 356
            G SE   G++TA+ +VL +GD+  DP+ DS R+ILDGH+VL+R LAE+G YP +D  AS
Sbjct: 304 AGNSENPHGSLTAIYTVLAEGDDQQDPVVDSARAILDGHVVLSRQLAEQGHYPAIDINAS 363

Query: 357 VSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDF 416
           +SR            + ++   +   + + +++  +GGY+PG D  LD++V   P +  +
Sbjct: 364 ISRCMSTCTQPAHSTIANNFRQMYSNYLQVKELLPLGGYQPGQDPELDQSVSMYPHLRSY 423

Query: 417 LKQSPSD 423
           L+QS ++
Sbjct: 424 LQQSANE 430


>gi|170738290|ref|YP_001779550.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Burkholderia cenocepacia MC0-3]
 gi|169820478|gb|ACA95060.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Burkholderia cenocepacia MC0-3]
          Length = 449

 Score =  279 bits (713), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 158/427 (37%), Positives = 250/427 (58%), Gaps = 6/427 (1%)

Query: 14  DYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYIC 73
           D + +L  +G  + ++ ++        +Y  L +    QG+      +V+  + D   + 
Sbjct: 26  DRAAHLSTRGKVMDALGTLIRVSGIDVRYGELCELRTGQGELM-QCAEVVGFSRDTALLS 84

Query: 74  PVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKV 132
           P G  + +S    V    R   I   +   GRV++++G+PIDG   +   + +  + +  
Sbjct: 85  PFGRLDGLSRDTQVVALRRPLAIPVGSALFGRVVDSMGRPIDGRGPIDTTE-TAALYAAP 143

Query: 133 PPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVII 192
           P AM+R  +E+   TG+RV+D    L  GQR+G+FA +G+GKSTL+ MFAR    D  +I
Sbjct: 144 PDAMSRPLLERSLDTGVRVVDGLMTLGEGQRVGIFAPAGVGKSTLMGMFARGTRCDLNVI 203

Query: 193 SLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDN 251
           +L+GERGREVREFIE  LG + + +S+VV ATSD S I R  A  +A  IAEYF  +G  
Sbjct: 204 ALIGERGREVREFIEQILGPEGIARSIVVCATSDRSSIERVKAAYSATAIAEYFRDRGKR 263

Query: 252 VLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVI 311
           VLL++DS+TRFA + REI   +GE P  RG+P S+F+ELPRLLER G S  E G+ITA+ 
Sbjct: 264 VLLMMDSLTRFARAQREIGLAAGEPPARRGFPPSIFAELPRLLERAGLS--EHGSITALY 321

Query: 312 SVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKK 371
           +VL + ++ +DP+A+ VR ILDGH++L+R +A   +YP +D LAS+SR+  +      ++
Sbjct: 322 TVLAEDESGSDPVAEEVRGILDGHMILSREIAARNQYPAIDVLASLSRVMPQVTDDAHRE 381

Query: 372 LVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQ 431
               +  L+ +  +   +  +G YR G D + D+AV ++  I  FL Q   + S+ +  +
Sbjct: 382 AAGHVRRLLAKHRDIETLLQLGEYRAGGDPVADEAVRKIEAIRQFLCQRTDEFSTREATR 441

Query: 432 EITKKLQ 438
           +  + L+
Sbjct: 442 DALRGLR 448


>gi|258404705|ref|YP_003197447.1| flagellar protein export ATPase FliI [Desulfohalobium retbaense DSM
           5692]
 gi|257796932|gb|ACV67869.1| flagellar protein export ATPase FliI [Desulfohalobium retbaense DSM
           5692]
          Length = 435

 Score =  279 bits (713), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 159/404 (39%), Positives = 244/404 (60%), Gaps = 16/404 (3%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDF--VVHQGKNSDNLGQVIRINLDIVYICPVGIGEEI 81
           G +++I  V     C +  V +G    +V +G  S    +V+     +  + P+G    +
Sbjct: 20  GKVTNIVGVLVQGYCPN--VSVGSLCEIVPEGGESPVQAEVVGFRDAMALLMPLGELRGL 77

Query: 82  SLGDLVFHWGRFRISP-SACWCGRVINALGKPIDGDDSLGKGDLSME----IMSKVPPAM 136
           + G+L+         P      GRV++A+G PIDG     KG LS+     I ++ P  M
Sbjct: 78  APGNLIKVLDSSATLPVGEDMLGRVLDAMGYPIDG-----KGPLSLPRSRMIYAQPPGPM 132

Query: 137 NRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVG 196
            R ++      G+  I+       GQR+ + AGSG+GKSTL+ M AR       +I+L+G
Sbjct: 133 ERAQISVPLDVGVSSINGLLTCGLGQRLAIMAGSGVGKSTLMGMIARDSKASINVIALIG 192

Query: 197 ERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLI 255
           ERGREVREFIE+ LG + LK+SVV+VATSD+SP+LR      A  +AE+F+ +G++V+LI
Sbjct: 193 ERGREVREFIENDLGPEGLKRSVVIVATSDQSPVLRMRGAFAATAVAEHFADQGEDVMLI 252

Query: 256 LDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLV 315
           +DS+TR+A + REI    GE P  +GYP SVF++LP+ LER G + K+ G+IT + +VLV
Sbjct: 253 MDSVTRYAMANREIGLAVGEPPTTKGYPPSVFAKLPKFLERAG-NFKKGGSITGLYTVLV 311

Query: 316 DGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSS 375
           +GD+ N+P+AD+VRSILDGHIVL+R LA +  YPP+D L S SRL  +    +  +  + 
Sbjct: 312 EGDDMNEPVADTVRSILDGHIVLDRRLANKNHYPPIDVLQSASRLMRQVVDEEHLQYSAQ 371

Query: 376 LTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
           + +++  + E+ D+  IG Y PG +  LD A++++  + +FL Q
Sbjct: 372 IQNVLATYRESEDLVTIGAYTPGTNRALDDALNRIESVNEFLTQ 415


>gi|291562024|emb|CBL40839.1| type III secretion system ATPase, FliI/YscN [butyrate-producing
           bacterium SS3/4]
          Length = 433

 Score =  279 bits (713), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 151/345 (43%), Positives = 221/345 (64%), Gaps = 5/345 (1%)

Query: 81  ISLGDLVFHWG-RFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQ 139
           I+ G  V + G R +I       GR+INALG PID       G L     + + P +NR 
Sbjct: 76  ITAGSFVRNTGCRLQIPVGDFLKGRIINALGHPIDEKGEFPPGKLYTVDSAYINP-LNRP 134

Query: 140 RVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERG 199
            + +  + GI+ ID    +  GQR+G+FAGSG+GKSTL+ M AR+   D  +I+LVGERG
Sbjct: 135 PIREHLEFGIKAIDGLNTIGKGQRMGIFAGSGVGKSTLMGMIARNVKTDINVIALVGERG 194

Query: 200 REVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDS 258
           REV EF++  LG+  +K+SV++VATSD+  +LR   PL A TIAEYF  +G +VLL++DS
Sbjct: 195 REVLEFVKKDLGEEGMKRSVLIVATSDQPAMLRMKCPLVATTIAEYFRDQGADVLLMMDS 254

Query: 259 ITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGD 318
           +TR+A + REI    GE P+ARGY  S+++E PRLLER G     KG+IT + +VLV+GD
Sbjct: 255 LTRYAMAQREIGLAIGEPPIARGYTPSIYAEFPRLLERSG--NFAKGSITGIYTVLVEGD 312

Query: 319 NHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTH 378
           + N+P+AD+VR ILDGHIVL+R LA    +P +D  AS+SRL +     + +K  S   +
Sbjct: 313 DTNEPVADTVRGILDGHIVLSRQLANANHFPAIDISASISRLMNDIAGEEHRKAASRFRN 372

Query: 379 LIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSD 423
           ++  +++  D+  IG Y+ G +  LD+AV ++  +  FL+Q  ++
Sbjct: 373 MLSLYQKNADLISIGAYKKGANSALDEAVDRIGDMNKFLEQETNE 417


>gi|153835939|ref|ZP_01988606.1| FliIL [Vibrio parahaemolyticus AQ3810]
 gi|149750693|gb|EDM61438.1| FliIL [Vibrio parahaemolyticus AQ3810]
          Length = 449

 Score =  279 bits (713), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 146/367 (39%), Positives = 227/367 (61%), Gaps = 5/367 (1%)

Query: 60  GQVIRINLDIVYICPVG-IGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDS 118
            QV+  +  + Y+ P+  +G   +   ++   G   +  S+ W GRV+N LG+P+D    
Sbjct: 66  AQVVGFDHTVAYLMPIRRLGGLFAGAKVIPLDGDSTVQLSSQWMGRVVNGLGEPLDDGIP 125

Query: 119 LGKGD-LSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
           L  GD +S+E     P  + R+ V+     G+R I+    +  GQRIG+ AGSG+GKS L
Sbjct: 126 LKGGDRVSLEPKPINP--LKRRPVDTPLNVGVRAINGLLTVGKGQRIGLMAGSGVGKSVL 183

Query: 178 LSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLK-KSVVVVATSDESPILRKMAPL 236
           + M  ++   D +++ L+GERGREVREFIE  L    + K++++ A +DESP++R  A L
Sbjct: 184 MGMITKNTEADVIVVGLIGERGREVREFIERNLTPEAREKAIIIAAPADESPLMRLRATL 243

Query: 237 TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLER 296
               +AEYF  +G +VLL++DS+TR+A + REIA + GE P +RGYP SVFS LP+LLER
Sbjct: 244 LCHRVAEYFRDQGKDVLLLMDSLTRYAMAQREIALSLGEPPASRGYPPSVFSVLPQLLER 303

Query: 297 IGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLAS 356
            G SE   G++TA+ +VL +GD+  DP+ DS R+ILDGH+VL+R LAE+G YP +D  AS
Sbjct: 304 AGNSENPHGSLTAIYTVLAEGDDQQDPVVDSARAILDGHVVLSRQLAEQGHYPAIDINAS 363

Query: 357 VSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDF 416
           +SR            + ++   +   + + +++  +GGY+PG D  LD++V   P +  +
Sbjct: 364 ISRCMSTCTQPAHSTIANNFRQMYSNYLQVKELLPLGGYQPGQDPELDQSVSMYPHLRSY 423

Query: 417 LKQSPSD 423
           L+QS ++
Sbjct: 424 LQQSANE 430


>gi|315639098|ref|ZP_07894265.1| flagellum-specific ATP synthase FliI [Campylobacter upsaliensis
           JV21]
 gi|315480802|gb|EFU71439.1| flagellum-specific ATP synthase FliI [Campylobacter upsaliensis
           JV21]
          Length = 452

 Score =  279 bits (713), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 166/422 (39%), Positives = 237/422 (56%), Gaps = 10/422 (2%)

Query: 4   NLETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFV---VHQGKNSDNLG 60
           +LE L +  +D  +NL    G I+ I++    +  L   V  GD V    ++ +N   L 
Sbjct: 2   SLEKLRKKLKD--ENLASVFGEITKISATNIEIQGLKTGV--GDIVRLISNENENLQTLA 57

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVF-HWGRFRISPSACWCGRVINALGKPIDGDDSL 119
            V+ +     Y+ P    E   +GD  F      +I  S    GRV++   KP DG  ++
Sbjct: 58  MVVEVKAQFSYLSPFSFIEGFKIGDKAFLSDAGMQIGVSDALLGRVVDPFMKPKDGKGAI 117

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
                 M IM     AM R  +E+ F TG++ ID       GQ++G+FAGSG+GKSTL+ 
Sbjct: 118 EISKF-MPIMRSPIDAMKRGLIEEIFPTGVKTIDGLLTCGVGQKLGIFAGSGVGKSTLMG 176

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAV 239
           M  ++      +I+L+GERGRE+ EFI+  LG  L  +V++VATSD+S ++RK     A+
Sbjct: 177 MIVKNSKAPVKVIALIGERGREIPEFIQKNLGGKLDDTVIIVATSDDSALMRKYGAFCAM 236

Query: 240 TIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGP 299
           ++AEYF  +G +VL I+DS+TRFA + REI    GE P  +GYP SV S LP+L+ER G 
Sbjct: 237 SVAEYFKEQGKDVLFIMDSVTRFAMAQREIGLALGEPPTTKGYPPSVLSLLPQLMERTG- 295

Query: 300 SEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSR 359
            E+ KG ITA  +VLVDGD+ +DPIAD  RSILDGHIVL+R L + G YPP++   S SR
Sbjct: 296 KEEGKGTITAFFTVLVDGDDMSDPIADQSRSILDGHIVLSRELTDFGIYPPINIQNSASR 355

Query: 360 LADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
           +     S   K        L    +E   +  IG Y+ G D  LD+A+ +  ++  FL Q
Sbjct: 356 VMSDIISDTHKNNARKFKRLSSLLKENEVLLRIGAYQKGSDKELDEAIMKKDLMQKFLSQ 415

Query: 420 SP 421
           +P
Sbjct: 416 TP 417


>gi|152997448|ref|YP_001342283.1| flagellar protein export ATPase FliI [Marinomonas sp. MWYL1]
 gi|150838372|gb|ABR72348.1| flagellar protein export ATPase FliI [Marinomonas sp. MWYL1]
          Length = 443

 Score =  279 bits (713), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 161/392 (41%), Positives = 234/392 (59%), Gaps = 4/392 (1%)

Query: 32  VYYTVTCLSQYVCLGDFV-VHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHW 90
           V  T+  +   V LGD   V   K+     +V+    D+ Y+ P    E IS G  V   
Sbjct: 31  VGLTMEAVGCVVALGDRCSVQVRKDRWVESEVVGFTGDLTYLMPTEAIEGISPGARVRPL 90

Query: 91  -GRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGI 149
            G  ++       GRV+N LGKP+DG   +   D S+ +   V   + R+ + +    GI
Sbjct: 91  LGDSKMPVGDELLGRVVNGLGKPLDGKGPIKTKD-SVTLHGNVINPLQRKPISEPLDVGI 149

Query: 150 RVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDY 209
           + I+    +  GQR+G+FAGSG+GKS LL M  +    D  ++ L+GERGREV+EFI+  
Sbjct: 150 KAINSLLTVGKGQRLGLFAGSGVGKSMLLGMMTKFTEADITVVGLIGERGREVKEFIDQI 209

Query: 210 LGDN-LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIRE 268
           LG+  L +SVVV + +D+S ++R  A + A  IAEY+  +G NVLL++DS+TR+A + RE
Sbjct: 210 LGEEGLSRSVVVASPADDSALMRLRAAMLATRIAEYYRDQGKNVLLLMDSLTRYAQAQRE 269

Query: 269 IATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSV 328
           IA + GE P  +GYP SVFS+LP+L+ER G   +  G++TA  +VL +GD+  DPIAD+ 
Sbjct: 270 IALSVGEPPATKGYPPSVFSKLPQLVERAGNGCEGSGSVTAFYTVLTEGDDQQDPIADAS 329

Query: 329 RSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRD 388
           R+ILDGHIVL+R LAEEG YP +D  AS+SR      S D       +  L  +F++ +D
Sbjct: 330 RAILDGHIVLSRRLAEEGHYPAIDIEASISRAMPHIVSEDHLYGAMRVKQLYSKFQQNQD 389

Query: 389 IRLIGGYRPGVDLILDKAVHQVPIIYDFLKQS 420
           +  +G Y  G D  LD+A+ Q+P I +FL+QS
Sbjct: 390 LISVGAYARGSDPDLDQAIIQMPEIRNFLQQS 421


>gi|292669729|ref|ZP_06603155.1| flagellar protein export ATPase FliI [Selenomonas noxia ATCC 43541]
 gi|292648526|gb|EFF66498.1| flagellar protein export ATPase FliI [Selenomonas noxia ATCC 43541]
          Length = 461

 Score =  279 bits (713), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 164/373 (43%), Positives = 228/373 (61%), Gaps = 14/373 (3%)

Query: 70  VYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSLGKGDLSME- 127
           V + PVG  + I  G  V   GR  R+       GRV++ LG PIDG   +    L+ E 
Sbjct: 80  VLLMPVGEMQGIGPGCEVIATGRRLRVKVGEELLGRVLDGLGNPIDGKGPI----LAQEE 135

Query: 128 --IMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSD 185
             + +  PP + R R+      G+R ID    L  GQRIG+ AGSG+GKSTLLSM AR+ 
Sbjct: 136 YPLQAPPPPPLTRPRIHDNLYVGVRAIDGLITLGDGQRIGIMAGSGVGKSTLLSMIARNT 195

Query: 186 CFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEY 244
             D  +I+LVGERGREVR+FIE  LG + LK+SVVVVATSD+  ++R    +T   IAEY
Sbjct: 196 EADISVITLVGERGREVRDFIERDLGEEGLKRSVVVVATSDQPALVRIKGAMTGTAIAEY 255

Query: 245 FSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEK 304
           F  +G  V+L++DS+TRFA + RE+    GE P  RGY  SVF+ LPRLLER G S  E+
Sbjct: 256 FRDQGHKVVLMMDSVTRFAMAQREVGLTIGEPPATRGYTPSVFAMLPRLLERAGTS--ER 313

Query: 305 GNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKA 364
           G+IT + +VLVDGD+ N+PIAD+VRSILDGHIVL+R +A +  +P +D L SVSR+  + 
Sbjct: 314 GSITGIYTVLVDGDDMNEPIADAVRSILDGHIVLSRRIAAQNHFPAIDVLGSVSRVMYEV 373

Query: 365 WSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDL 424
                 +    +  L+  + E  D+  IG Y  G    +D A+ ++  I +FL+Q   ++
Sbjct: 374 VDKSHLEAAQEMRQLMAVYAEAEDLIHIGAYVKGSSPKIDAAIQKIDGINEFLRQDIYEV 433

Query: 425 SSEDVFQEITKKL 437
           +S   ++E  ++L
Sbjct: 434 TS---YEETEQQL 443


>gi|303240285|ref|ZP_07326804.1| flagellar protein export ATPase FliI [Acetivibrio cellulolyticus
           CD2]
 gi|302592195|gb|EFL61924.1| flagellar protein export ATPase FliI [Acetivibrio cellulolyticus
           CD2]
          Length = 438

 Score =  279 bits (713), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 159/370 (42%), Positives = 223/370 (60%), Gaps = 13/370 (3%)

Query: 70  VYICPVGIGEEISLGDLVFHWGRF-RISPSACWCGRVINALGKPIDGDDSLGKGDLSMEI 128
           V + P+G    I  G  V   G +   +   C  GRVI+ LG PIDG     KGDL +E 
Sbjct: 69  VILMPLGDMTGIGPGSTVVATGEYLSAAVGNCMVGRVIDGLGNPIDG-----KGDLKVET 123

Query: 129 MSKV----PPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARS 184
              V    P  + R R+      G++ ID    +  GQR+G+FAGSG+GKSTL+ M AR+
Sbjct: 124 SYPVNNDPPHPLMRNRINDPLPLGVKTIDGLLTIGKGQRVGIFAGSGVGKSTLIGMIARN 183

Query: 185 DCFDKVIISLVGERGREVREFIE-DYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAE 243
              D  +I+L+GERGREVREFIE D   + L +SVVVVATSD+  ++R      A  IAE
Sbjct: 184 TKADINVIALIGERGREVREFIEKDLKEEGLSRSVVVVATSDQPALVRLKGAFIATAIAE 243

Query: 244 YFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKE 303
           YF  +G +VLL++DS+TRFA + REI    GE PV+RGY  SVFS +P+LLER G S  +
Sbjct: 244 YFRDQGKDVLLLMDSLTRFAMAQREIGLAVGEPPVSRGYTPSVFSSMPKLLERAGNS--Q 301

Query: 304 KGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADK 363
            G+IT + +VLVDGD+  +P+ D+ R ILDGHIVL+R+LA   +YP +D LASVSR+   
Sbjct: 302 SGSITGLYTVLVDGDDLTEPVTDTARGILDGHIVLSRALANRNQYPAIDVLASVSRVMSD 361

Query: 364 AWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSD 423
             +++ KK+ + +  ++    +  D+  IG Y  G +  +D A+  +  I +F++Q   D
Sbjct: 362 IVTSEHKKIANQMKKVMAIHRDAEDLINIGAYVKGSNEKIDYAIAHIDKILEFIEQGTHD 421

Query: 424 LSSEDVFQEI 433
             S D   E+
Sbjct: 422 NYSFDEVVEL 431


>gi|91200226|emb|CAJ73270.1| strongly similar to flagellar ATPase fliI [Candidatus Kuenenia
           stuttgartiensis]
          Length = 439

 Score =  279 bits (713), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 156/374 (41%), Positives = 229/374 (61%), Gaps = 16/374 (4%)

Query: 70  VYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSLGKGDLSME- 127
           + + P+G  E I  G+ V   G    +       GR++  LG+P+DG     KG L++E 
Sbjct: 71  ILLMPIGELERIGPGNRVTASGSPLTVGVGMGLMGRILGGLGEPMDG-----KGPLNVEE 125

Query: 128 ---IMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARS 184
              I +  P  + R R+++  +TG+R ID       GQR+G+FAGSG+GKSTL+ M AR+
Sbjct: 126 RVSIYNSPPDPLTRSRIKEVLETGVRAIDGMLTFGQGQRLGIFAGSGVGKSTLMGMIARN 185

Query: 185 DCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAE 243
              +  +I+L+GERGREVREF+E  LG + +KKSV+V  TSD+  +LR      A +IAE
Sbjct: 186 SGAEVNVIALIGERGREVREFVEKNLGEEGMKKSVIVSVTSDKPALLRVKGAYIASSIAE 245

Query: 244 YFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKE 303
           YF  +G  VLL++DS+TRFA++ REI    GE P ++GY  SVF+ LP+LLER G     
Sbjct: 246 YFRDRGMRVLLMMDSVTRFANAQREIGLAIGEPPTSKGYTPSVFALLPKLLERSGTG--T 303

Query: 304 KGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADK 363
           KG+IT + +VLVDGD+ N+PIAD+VR ILDGH+VL+R++A +  YP +D + SVSR  D 
Sbjct: 304 KGSITGLYTVLVDGDDMNEPIADAVRGILDGHVVLSRAMASQNHYPAIDIMESVSRCMDD 363

Query: 364 AWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSD 423
             + + +K    L  +   ++E  D+  IG Y  G +  +D A+  +  I ++LKQ   D
Sbjct: 364 IITGEHRKAAQMLKAVYATYKEAEDMINIGAYAKGGNKKIDYALSVIDAINEYLKQ---D 420

Query: 424 LSSEDVFQEITKKL 437
           +++   F E   KL
Sbjct: 421 MTTNGNFNESISKL 434


>gi|254486056|ref|ZP_05099261.1| flagellum-specific ATP synthase [Roseobacter sp. GAI101]
 gi|214042925|gb|EEB83563.1| flagellum-specific ATP synthase [Roseobacter sp. GAI101]
          Length = 445

 Score =  278 bits (712), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 156/390 (40%), Positives = 234/390 (60%), Gaps = 3/390 (0%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFV-VHQGKNSDNLGQVIRINLDIVYICPVGIGEEIS 82
           G I+ +      V+ L    CLGD V + +   SD  G++++++  I+        + ++
Sbjct: 24  GRITLVDQGAVQVSGLGTEACLGDRVKIRRRSGSDLFGEIVQLDGTILTALLENAPDGVA 83

Query: 83  LGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVE 142
           + D VF      I PS  W GRVI++ G P+DG   L  G  +  + +  P A  R+ + 
Sbjct: 84  VHDRVFLASAGEIFPSPQWIGRVIDSSGHPLDGK-PLPCGPQAQPLRASPPGAAERKPLG 142

Query: 143 KGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREV 202
           +  +TG+ + +   P+  GQR+G+FAGSGIGKSTLL   A     D V+I++VGERGREV
Sbjct: 143 QRLETGLEITNTLLPIVEGQRVGLFAGSGIGKSTLLGTLASKMQADVVVIAMVGERGREV 202

Query: 203 REFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITR 261
           R FI+D LG + L ++VVV ATSD+S +LR+    TA+ +AE+F  +G +VL + DS+TR
Sbjct: 203 RHFIDDVLGPEGLARTVVVAATSDQSALLRRRCAWTAMAVAEFFRDQGKSVLFLADSVTR 262

Query: 262 FAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHN 321
           FA + REIA +SGE PV RGYP S    + +L ER GP    +GNIT + SVLV G + +
Sbjct: 263 FAEAHREIAVSSGEAPVLRGYPPSTAHMIMQLCERAGPGHLGQGNITGLFSVLVAGSDMD 322

Query: 322 DPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIH 381
           +PIAD +R +LDGHI+L+R++AE GR+P +D L SVSR    A +  E K++  +  ++ 
Sbjct: 323 EPIADILRGVLDGHIILDRAIAERGRFPAIDVLRSVSRSLPAAATEGENKILKQVRKILG 382

Query: 382 RFEETRDIRLIGGYRPGVDLILDKAVHQVP 411
            +E    +   G Y  G D  +D+++   P
Sbjct: 383 VYERNSMMISAGLYTSGSDPEIDQSIALWP 412


>gi|192362186|ref|YP_001982194.1| flagellum-specific ATP synthase [Cellvibrio japonicus Ueda107]
 gi|190688351|gb|ACE86029.1| flagellum-specific ATP synthase FliI [Cellvibrio japonicus Ueda107]
          Length = 476

 Score =  278 bits (712), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 152/373 (40%), Positives = 227/373 (60%), Gaps = 12/373 (3%)

Query: 55  NSDNL---GQVIRINLDIVYICPVGIGEEISLGDLVF----HWGRFRISPSACWCGRVIN 107
           NSDN     +V+    D V++ PV   E +  G  V       G  RI P     GRVIN
Sbjct: 69  NSDNRRIEAEVVGFAGDKVFLMPVKRVEGLQPGARVIPVAGQMG-MRIGPQ--LLGRVIN 125

Query: 108 ALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVF 167
            +G+P+D    L  GD  ++   +    + R  + +    G+R I+    +  GQR+G+F
Sbjct: 126 GIGQPLDAKGPLA-GDEYLDFNPRDINPLQRHPISETLDVGVRAINALITVGRGQRLGLF 184

Query: 168 AGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDE 226
           AGSG+GKS L+ M  +    D V++ L+GERGREV+EFI+  LG+  L+++VVV + +D+
Sbjct: 185 AGSGVGKSVLMGMMTKFTTADIVVVGLIGERGREVKEFIDHILGEEGLRRAVVVASPADD 244

Query: 227 SPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSV 286
           +P++R  A L A  IAEY+  +G NVLL++DS+TRFA + REIA   GE P  +GYP SV
Sbjct: 245 APLMRLRASLLASRIAEYYRDQGQNVLLLMDSLTRFAQAQREIALAIGEPPATKGYPPSV 304

Query: 287 FSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEG 346
           F+++P+L+ER G + + +G+ITA  +VL +GD+  DPIADS R+ILDGH+VL+R LAEEG
Sbjct: 305 FAKIPQLVERAGNAAEGEGSITAFYTVLTEGDDLQDPIADSARAILDGHVVLSRRLAEEG 364

Query: 347 RYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKA 406
            YP +D  +S+SR        +  K++     L+ R+++ RD+  IG Y  G D   D A
Sbjct: 365 VYPAIDVESSISRAMQNIVDDEHLKMMQRFKQLLARYQQNRDLIAIGAYTQGADPETDAA 424

Query: 407 VHQVPIIYDFLKQ 419
           + + P +  F++Q
Sbjct: 425 IERFPHLRAFIQQ 437


>gi|224825759|ref|ZP_03698863.1| ATPase, FliI/YscN family [Lutiella nitroferrum 2002]
 gi|224601983|gb|EEG08162.1| ATPase, FliI/YscN family [Lutiella nitroferrum 2002]
          Length = 436

 Score =  278 bits (712), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 159/367 (43%), Positives = 223/367 (60%), Gaps = 16/367 (4%)

Query: 61  QVIRINLDIVYICP----VGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGD 116
           QV+    ++ Y+ P    VG+     +       G F I PS  W GR++N LG+P+DG 
Sbjct: 57  QVVGFKREVSYLMPFKKPVGLTTGARVQPAPDAAGLF-IGPS--WLGRIVNGLGEPLDGL 113

Query: 117 DSLGKGDLSMEIMSKVPPAMN--RQR-VEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIG 173
             LG        ++  PP +N  R+R V+     G+R I+    L  GQR+G+FAGSG+G
Sbjct: 114 GRLG----GEHPLAAHPPRVNPLRKRPVDTPLDVGVRAINGLLTLGRGQRVGLFAGSGVG 169

Query: 174 KSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRK 232
           KS LL M  R    D V++ L+GERGREVREF+E  LG + L K+V+VVA +DESP++R 
Sbjct: 170 KSVLLGMITRHTEADVVVVGLIGERGREVREFVEHALGAEGLAKAVLVVAPADESPLMRL 229

Query: 233 MAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPR 292
            A     TIA +F  +G +VLL++DS+TR+A + RE+A   GE P  RGYP SVF  LP 
Sbjct: 230 KATELTHTIAAHFRDQGRHVLLLVDSLTRYAMAQREVALALGEPPATRGYPPSVFGLLPT 289

Query: 293 LLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVD 352
           L E  G  E E G+++A+ +VL +GD+  DP+ D+ R+ILDGHIVL+R LAE G YP +D
Sbjct: 290 LAESAGNGEGE-GSMSAIYTVLAEGDDQQDPVVDTARAILDGHIVLSRGLAERGHYPAID 348

Query: 353 PLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPI 412
             ASVSR         +++   +L  L  R++E R +  +GGY PG D   D+AV ++P+
Sbjct: 349 IAASVSRCMGLVAGVSQREAARTLRGLWARYQEVRALIPLGGYVPGADAETDRAVQRMPL 408

Query: 413 IYDFLKQ 419
           I  FL+Q
Sbjct: 409 IERFLRQ 415


>gi|325109015|ref|YP_004270083.1| type III secretion system ATPase, FliI/YscN [Planctomyces
           brasiliensis DSM 5305]
 gi|324969283|gb|ADY60061.1| type III secretion system ATPase, FliI/YscN [Planctomyces
           brasiliensis DSM 5305]
          Length = 442

 Score =  278 bits (712), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 164/379 (43%), Positives = 234/379 (61%), Gaps = 13/379 (3%)

Query: 50  VHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGD---LVFHWGRFRISPSACWCGRVI 106
           +  G+      +VI +  D + + P G    I  GD   LV    R R+       GRVI
Sbjct: 47  IEAGQRQGIDAEVIGLEDDEIILQPYGELAGIKRGDTVRLVHSAQRIRVGDR--LLGRVI 104

Query: 107 NALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGV 166
           NA G+ IDGD      +  M   + + P + R R+ +  +TG+R ID       GQR+G+
Sbjct: 105 NARGEFIDGDLPPVLPESLMLQNAPIAP-LQRPRITERLETGVRAIDSLLTCGQGQRLGI 163

Query: 167 FAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSD 225
           FAGSG+GKSTLL   AR    D  ++ LVGERGREVREF+E  LG+   ++SV+VVATS+
Sbjct: 164 FAGSGVGKSTLLGQLARYASADVNVVVLVGERGREVREFLERDLGEEGRRRSVLVVATSE 223

Query: 226 ESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTS 285
           ES +LR+        +AEYF  +G NVLL++DS+TR+A + REI   +GE P  RGYP S
Sbjct: 224 ESALLRRQCANVGTAVAEYFRDQGKNVLLMMDSVTRYALAQREIGLAAGEPPATRGYPPS 283

Query: 286 VFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEE 345
           VF+ LPRLLER G    E+G+IT + +VLV+GD+ N+PIAD+VR ILDGHIVL+R LA +
Sbjct: 284 VFALLPRLLERSG--RTERGSITGLYTVLVEGDDTNEPIADTVRGILDGHIVLSRDLAHK 341

Query: 346 GRYPPVDPLASVSRLADKAWSADEKKLVSS--LTHLIHRFEETRDIRLIGGYRPGVDLIL 403
             +P +D L S+SRL ++   ADE  L ++  L  L+  + ++ D+  IG Y+ G + ++
Sbjct: 342 AHWPAIDILGSISRLMNEL--ADETHLAAARQLKQLMAAYRQSEDLINIGAYQHGSNRVV 399

Query: 404 DKAVHQVPIIYDFLKQSPS 422
           D+A+   P I +FL+Q+ +
Sbjct: 400 DRAIQLKPRIDEFLQQTST 418


>gi|307722059|ref|YP_003893199.1| flagellar protein export ATPase FliI [Sulfurimonas autotrophica DSM
           16294]
 gi|306980152|gb|ADN10187.1| flagellar protein export ATPase FliI [Sulfurimonas autotrophica DSM
           16294]
          Length = 435

 Score =  278 bits (712), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 165/425 (38%), Positives = 240/425 (56%), Gaps = 10/425 (2%)

Query: 16  SKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFV--VHQGKNSDNLGQVIRINLDIVYIC 73
           +KN  V  G +  I +   T   L  +V + D V  V      + +G V  I+ D+ +I 
Sbjct: 12  NKNYSVSFGEVVKINATIITAKGL--HVSISDMVKIVSDTTGQETVGMVTEIDADLFFIT 69

Query: 74  PVGIGEEISLGDLVF-HWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKV 132
           P    E    GD VF       I       GRV++   +PIDG  S+    L+  I + +
Sbjct: 70  PFSFVEGFRSGDKVFLDATGLNIPVGPALLGRVVDPFMRPIDGKGSVKDAKLAPIIKAPI 129

Query: 133 PPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVII 192
             AM R  +++ F  G++ ID       GQ++G+FAGSG+GKSTL+ M  R       ++
Sbjct: 130 A-AMKRGMIDEVFSVGVKSIDGLLSCGKGQKLGIFAGSGVGKSTLMGMIVRGADAPIKVV 188

Query: 193 SLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNV 252
           +L+GERGREV EFIE  LG +L  +V+VVATSD+SP++RK     A+++AEYF  +G +V
Sbjct: 189 ALIGERGREVPEFIEKNLGGDLTNTVIVVATSDDSPLMRKYGAFAAMSVAEYFKDQGRDV 248

Query: 253 LLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVIS 312
           L I+DS+TRFA + REI    GE P ++GYP S  + LP+L+ER G  E+ KG+ITA  +
Sbjct: 249 LFIMDSVTRFAMAQREIGLALGEPPTSKGYPPSSLTLLPQLMERAG-KEEGKGSITAFFT 307

Query: 313 VLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKL 372
           VL++GD+ +DPIAD  RSILDGHIVL+R + + G YPPV  L S SR+     +    K 
Sbjct: 308 VLIEGDDMSDPIADQSRSILDGHIVLSREMTDFGIYPPVHILNSASRVMSDIITPQHLKA 367

Query: 373 VSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQE 432
           V     L    +E   +  IG Y  G D  LD+A+++   +  F+ Q+ +  +S   F E
Sbjct: 368 VMKFRRLYTLLKENETLIRIGAYTQGSDAELDEAINKKEDMEAFITQNSTVQTS---FSE 424

Query: 433 ITKKL 437
            ++ L
Sbjct: 425 TSQAL 429


>gi|153831717|ref|ZP_01984384.1| FliIL [Vibrio harveyi HY01]
 gi|148872227|gb|EDL71044.1| FliIL [Vibrio harveyi HY01]
          Length = 449

 Score =  278 bits (712), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 147/367 (40%), Positives = 228/367 (62%), Gaps = 5/367 (1%)

Query: 60  GQVIRINLDIVYICPVG-IGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDS 118
            QV+  +  + Y+ P+  +G   +   ++   G   +  S+ W GRV+N LG+P D    
Sbjct: 66  AQVVGFDHTVAYLMPIRRLGGLFAGAKVIPLDGDSTVQLSSQWLGRVVNGLGEPFDDGAP 125

Query: 119 LGKGD-LSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
           L  GD +S+E     P  + R+ V+     G+R I+    +  GQRIG+ AGSG+GKS L
Sbjct: 126 LKGGDRVSLEPKPINP--LKRRPVDTPLDVGVRAINGLLTVGKGQRIGLMAGSGVGKSVL 183

Query: 178 LSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPL 236
           + M  ++   D +++ L+GERGREVREF+E  L  +  KK+++V A +DESP++R  A L
Sbjct: 184 MGMITQNTEADVIVVGLIGERGREVREFVERNLTPEARKKAIIVAAPADESPLMRLRATL 243

Query: 237 TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLER 296
               +AEYF  +G +VLL++DS+TR+A + REIA + GE P +RGYP SVFS LP+LLER
Sbjct: 244 LCHRVAEYFRDQGKDVLLLMDSLTRYAMAQREIALSLGEPPASRGYPPSVFSVLPQLLER 303

Query: 297 IGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLAS 356
            G S+   G++TA+ +VL +GD+  DP+ DS R+ILDGH+VL+R LAE+G YP +D  AS
Sbjct: 304 AGNSDNPNGSLTAIYTVLAEGDDQQDPVVDSARAILDGHVVLSRQLAEQGHYPAIDINAS 363

Query: 357 VSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDF 416
           +SR  +         + ++   L   + + +++  +GGY+PG D  LD++V   P +  +
Sbjct: 364 ISRCMNACTHEAHSTIANNFRQLYSNYLQVKELLPLGGYQPGQDPELDQSVSMYPHLRAY 423

Query: 417 LKQSPSD 423
           L+QS ++
Sbjct: 424 LQQSANE 430


>gi|315127316|ref|YP_004069319.1| flagellum-specific ATP synthase [Pseudoalteromonas sp. SM9913]
 gi|315015830|gb|ADT69168.1| flagellum-specific ATP synthase [Pseudoalteromonas sp. SM9913]
          Length = 444

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 145/332 (43%), Positives = 213/332 (64%), Gaps = 6/332 (1%)

Query: 100 CWCGRVINALGKPIDGDDSLGK--GDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTP 157
              GRV++ LG+P+DG   LGK   + +++        + R+ + K    G+R I+    
Sbjct: 103 SLLGRVVDGLGRPLDG---LGKINAEHTLKFAQNAINPLARRPISKPMDVGVRAINSVIT 159

Query: 158 LCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKK 216
           +  GQR+G+FAGSG+GKS LL M  R    D +++ LVGERGREV+EFIE+ LG +  K+
Sbjct: 160 VGQGQRMGLFAGSGVGKSVLLGMMTRGSEADVIVVGLVGERGREVKEFIEEILGVEGRKR 219

Query: 217 SVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGEL 276
           SVVV A +D SP++R     +AVTIAEYF  +G NVLL+LDS+TR+A + REIA   GE 
Sbjct: 220 SVVVAAPADASPLMRLKGCESAVTIAEYFRDQGLNVLLLLDSVTRYAMAQREIALAVGEP 279

Query: 277 PVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHI 336
           P  +GYP SVF++LP L+ER G   + +G+ITA  +VL +GD+  DPIAD+ R+ILDGHI
Sbjct: 280 PATKGYPPSVFAKLPALVERAGNGGEGQGSITAFFTVLSEGDDMQDPIADAARAILDGHI 339

Query: 337 VLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYR 396
           VL+R LA+ G YP +D   S+SR+  +  S    +    L  +   +++ +D+  +G Y+
Sbjct: 340 VLSRDLADSGHYPAIDIEKSISRVMPQVVSESHMQQARVLKQVYSMYQQNKDMITLGAYQ 399

Query: 397 PGVDLILDKAVHQVPIIYDFLKQSPSDLSSED 428
            G D +LD+A++ +P +  FL+Q   D+ S D
Sbjct: 400 KGSDQMLDQAINMMPRVNAFLQQGMRDVISYD 431


>gi|126665012|ref|ZP_01735995.1| flagellum-specific ATP synthase [Marinobacter sp. ELB17]
 gi|126630382|gb|EBA00997.1| flagellum-specific ATP synthase [Marinobacter sp. ELB17]
          Length = 479

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 158/401 (39%), Positives = 234/401 (58%), Gaps = 10/401 (2%)

Query: 32  VYYTVTCLSQYVCLGDFVVHQGKNSDNL-GQVIRINLDIVYICPVGIGEEISLGDLVFHW 90
           V  T+ C+   + +GD  V Q + S  +  +V+    + VY+ P+   E +  G LV   
Sbjct: 48  VGLTLECVGVPMVVGDRCVIQSQGSSVVEAEVVGFEDEKVYLMPLTAIEGLRPGALVVPL 107

Query: 91  GRF-RISPSACWCGRVINALGKPIDGDDSL---GKGDLSMEIMSKVPPAMNRQRVEKGFK 146
               R+       GRV++  G+P+DG   L    +  LS +I++     +NR  V +   
Sbjct: 108 SSTSRVPVGNQLLGRVVDGSGEPLDGKGPLHAEARVSLSGDIINP----LNRAPVRQPMD 163

Query: 147 TGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFI 206
            GIR I+    +  GQR+G+FAGSG+GKS LL M  R    D  ++ L+GERGREV+EFI
Sbjct: 164 VGIRAINALLTVGQGQRLGLFAGSGVGKSVLLGMMTRFTNADVTVVGLIGERGREVKEFI 223

Query: 207 EDYLGDN-LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHS 265
           ED LG+  L +SVVV + +D+SP++R  A +    IAE++  +G  VLL++DS+TR+A +
Sbjct: 224 EDILGEEGLARSVVVASPADDSPLMRLRAAMLTTRIAEFYRDQGKRVLLLMDSLTRYAQA 283

Query: 266 IREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIA 325
            REIA   GE P  +GYP SVF++LP+L+ER G      G+ITA  +VL +GD+  DPIA
Sbjct: 284 QREIALAVGEPPATKGYPPSVFAKLPQLVERTGNGRPGGGSITAFYTVLTEGDDQQDPIA 343

Query: 326 DSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEE 385
           D+ R+ILDGHIVL+R LAEEG YP +D  AS+SR+  +    +          +  R+++
Sbjct: 344 DAARAILDGHIVLSRRLAEEGHYPAIDVEASISRVMPQVTEPEHFARAQRFKQVYSRYQQ 403

Query: 386 TRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
            RD+  +G Y  G D   D A+  +  +  FLKQ  S+ +S
Sbjct: 404 ARDLISVGAYVKGSDPETDFAIAHIANMRQFLKQGLSEKTS 444


>gi|54307262|ref|YP_128282.1| putative FliI, flagellum-specific ATP synthase [Photobacterium
           profundum SS9]
 gi|46911682|emb|CAG18480.1| Putative FliI, flagellum-specific ATP synthase [Photobacterium
           profundum SS9]
          Length = 446

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 145/338 (42%), Positives = 210/338 (62%), Gaps = 3/338 (0%)

Query: 84  GDLVFHW-GRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVE 142
           G  VF   G  +I+      GRV+N LG+P+D    +   D  + +  +    + R  + 
Sbjct: 88  GSRVFPLHGDSKINVGYSMLGRVLNGLGEPLDSRGPI-TADQRINLQGETINPLQRLPIS 146

Query: 143 KGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREV 202
                G+RVI+    +  GQR+G+FAGSG+GKS LL M  R+   +  ++ L+GERGREV
Sbjct: 147 TQLDVGVRVINSMLSVGKGQRMGLFAGSGVGKSVLLGMMTRNTTAEITVVGLIGERGREV 206

Query: 203 REFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITR 261
           REFIE  LG + +K +VV+ + +D+ P++R  A +    IAE+F  +G +VLL++DS+TR
Sbjct: 207 REFIEHSLGPEGMKNAVVIASPADDPPLMRLRASMLCHRIAEFFRDQGHDVLLLMDSLTR 266

Query: 262 FAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHN 321
           +A + REIA   GE P  +GYP SVFS LP+L+ER G    EKG+ITA  +VL +GD+  
Sbjct: 267 YAQAQREIALAVGEPPATKGYPPSVFSMLPQLVERAGNGATEKGSITAFYTVLSEGDDQQ 326

Query: 322 DPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIH 381
           DPIAD+ R+ILDGHIVLNR LAE+G YP +D   S+SR   +  + ++ +    +  L  
Sbjct: 327 DPIADAARAILDGHIVLNRELAEQGHYPAIDIEQSISRAMPQVVTPEQLQKAQQVKQLYA 386

Query: 382 RFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
           R+ + +D+  +GGY+ G D  LD AVH  P I DFL+Q
Sbjct: 387 RYRQVQDLISLGGYQQGQDQNLDMAVHYYPEICDFLQQ 424


>gi|312602777|ref|YP_004022622.1| type III secretion cytoplasmic ATPase SctN [Burkholderia
           rhizoxinica HKI 454]
 gi|306431580|emb|CBK52132.1| type III secretion cytoplasmic ATPase SctN [Burkholderia
           rhizoxinica HKI 454]
 gi|312170091|emb|CBW77103.1| type III secretion cytoplasmic ATPase SctN [Burkholderia
           rhizoxinica HKI 454]
          Length = 459

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 166/422 (39%), Positives = 239/422 (56%), Gaps = 13/422 (3%)

Query: 16  SKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNL--GQVIRINLDIVYIC 73
           S   + + G +  +      V  L   V LG+    +  +   L   +VI    D+  + 
Sbjct: 36  STRAIARNGKVLEVIGTLVKVGGLD--VTLGELCELRAADGSLLQHAEVIGFTRDVALLS 93

Query: 74  PVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSLGKGDLSME--IMS 130
           P    E IS    V   GR   +       GRVI++LG+PIDG    G  D + E  I +
Sbjct: 94  PFSRLESISRSTRVIGLGRPLSVPVGEGLLGRVIDSLGQPIDG---FGPIDANEERPIFA 150

Query: 131 KVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKV 190
             P  M+R+ +E    TG+RV+D    L  GQR+G+FA +G+GKSTLL MFAR    D  
Sbjct: 151 DSPDPMSRRMIEYPLATGVRVVDSMMTLAEGQRMGIFAPAGVGKSTLLGMFARGAQCDVT 210

Query: 191 IISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKG 249
           +I+L+GERGREVREF+E  LG + + +SVVV ATSD S I R  A   A  IAEYF  +G
Sbjct: 211 VIALIGERGREVREFVELILGKEGMARSVVVCATSDRSSIERAKAAYVATAIAEYFRDRG 270

Query: 250 DNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITA 309
             VLL++DS+TRFA + REI   +GE P  RG+P S+F+ELPRLLER G      G+ITA
Sbjct: 271 QRVLLMMDSLTRFARAQREIGLAAGEPPARRGFPPSIFAELPRLLERAGMG--ATGSITA 328

Query: 310 VISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADE 369
           + +VL + ++ +DPIA+ VR ILDGH++L+R +A   +YP +D L S+SR+  +    + 
Sbjct: 329 LYTVLAEDESGSDPIAEEVRGILDGHMILSREIAARNQYPAIDVLGSLSRVMSQVMPREY 388

Query: 370 KKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDV 429
               + +  L+ +  E   +  IG Y+PG + + D+A+ ++  I DFL Q   + +  D 
Sbjct: 389 VDAAARVRELLAKHREVEMLLQIGEYQPGGNPLADEAIAKIDAIRDFLGQRTDEWADPDD 448

Query: 430 FQ 431
            Q
Sbjct: 449 TQ 450


>gi|332533123|ref|ZP_08408992.1| flagellum-specific ATP synthase FliI [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332037405|gb|EGI73859.1| flagellum-specific ATP synthase FliI [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 444

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 145/332 (43%), Positives = 213/332 (64%), Gaps = 6/332 (1%)

Query: 100 CWCGRVINALGKPIDGDDSLGK--GDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTP 157
              GRV++ LG+P+DG   LGK   +  ++        ++R+ + K    G+R I+    
Sbjct: 103 SLLGRVVDGLGRPLDG---LGKINAEHHLKFAQNTINPLSRRPITKPMDVGVRAINSVIT 159

Query: 158 LCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKK 216
           +  GQR+G+FAGSG+GKS LL M  R    D +++ LVGERGREV+EFIE+ LG +  K+
Sbjct: 160 VGQGQRMGLFAGSGVGKSVLLGMMTRGSEADVIVVGLVGERGREVKEFIEEILGVEGRKR 219

Query: 217 SVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGEL 276
           SVVV A +D SP++R     +AVTIAEYF  +G NVLL+LDS+TR+A + REIA   GE 
Sbjct: 220 SVVVAAPADSSPLMRLKGCESAVTIAEYFRDQGLNVLLLLDSVTRYAMAQREIALAVGEP 279

Query: 277 PVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHI 336
           P  +GYP SVF++LP L+ER G   + +G+ITA  +VL +GD+  DPIAD+ R+ILDGHI
Sbjct: 280 PATKGYPPSVFAKLPALVERAGNGGEGQGSITAFFTVLSEGDDMQDPIADAARAILDGHI 339

Query: 337 VLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYR 396
           VL+R LA+ G YP +D   S+SR+  +  S    +    L  +   +++ +D+  +G Y+
Sbjct: 340 VLSRDLADSGHYPAIDIEKSISRVMPQVVSEPHMQQARVLKQVYSMYQQNKDMITLGAYQ 399

Query: 397 PGVDLILDKAVHQVPIIYDFLKQSPSDLSSED 428
            G D +LD+A++ +P +  FL+Q   D+ S D
Sbjct: 400 KGTDQMLDQAINMMPRVNAFLQQGMRDVISYD 431


>gi|160880846|ref|YP_001559814.1| flagellar protein export ATPase FliI [Clostridium phytofermentans
           ISDg]
 gi|160429512|gb|ABX43075.1| flagellar protein export ATPase FliI [Clostridium phytofermentans
           ISDg]
          Length = 434

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 153/340 (45%), Positives = 228/340 (67%), Gaps = 10/340 (2%)

Query: 101 WCGRVINALGKPIDGDD-SLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLC 159
             G+ ++ LG P+D    SL +   S  + +K P  M+R+ + +    G+R +D    + 
Sbjct: 98  LLGQTLDGLGNPMDMSTLSLSE---SYPVDAKAPDPMDRELIGEVLSLGVRAVDGLLTIG 154

Query: 160 HGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSV 218
            GQRIG+FAGSG+GKSTLL MFAR+   D  +I+L+GERGREV+EFIE  LG + +K+SV
Sbjct: 155 KGQRIGIFAGSGVGKSTLLGMFARNTKADINVIALIGERGREVKEFIERDLGPEGVKRSV 214

Query: 219 VVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPV 278
           +V+ATSD+  ++RK A  TA  IAEYF  KG +VLL++DS+TRF+ + REI   SGE PV
Sbjct: 215 LVIATSDKPALIRKKAAKTATAIAEYFRDKGKDVLLMMDSLTRFSMAQREIGLASGEPPV 274

Query: 279 ARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVL 338
           +RGYP SV+SE+P+LLER G S  +KG+IT + +VLVDGD+ N+PI D+ R ILDGHIVL
Sbjct: 275 SRGYPPSVYSEMPKLLERAGNS--DKGSITGLYTVLVDGDDFNEPITDTARGILDGHIVL 332

Query: 339 NRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPG 398
           +R +A++  YP +D LAS+SR+     +++ KKL   L  ++  +++  D+  IG Y+PG
Sbjct: 333 SRKMAQKNHYPAIDVLASISRVMSAIATSEHKKLAGKLKMVLATYQDAEDLINIGAYKPG 392

Query: 399 VDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
            +  +D ++ ++  + +FL Q   D +    F++   KL+
Sbjct: 393 TNKNIDYSMRKIEQVNEFLCQQVDDKAD---FEDTIHKLE 429


>gi|23099013|ref|NP_692479.1| flagellum-specific ATP synthase [Oceanobacillus iheyensis HTE831]
 gi|22777241|dbj|BAC13514.1| flagellar-specific H(+)-transporting ATP synthase [Oceanobacillus
           iheyensis HTE831]
          Length = 439

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 158/388 (40%), Positives = 236/388 (60%), Gaps = 8/388 (2%)

Query: 55  NSDN--LGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGK 111
           N+D+  L +V+    + + + P     E+  G LV   G+   +       G+V+N+LGK
Sbjct: 49  NTDHALLAEVVGFRNEKIILMPYTEVTEVGPGCLVEATGKPLTVKVGRGLVGKVLNSLGK 108

Query: 112 PIDGDDSLGKGDLSMEIMSKVPP-AMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGS 170
           P++  + L KG L+  +  + PP  + R  +    + G++ ID    +  GQR+G+FAGS
Sbjct: 109 PLNDTEELPKG-LANFMTEQTPPNPLERPPIRTPLQVGVKAIDSLLTMGEGQRVGLFAGS 167

Query: 171 GIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPI 229
           G+GKSTLL M AR+   +  +I+L+GERGREVREFIE+ LG + LKKS+VVVATSD+  +
Sbjct: 168 GVGKSTLLGMIARNSSAEINVIALIGERGREVREFIENDLGPEGLKKSIVVVATSDQPAL 227

Query: 230 LRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSE 289
           +R     TA  I+EYF   G  V L++DS+TR A + REI    GE P  +GY  SVFS 
Sbjct: 228 MRIKGAYTATAISEYFRDLGYKVNLMMDSVTRVAMAQREIGLAVGEPPTTKGYTPSVFSI 287

Query: 290 LPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYP 349
           LP+LLER G +    G IT   +VLVDGD+ N+PIAD+VR ILDGH +L+R LAE G++P
Sbjct: 288 LPKLLERTGTN--ANGTITGFYTVLVDGDDMNEPIADAVRGILDGHFILDRKLAERGQFP 345

Query: 350 PVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQ 409
            ++ L S+SR+ +     + K+   +L  L+  +EE +++  IG Y+ G +  +D+A+  
Sbjct: 346 AINVLKSISRVMNVIADEEHKEQSQTLRKLLSTYEENQELITIGAYKKGTNHEIDQAISF 405

Query: 410 VPIIYDFLKQSPSDLSSEDVFQEITKKL 437
            P I +FLKQ   +  + D   ++ K L
Sbjct: 406 QPYILEFLKQGIHEKRTFDETIQMMKNL 433


>gi|77359744|ref|YP_339319.1| flagellum-specific ATP synthase [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76874655|emb|CAI85876.1| flagellum-specific ATP synthase [Pseudoalteromonas haloplanktis
           TAC125]
          Length = 444

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 145/332 (43%), Positives = 214/332 (64%), Gaps = 6/332 (1%)

Query: 100 CWCGRVINALGKPIDGDDSLGK--GDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTP 157
              GRV++ LG+P+DG   LGK   +  ++   K    ++R+ + +    G+R I+    
Sbjct: 103 SLLGRVVDGLGRPLDG---LGKINAEHYLKFAQKPINPLSRRPISQPMDVGVRAINSVIT 159

Query: 158 LCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKK 216
           +  GQR+G+FAGSG+GKS LL M  R    D +++ LVGERGREV+EFIE+ LG +  K+
Sbjct: 160 VGQGQRMGLFAGSGVGKSVLLGMMTRGSEADVIVVGLVGERGREVKEFIEEILGVEGRKR 219

Query: 217 SVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGEL 276
           SVVV A +D SP++R     +AVTIAEYF  +G NVLL+LDS+TR+A + REIA   GE 
Sbjct: 220 SVVVAAPADSSPLMRLKGCESAVTIAEYFRDQGLNVLLLLDSVTRYAMAQREIALAVGEP 279

Query: 277 PVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHI 336
           P  +GYP SVF++LP L+ER G   + +G+ITA  +VL +GD+  DPIAD+ R+ILDGHI
Sbjct: 280 PATKGYPPSVFAKLPALVERAGNGGEGQGSITAFFTVLSEGDDMQDPIADAARAILDGHI 339

Query: 337 VLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYR 396
           VL+R LA+ G YP +D   S+SR+  +  S    +    L  +   +++ +D+  +G Y+
Sbjct: 340 VLSRELADSGHYPAIDIEKSISRVMPQVVSETHMQQARVLKQVYSMYQQNKDMITLGAYQ 399

Query: 397 PGVDLILDKAVHQVPIIYDFLKQSPSDLSSED 428
            G D +LD+A++ +P +  FL+Q   D+ S D
Sbjct: 400 KGTDQMLDQAINMMPRVNAFLQQGMRDVISYD 431


>gi|206895959|ref|YP_002246686.1| flagellum-specific ATP synthase [Coprothermobacter proteolyticus
           DSM 5265]
 gi|206738576|gb|ACI17654.1| flagellum-specific ATP synthase [Coprothermobacter proteolyticus
           DSM 5265]
          Length = 438

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 171/414 (41%), Positives = 243/414 (58%), Gaps = 21/414 (5%)

Query: 11  LAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIV 70
           L E Y K L V G  I ++T   +     S         V++        +V+       
Sbjct: 18  LFEVYGKVLNVSGLSIEALTPASFVGELCS---------VNRFDGKPMFAEVVGFKEGKT 68

Query: 71  YICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSLGKGDLSME-- 127
            + P+G  + I    L+   GR   I  S    GRV+NA+G+P+D      KG +  E  
Sbjct: 69  LLMPIGDVQGIGPNSLIRAMGRPLWIKVSDGLVGRVVNAIGEPLDD-----KGPVYGEKR 123

Query: 128 -IMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDC 186
            +    P  + R+ + +  +T I+ ID    +  GQR+G+FAGSG+GKSTLL M AR+  
Sbjct: 124 SVYQDPPHPLKRKIITEPLQTSIKAIDGLLTVGKGQRVGIFAGSGVGKSTLLGMIARNSS 183

Query: 187 FDKVIISLVGERGREVREFIE-DYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYF 245
            D  +I LVGERGREVR+FIE D   +  K+SVVVVATSD+  +LR  A LT +TIAEYF
Sbjct: 184 ADVNVIILVGERGREVRKFIEEDLTEEGAKRSVVVVATSDQPALLRVKAVLTGMTIAEYF 243

Query: 246 SSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKG 305
             +G +VL+++DS+TR A + RE+  + GE P  RGY  SVF+ LP++LER G S+K  G
Sbjct: 244 RDQGKDVLVMMDSVTRLAMAQREVGLSIGEPPTTRGYTPSVFALLPKILERAGNSDK--G 301

Query: 306 NITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAW 365
           +ITA I+VLV+GD+ N+P+AD+VRSILDGHIVL+R+LA    YP +D L S+SR+ +   
Sbjct: 302 SITAFITVLVEGDDMNEPVADAVRSILDGHIVLSRALAHRAHYPAIDVLQSISRVMNDVV 361

Query: 366 SADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
           SA   KL + +  L+  + E  D+  IG Y+ G +  +D+A+  +  I  FL Q
Sbjct: 362 SAKHLKLANRMRELLAVYTEAEDLINIGAYQRGNNPKIDEALDYIDAINHFLLQ 415


>gi|330808218|ref|YP_004352680.1| flagellum-specific ATP synthase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327376326|gb|AEA67676.1| flagellum-specific ATP synthase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 452

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 152/356 (42%), Positives = 215/356 (60%), Gaps = 3/356 (0%)

Query: 70  VYICPVGIGEEISLGDLVFHWG-RFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEI 128
           V++ PVG    I+ G  V       R+       GRV++  G+ +DG   +   D     
Sbjct: 77  VFLMPVGSVAGIAPGARVVPLADNGRLPMGMSMLGRVLDGAGRALDGKGGMKAEDWVPMD 136

Query: 129 MSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFD 188
              + P + R  +      GIR I+    +  GQR+G+FAG+G+GKS LL M  R    D
Sbjct: 137 GPTINP-LKRDPISVPLDVGIRCINGLLTVGRGQRLGLFAGTGVGKSVLLGMMTRFTEAD 195

Query: 189 KVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSS 247
            +++ L+GERGREV+EFIE  LG+  LK+SVVV + +D++P++R  A +    IAEYF  
Sbjct: 196 IIVVGLIGERGREVKEFIEHILGEEGLKRSVVVASPADDAPLMRLRAAMYCTRIAEYFRD 255

Query: 248 KGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNI 307
           KG NVLL++DS+TRFA + REIA   GE P  +GYP SVF++LP+L+ER G +EK  G+I
Sbjct: 256 KGKNVLLLMDSLTRFAQAQREIALAIGEPPATKGYPPSVFAKLPKLVERAGNAEKGGGSI 315

Query: 308 TAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSA 367
           TA  +VL +GD+  DPIADS R +LDGHIVL+R LAEEG YP +D  AS+SR+     SA
Sbjct: 316 TAFYTVLSEGDDQQDPIADSARGVLDGHIVLSRRLAEEGHYPAIDIEASISRVMPSVISA 375

Query: 368 DEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSD 423
           +  K          R++++RD+  +G Y PG D   D A+   P +  +L+QS +D
Sbjct: 376 EHMKRAQQFKQYWSRYQQSRDLISVGAYVPGGDRETDTAISLYPAMAVYLRQSLND 431


>gi|327543131|gb|EGF29567.1| flagellum-specific ATP synthase [Rhodopirellula baltica WH47]
          Length = 467

 Score =  278 bits (710), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 165/420 (39%), Positives = 248/420 (59%), Gaps = 12/420 (2%)

Query: 24  GYISSITSVYYTVTCLSQYV-CLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEIS 82
           G ++S+T    TV  ++  +  + + +    K +  L +VI  +     + P+     ++
Sbjct: 34  GRVASVTGDAVTVQGMTAPLGAICELMPPDAKPT--LARVIGFDDTRPILAPMEAISALA 91

Query: 83  LGDLVFHWGR---FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQ 139
            GD V    R    R+  S   CGRVI+A G+PIDG   L    + +      P +++R 
Sbjct: 92  AGDRVRLVSRSLTLRVGDS--LCGRVIDAFGRPIDGK-PLSDDLVRVSASRAAPDSLDRP 148

Query: 140 RVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERG 199
            +++  +TG+R ID       GQR+G+FAGSG+GKSTLL M  R    D+++I++VGERG
Sbjct: 149 PIDEPLQTGVRAIDAMLTCGVGQRLGIFAGSGVGKSTLLGMLTRGTTADRIVIAMVGERG 208

Query: 200 REVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDS 258
           REV+EF++  LG   LK+SVVVVATSD+    R  A  TA  IAE F  +G  VLL++DS
Sbjct: 209 REVQEFMQRALGAAGLKRSVVVVATSDKPAAQRLSAAWTATAIAEQFRDEGHRVLLLVDS 268

Query: 259 ITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGD 318
           +TRFA + RE+   +GE P  RGYP SVF+ LP+L+ER G     KG+ITA  +VLV+GD
Sbjct: 269 VTRFAMAQRELGLAAGEPPTTRGYPPSVFNMLPQLVERAG--RTTKGSITAFYTVLVEGD 326

Query: 319 NHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTH 378
           ++N+PI+D+VR +LDGHIVLNR LA  G YPP+D   S+SR+A+   + +  +    +  
Sbjct: 327 DNNEPISDTVRGLLDGHIVLNRKLAHRGHYPPIDIPESISRVANHLVTPETYQATLGIRE 386

Query: 379 LIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
            + +++ + D+  IG YR G D  +D A+     I D L+Q  ++++     Q   +KL 
Sbjct: 387 HMVQYQTSEDLISIGAYRSGSDPRVDTAIAMRDPINDLLRQDANEITPIADSQARVQKLH 446


>gi|83716747|ref|YP_438376.1| flagellum-specific ATP synthase [Burkholderia thailandensis E264]
 gi|167614822|ref|ZP_02383457.1| flagellum-specific ATP synthase [Burkholderia thailandensis Bt4]
 gi|257141407|ref|ZP_05589669.1| flagellum-specific ATP synthase [Burkholderia thailandensis E264]
 gi|83650572|gb|ABC34636.1| flagellum-specific ATP synthase FliI [Burkholderia thailandensis
           E264]
          Length = 435

 Score =  278 bits (710), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 160/397 (40%), Positives = 228/397 (57%), Gaps = 9/397 (2%)

Query: 46  GDFVVHQGKNSDNL-GQVIRINLDIVYICPVGIGEEISLGDLVF---HWGRFRISPSACW 101
           G+  V +  + D +  QV+  N +  ++ P      +  G  V      G  RI  S  W
Sbjct: 41  GERCVIESADGDRIDAQVVGFNREETFLMPFKKPVGLVAGAQVLSCDRQGSLRIGRS--W 98

Query: 102 CGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHG 161
            GR++N LG+ IDG   LG GD+++         + ++ V      G+R ID    L  G
Sbjct: 99  LGRIVNGLGEAIDGRGPLG-GDVALRAHPAPVNPLRKRPVRDTLDVGVRAIDGLLTLGRG 157

Query: 162 QRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVV 220
           QR+G+ AGSG+GKS LL M  R+   D V++ L+GERGREVREF++  LG+  L KSV+V
Sbjct: 158 QRVGLMAGSGVGKSMLLGMITRATQADVVVVGLIGERGREVREFVDHALGEAGLAKSVLV 217

Query: 221 VATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVAR 280
            A +DESP++R  A      IA +F   G NVLL++DS+TR+A + REIA + GE P  R
Sbjct: 218 AAPADESPLMRLKAAELCHAIAAHFRDTGANVLLLVDSLTRYAMAQREIALSVGEPPATR 277

Query: 281 GYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNR 340
           GYP SVF  LP+L+E  G  E   G+++A+ +VL +GD+ NDP+ D+ R+ILDGHIVL R
Sbjct: 278 GYPPSVFGMLPQLVETAGNGEG-AGSMSAIYTVLAEGDDQNDPVVDTARAILDGHIVLTR 336

Query: 341 SLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVD 400
            LAE G YP +D   SVSR   +   A+ + L   +  +I R E+ RD+  +GGY  G D
Sbjct: 337 ELAERGHYPAIDVPRSVSRCMSQVAGAEHEALARKVKEMIGRHEQVRDLIPLGGYVQGAD 396

Query: 401 LILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKL 437
              D+AV +   I  FL+Q   D++  D      ++L
Sbjct: 397 PATDEAVAKAARIDAFLRQDMRDVARRDATLAALREL 433


>gi|149189869|ref|ZP_01868149.1| putative flagellum-specific ATP synthase [Vibrio shilonii AK1]
 gi|148836355|gb|EDL53312.1| putative flagellum-specific ATP synthase [Vibrio shilonii AK1]
          Length = 448

 Score =  278 bits (710), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 151/367 (41%), Positives = 227/367 (61%), Gaps = 5/367 (1%)

Query: 60  GQVIRINLDIVYICPV-GIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDS 118
            QV+  + +I Y+ PV  +G   +   ++   G   ++  + W GRV+N LG+ +D    
Sbjct: 65  AQVVGFDHNIAYLMPVRQLGGLFAGAKVIPLDGDSSVNLGSHWLGRVVNGLGEALDDGAV 124

Query: 119 LGKGD-LSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
           L  GD +S+E     P  + R+ V+     G+R I+    +  GQRIG+ AGSG+GKS L
Sbjct: 125 LKGGDRVSLEPKPINP--LKRRPVDTPLDVGVRAINGLLTVGKGQRIGLMAGSGVGKSVL 182

Query: 178 LSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPL 236
           + M  ++   D +++ L+GERGREVREFIE  L  +  KK++++ A +DESP++R  A L
Sbjct: 183 MGMITQNTEADVIVVGLIGERGREVREFIERNLTPEARKKAIIIAAPADESPLMRLRATL 242

Query: 237 TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLER 296
               +AEYF  KG++VLL++DS+TR+A + REIA   GE P +RGYP SVFS LP+LLER
Sbjct: 243 LCHRVAEYFRDKGNDVLLLMDSLTRYAMAQREIALALGEPPASRGYPPSVFSVLPQLLER 302

Query: 297 IGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLAS 356
            G SE   G++TA+ +VL +GD+  DP+ DS R+ILDGH+VL+RSLAE+G YP +D  AS
Sbjct: 303 AGNSEHPDGSLTAIYTVLAEGDDQQDPVVDSARAILDGHVVLSRSLAEQGHYPAIDINAS 362

Query: 357 VSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDF 416
           +SR            L +    L   + + +++  +GGY+PG D  LD++V   P +  +
Sbjct: 363 ISRCMSGCTPEAHSTLANQFRQLYSNYLQVKELLPLGGYQPGQDPELDQSVAMHPQLKKY 422

Query: 417 LKQSPSD 423
           L Q+ +D
Sbjct: 423 LLQAAND 429


>gi|167576647|ref|ZP_02369521.1| flagellum-specific ATP synthase [Burkholderia thailandensis TXDOH]
          Length = 435

 Score =  278 bits (710), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 160/397 (40%), Positives = 228/397 (57%), Gaps = 9/397 (2%)

Query: 46  GDFVVHQGKNSDNL-GQVIRINLDIVYICPVGIGEEISLGDLVF---HWGRFRISPSACW 101
           G+  V +  + D +  QV+  N +  ++ P      +  G  V      G  RI  S  W
Sbjct: 41  GERCVIESADGDRIDAQVVGFNREETFLMPFKKPVGLVAGAQVLSCDRQGSLRIGRS--W 98

Query: 102 CGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHG 161
            GR++N LG+ IDG   LG GD+++         + ++ V      G+R ID    L  G
Sbjct: 99  LGRIVNGLGEAIDGRGPLG-GDVALRAHPAPVNPLRKRPVRDTLDVGVRAIDGLLTLGRG 157

Query: 162 QRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVV 220
           QR+G+ AGSG+GKS LL M  R+   D V++ L+GERGREVREF++  LG+  L KSV+V
Sbjct: 158 QRVGLMAGSGVGKSMLLGMITRATQADVVVVGLIGERGREVREFVDHALGEAGLAKSVLV 217

Query: 221 VATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVAR 280
            A +DESP++R  A      IA +F   G NVLL++DS+TR+A + REIA + GE P  R
Sbjct: 218 AAPADESPLMRLKAAELCHAIAAHFRDTGANVLLLVDSLTRYAMAQREIALSVGEPPATR 277

Query: 281 GYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNR 340
           GYP SVF  LP+L+E  G  E   G+++A+ +VL +GD+ NDP+ D+ R+ILDGHIVL R
Sbjct: 278 GYPPSVFGMLPQLVEMAGNGEG-AGSMSAIYTVLAEGDDQNDPVVDTARAILDGHIVLTR 336

Query: 341 SLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVD 400
            LAE G YP +D   SVSR   +   A+ + L   +  +I R E+ RD+  +GGY  G D
Sbjct: 337 ELAERGHYPAIDVPRSVSRCMSQVAGAEHEALARKVKEMIGRHEQVRDLIPLGGYVQGAD 396

Query: 401 LILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKL 437
              D+AV +   I  FL+Q   D++  D      ++L
Sbjct: 397 PATDEAVAKAARIDAFLRQDMRDVARRDATLAALREL 433


>gi|312135851|ref|YP_004003189.1| atpase, flii/yscn family [Caldicellulosiruptor owensensis OL]
 gi|311775902|gb|ADQ05389.1| ATPase, FliI/YscN family [Caldicellulosiruptor owensensis OL]
          Length = 434

 Score =  278 bits (710), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 158/403 (39%), Positives = 241/403 (59%), Gaps = 17/403 (4%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICP----VGI-- 77
           G+++ +  +  T+      V +G     +   ++ L +V+    + V + P    VG+  
Sbjct: 22  GFVNQVIGL--TIESQGPAVSIGTLCRIKAAKTETLAEVVGFKENKVLLMPYSDLVGVFP 79

Query: 78  GEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMN 137
           G ++   D +F      I       GR+++ LG+PIDG   + K  +   + ++ P  + 
Sbjct: 80  GCKVIAQDSIFE-----IKVGNELLGRILDGLGQPIDGKGEI-KSKIKYPVENRAPNPLE 133

Query: 138 RQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGE 197
           R R++     GI+ ID    +  GQR+G+FAGSG+GKSTLL M AR+   D  +++L+GE
Sbjct: 134 RPRIDTIMPLGIKAIDALLTIGRGQRVGIFAGSGVGKSTLLGMIARNAKADVNVLALIGE 193

Query: 198 RGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLIL 256
           RGRE++EF+E  L D  LK+SVVVVATSDES + R  A   A+ IAEYF  +G +VL ++
Sbjct: 194 RGRELKEFLEKDLKDEGLKRSVVVVATSDESALKRVKAAYVAMAIAEYFRDQGLDVLFLM 253

Query: 257 DSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVD 316
           DS+TRFA + REI    GE PV+RGY  SVFS +P+LLER G  +   G+ITA+ +VLVD
Sbjct: 254 DSLTRFAMAQREIGLAVGEPPVSRGYTPSVFSIMPKLLERAG--KNRNGSITALFTVLVD 311

Query: 317 GDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSL 376
           GD+ N+PI D+ R ILDGHIVL+R++A +  YP +D LAS+SR+ +       ++L +  
Sbjct: 312 GDDFNEPITDTARGILDGHIVLSRAIANKNHYPAIDVLASISRVMNDIVEPFHRELANQT 371

Query: 377 THLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
             ++  + E  D+  IG Y  G +  +D+A+  +P I  FL+Q
Sbjct: 372 KRILAVYREAEDLINIGAYTKGSNPEIDRAIDLMPRINQFLRQ 414


>gi|82702477|ref|YP_412043.1| ATPase FliI/YscN [Nitrosospira multiformis ATCC 25196]
 gi|82410542|gb|ABB74651.1| ATPase FliI/YscN [Nitrosospira multiformis ATCC 25196]
          Length = 470

 Score =  278 bits (710), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 162/440 (36%), Positives = 245/440 (55%), Gaps = 29/440 (6%)

Query: 3   KNLETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQV 62
           KN   LA+++  +  +     G ++ +T +    T L   V  G  ++    NS    +V
Sbjct: 15  KNCSGLAEVSPPFQIS-----GSLTRVTGLIMEATGLKLAVGSGCTILMPNGNSME-AEV 68

Query: 63  IRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSA---------------------CW 101
           +  + D +Y+ P      ++ G  V  W R  + P+                        
Sbjct: 69  VGFHGDRLYLMPAHGMFGLAPGAKVVPWDRTGVLPNPGSASRQRRRASDQISRFPVGEAL 128

Query: 102 CGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHG 161
            GRV++  G+P+D    L     +    S + P ++R+ + +    G+R I+    +  G
Sbjct: 129 LGRVVDGTGRPLDNLGPLEVERSASAAGSPINP-LDREPISEVLDVGVRAINALLTVGRG 187

Query: 162 QRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVV 220
           QR+G+FAGSG+GKS LL M AR    D +++ L+GERGREV++FIE  LG + L +SVVV
Sbjct: 188 QRMGLFAGSGVGKSVLLGMMARYTSADIIVVGLIGERGREVKDFIEQILGAEGLARSVVV 247

Query: 221 VATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVAR 280
            A +D  P++R      A ++AEYF  +G NVLLI+DS+TR+A + REIA   GE P  +
Sbjct: 248 AAPADTWPLMRLQGASYATSVAEYFRDQGKNVLLIMDSLTRYAMAQREIALAIGEPPATK 307

Query: 281 GYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNR 340
           GYP SVF++LP+L+ER G   K  G+ITA  +VL +GD+  DPIAD+ R+ILDGHIVL+R
Sbjct: 308 GYPPSVFAKLPQLVERAGNGVKGSGSITAFYTVLAEGDDQQDPIADAARAILDGHIVLSR 367

Query: 341 SLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVD 400
            LAE G YP +D  AS+SR      S +  + V +   L  R++ +RD+  +G Y PG D
Sbjct: 368 QLAESGHYPAIDIEASISRAMTSLISPEYFEQVRNFKQLFSRYQRSRDLISVGAYSPGND 427

Query: 401 LILDKAVHQVPIIYDFLKQS 420
            +LD+A+   P +  FL+Q+
Sbjct: 428 RLLDRAIALYPKLEHFLQQT 447


>gi|42524760|ref|NP_970140.1| flagellum-specific ATP synthase [Bdellovibrio bacteriovorus HD100]
 gi|39576970|emb|CAE78199.1| flagellum-specific ATP synthase [Bdellovibrio bacteriovorus HD100]
          Length = 442

 Score =  278 bits (710), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 151/343 (44%), Positives = 220/343 (64%), Gaps = 14/343 (4%)

Query: 101 WCGRVINALGKPIDGDDSLGKGDLS----MEIMSKVPPAMNRQRVEKGFKTGIRVIDIFT 156
             GRV++ LG+P+D      KG++     + + S+V   ++R+ + +    GIR I+   
Sbjct: 103 LLGRVVDGLGRPLDD-----KGEVENFREVPLYSEVRNPLDRRPIREPIDLGIRAINGAL 157

Query: 157 PLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLK 215
               GQR+ + AGSG+GKS LL M AR+   D  +I+++GERGREVREFIE  LG + +K
Sbjct: 158 TAGLGQRVAIMAGSGVGKSVLLGMMARNTNADVNVIAMIGERGREVREFIEHDLGPEGMK 217

Query: 216 KSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGE 275
           +SVVV  TSD+SP+LR      A  +AEYFSS+G NVLL++DS+TRFA + REI  ++GE
Sbjct: 218 RSVVVCVTSDQSPLLRMRGAYVATALAEYFSSQGKNVLLMMDSVTRFAMAQREIGLSTGE 277

Query: 276 LPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGH 335
            P  +GY  SVF+ LP+LLER G  E E G+IT   + LV+GD+ NDPI DSVRSI+DGH
Sbjct: 278 PPSQKGYTPSVFATLPKLLERAGSFEGE-GSITGFYTTLVEGDDMNDPIGDSVRSIVDGH 336

Query: 336 IVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGY 395
           IVL+RSLA++G +P +D + S SR+     S +  KL   L   +  +++  D+  IG Y
Sbjct: 337 IVLSRSLAQKGHFPAIDIMQSASRVMRAVSSPEHSKLAQKLRETLAVYKDAEDLINIGAY 396

Query: 396 RPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
           +PG +  +D+AV  +  + DFLKQ   D ++   F +  +++Q
Sbjct: 397 KPGSNPKIDRAVKVIDQVNDFLKQRVEDPTN---FTQTVRQMQ 436


>gi|32477553|ref|NP_870547.1| flagellum-specific ATP synthase [Rhodopirellula baltica SH 1]
 gi|32448107|emb|CAD77624.1| flagellum-specific ATP synthase [Rhodopirellula baltica SH 1]
          Length = 467

 Score =  277 bits (709), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 165/420 (39%), Positives = 248/420 (59%), Gaps = 12/420 (2%)

Query: 24  GYISSITSVYYTVTCLSQYV-CLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEIS 82
           G ++S+T    TV  ++  +  + + +    K +  L +VI  +     + P+     ++
Sbjct: 34  GRVASVTGDAVTVQGMTAPLGAICELMPPDAKPT--LARVIGFDDTRPILAPMEAISALA 91

Query: 83  LGDLVFHWGR---FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQ 139
            GD V    R    R+  S   CGRVI+A G+PIDG   L    + +      P +++R 
Sbjct: 92  AGDRVRLVSRSLTLRVGDS--LCGRVIDAFGRPIDGK-PLSDDLVRVSASRAAPDSLDRP 148

Query: 140 RVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERG 199
            +++  +TG+R ID       GQR+G+FAGSG+GKSTLL M  R    D+++I++VGERG
Sbjct: 149 PIDEPLQTGVRAIDAMLTCGVGQRLGIFAGSGVGKSTLLGMLTRGTTADRIVIAMVGERG 208

Query: 200 REVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDS 258
           REV+EF++  LG   LK+SVVVVATSD+    R  A  TA  IAE F  +G  VLL++DS
Sbjct: 209 REVQEFMQRALGAAGLKRSVVVVATSDKPAAQRLSAAWTATAIAEKFRDEGHRVLLLVDS 268

Query: 259 ITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGD 318
           +TRFA + RE+   +GE P  RGYP SVF+ LP+L+ER G     KG+ITA  +VLV+GD
Sbjct: 269 VTRFAMAQRELGLAAGEPPTTRGYPPSVFNMLPQLVERAG--RTTKGSITAFYTVLVEGD 326

Query: 319 NHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTH 378
           ++N+PI+D+VR +LDGHIVLNR LA  G YPP+D   S+SR+A+   + +  +    +  
Sbjct: 327 DNNEPISDTVRGLLDGHIVLNRKLAHRGHYPPIDIPESISRVANHLVTPETYQATLGIRE 386

Query: 379 LIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
            + +++ + D+  IG YR G D  +D A+     I D L+Q  ++++     Q   +KL 
Sbjct: 387 HMVQYQTSEDLISIGAYRSGSDPRVDTAIAMRDPINDLLRQDANEITPIADSQARVQKLH 446


>gi|108810006|ref|YP_653922.1| type III secretion system ATPase [Yersinia pestis Antiqua]
 gi|108813561|ref|YP_649328.1| type III secretion system ATPase [Yersinia pestis Nepal516]
 gi|145600951|ref|YP_001165027.1| type III secretion system ATPase [Yersinia pestis Pestoides F]
 gi|108777209|gb|ABG19728.1| type III secretion system ATP synthase [Yersinia pestis Nepal516]
 gi|108781919|gb|ABG15977.1| putative type III secretion system ATP synthase [Yersinia pestis
           Antiqua]
 gi|145212647|gb|ABP42054.1| type III secretion system ATP synthase [Yersinia pestis Pestoides
           F]
          Length = 448

 Score =  277 bits (709), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 158/363 (43%), Positives = 219/363 (60%), Gaps = 6/363 (1%)

Query: 59  LGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRF-RISPSACWCGRVINALGKPIDGDD 117
           L +V+ I  ++  + P    + +  G  V   G   R+   A   GR+++ LG PIDG  
Sbjct: 65  LAEVVSIEQEMALLSPFASSDGLRCGQWVTPLGHMHRVQVGADLAGRILDGLGAPIDGGP 124

Query: 118 SLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
            L  G    E+    P  + RQ VE+   TGIR ID       GQRIG+FA +G+GKSTL
Sbjct: 125 PL-TGQWR-ELDCPPPSPLTRQPVEQMLTTGIRAIDGILSCGEGQRIGIFAAAGVGKSTL 182

Query: 178 LSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLK-KSVVVVATSDESPILRKMAPL 236
           LSM       D ++++L+GERGREVREF+E  L    + ++VVVVATSD   + R     
Sbjct: 183 LSMLCADSAADVMVLALIGERGREVREFLEQVLTPEARARTVVVVATSDRPALERLKGLS 242

Query: 237 TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLER 296
           TA T+AEYF  +G  VLL+ DS+TR+A + REI   +GE P A  +P SVF+ LPRLLER
Sbjct: 243 TATTVAEYFRERGLKVLLLADSLTRYARAAREIGLAAGEPPAAGSFPPSVFANLPRLLER 302

Query: 297 IGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLAS 356
            G S++  G+ITA  +VLV+GD+ N+P+AD VRS+LDGHIVL+R LA  G YP +D  AS
Sbjct: 303 TGNSDR--GSITAFYTVLVEGDDMNEPVADEVRSLLDGHIVLSRRLAGAGHYPAIDIAAS 360

Query: 357 VSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDF 416
           VSR+  +  SA +  +   L  ++  ++E   +  IG Y+ G DL  D+A+ + P I  F
Sbjct: 361 VSRIMPQIVSAGQLAMAQKLRRMLACYQEIELLVQIGEYQAGEDLQADEALQRYPAICAF 420

Query: 417 LKQ 419
           L+Q
Sbjct: 421 LQQ 423


>gi|332159957|ref|YP_004296534.1| Secretion system apparatus ATP synthase ssaN [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|325664187|gb|ADZ40831.1| Secretion system apparatus ATP synthase ssaN [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
          Length = 451

 Score =  277 bits (709), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 162/374 (43%), Positives = 225/374 (60%), Gaps = 7/374 (1%)

Query: 55  NSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPI 113
           + D L +V+ I      + P      +  G  +   G   R+       GRV++ LG+PI
Sbjct: 58  SPDMLAEVVAIEQQTALLSPFASSAGLRCGQWISPLGHEHRVRVGVDLLGRVLDGLGEPI 117

Query: 114 DGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIG 173
           D    L +G    E+    P  + RQ V++   TGIR ID       GQRIG+FA +G+G
Sbjct: 118 DAGPPL-RGHWR-ELDCPPPDPLTRQPVQQILTTGIRAIDGVLSCGEGQRIGIFAAAGVG 175

Query: 174 KSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLK-KSVVVVATSDESPILRK 232
           KS+LLSM  R    D ++++L+GERGREVREF+E  L    + ++VVVVATSD   + R 
Sbjct: 176 KSSLLSMLCRGCRADIIVLALIGERGREVREFLEQVLTPETRARTVVVVATSDRPALERL 235

Query: 233 MAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPR 292
               TA T+AEYF  +G+ VLL+ DS+TR+A + REI   +GE P    +PTSVF+ LPR
Sbjct: 236 KGIYTATTVAEYFRERGEKVLLMADSLTRYARAAREIGLAAGEHPAMGSFPTSVFAALPR 295

Query: 293 LLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVD 352
           LLER G SE+  G+ITA  +VLV+GD+ N+P+AD VRS+LDGHIVL+R LA  G YP +D
Sbjct: 296 LLERAGNSER--GSITAFYTVLVEGDDMNEPVADEVRSLLDGHIVLSRQLAGAGHYPAID 353

Query: 353 PLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPI 412
             ASVSR+  +  SA+ + L   L H+   ++E   +  +G Y+ G DL  D+A+ + P 
Sbjct: 354 IAASVSRIMPQIVSAEHRALAQKLRHIQACYQEIELLVRVGEYQEGQDLQADEALQRYPG 413

Query: 413 IYDFLKQSPSDLSS 426
           I  FL+Q  S LSS
Sbjct: 414 ICAFLQQE-SALSS 426


>gi|253573521|ref|ZP_04850864.1| flagellar protein export ATPase FliI [Paenibacillus sp. oral taxon
           786 str. D14]
 gi|251847049|gb|EES75054.1| flagellar protein export ATPase FliI [Paenibacillus sp. oral taxon
           786 str. D14]
          Length = 439

 Score =  277 bits (709), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 153/355 (43%), Positives = 226/355 (63%), Gaps = 11/355 (3%)

Query: 70  VYICPVGIGEEISLG-DLVFHWGRFRISPSACWCGRVINALGKPIDGD---DSLGKGDLS 125
           V + P+G  + I  G D+V       +   +   G+V++ LG+P+DG      +G     
Sbjct: 69  VLLMPLGELQSIGPGCDVVGTGKPLTVQVGSELLGKVLDGLGQPLDGSLLPSRMGHYSTY 128

Query: 126 MEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSD 185
            + M+     +NR RV +    G+R ID    +  GQR+G+FAGSG+GKSTL+ M AR+ 
Sbjct: 129 NKPMNP----LNRPRVSEPIGIGVRAIDGLLTIGKGQRVGIFAGSGVGKSTLMGMIARNT 184

Query: 186 CFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEY 244
             D  +I+LVGERGREV +FIE  LG + L++SVVVVATSD+  ++R    L A TIAEY
Sbjct: 185 SADVNVIALVGERGREVLDFIERDLGPEGLERSVVVVATSDQPALIRMKGALIATTIAEY 244

Query: 245 FSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEK 304
           F  +G NV+L++DS+TR+A ++RE+    GE P  RGY  SVF+ LP+L+ER G      
Sbjct: 245 FRDRGLNVMLMMDSVTRYAMALREVGLAVGEPPAMRGYTPSVFAALPKLMERAGTGPT-- 302

Query: 305 GNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKA 364
           G+ITA  +VLVDGD+ N+PIAD+VR ILDGHIVLNR +A +G +P +D LAS+SR+    
Sbjct: 303 GSITAFYTVLVDGDDMNEPIADAVRGILDGHIVLNRGIANKGHFPAIDILASISRVMKDI 362

Query: 365 WSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
            S ++ +   +L  L+  ++++ D+  IG Y+PG +  +D+A+  +  I++F KQ
Sbjct: 363 VSDEQNEAAENLKRLMAVYKDSEDLINIGAYQPGSNPDIDEAIGAIQQIWNFTKQ 417


>gi|34558482|ref|NP_908297.1| flagellum-specific ATP synthase [Wolinella succinogenes DSM 1740]
 gi|34484201|emb|CAE11197.1| FLAGELLUM-SPECIFIC ATP SYNTHASE [Wolinella succinogenes]
          Length = 434

 Score =  277 bits (709), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 165/410 (40%), Positives = 242/410 (59%), Gaps = 13/410 (3%)

Query: 17  KNLVVQGGYISSITSVYYTVTCLSQYVCLGDFV-VHQGKNS-DNLGQVIRINLDIVYICP 74
           K+L    G +  ++S    V  L   V  GD V + QG+N  +++G V  +  +   + P
Sbjct: 13  KSLSPTFGTVVKVSSGAIVVVGLRPSV--GDIVRIIQGENHHESMGMVTVVESESFTVSP 70

Query: 75  VGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVP 133
               E   +GD V+   R  +I   A   GRV++ LG+PIDG   +    L  E    + 
Sbjct: 71  FSFIEGSKVGDRVYLNNRGLQIPVGAGLLGRVVDPLGRPIDGAGEI----LGTEYAPIIK 126

Query: 134 P---AMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKV 190
           P   AM R  +++ F  G++ ID       GQ++G+FAGSG+GKSTL+ M  +       
Sbjct: 127 PPIAAMKRGMIDEVFSVGVKSIDGLLTCGKGQKLGIFAGSGVGKSTLMGMIVKGASAPIK 186

Query: 191 IISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGD 250
           +I+L+GERGREV EFIE  LG NL+ +V+VVATSD+SP++RK    +A+++AEYF ++G+
Sbjct: 187 VIALIGERGREVPEFIEKNLGGNLENTVLVVATSDDSPLMRKYGAFSAMSVAEYFKARGE 246

Query: 251 NVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAV 310
           +VL ++DS+TRFA + REI    GE P ++GYP SV + LP+L+ER G  E+  G+ITA 
Sbjct: 247 DVLFMMDSVTRFAMAQREIGLALGEPPTSKGYPPSVLTLLPQLMERAG-KEEGHGSITAF 305

Query: 311 ISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEK 370
            +VLV+GD+  DPIAD  RSILDGHIVL+R L + G YPP++ L S SRL +   + D  
Sbjct: 306 FTVLVEGDDMGDPIADQSRSILDGHIVLSRELTDFGIYPPINILNSASRLMNDVSTKDHV 365

Query: 371 KLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQS 420
                   L    +E   +  IG Y+ G D  LD+A+ +   +  +LKQ+
Sbjct: 366 LAARKFRRLYSLLKENEVLIRIGAYQKGNDRELDEAIEKKERMEGYLKQN 415


>gi|269965406|ref|ZP_06179526.1| flagellum-specific ATP synthase [Vibrio alginolyticus 40B]
 gi|269830052|gb|EEZ84281.1| flagellum-specific ATP synthase [Vibrio alginolyticus 40B]
          Length = 448

 Score =  277 bits (709), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 144/366 (39%), Positives = 228/366 (62%), Gaps = 3/366 (0%)

Query: 60  GQVIRINLDIVYICPVG-IGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDS 118
            QV+     I Y+ P+  +G   +   ++   G   +  S+ W GRV+N LG+P+D D +
Sbjct: 66  AQVVGFEHTIAYLMPIRRLGGLFAGAKVIPLDGDSTVQLSSQWLGRVLNGLGEPLD-DGA 124

Query: 119 LGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLL 178
             KG   + +  K    + R+ V+     G+R I+    +  GQRIG+ AGSG+GKS L+
Sbjct: 125 PLKGGERVSLEPKPINPLKRRPVDTPLNVGVRAINGLLTVGKGQRIGLMAGSGVGKSVLM 184

Query: 179 SMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLT 237
            M  ++   D +++ L+GERGREVREFIE  L  +  KK++++ A +DESP++R  A L 
Sbjct: 185 GMITKNTEADVIVVGLIGERGREVREFIERNLTPEARKKAIIIAAPADESPLMRLRATLL 244

Query: 238 AVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERI 297
              ++EYF  +G +VLL++DS+TR+A + REIA + GE P +RGYP SVFS LP+LLER 
Sbjct: 245 CHRVSEYFRDQGKDVLLLMDSLTRYAMAQREIALSLGEPPASRGYPPSVFSVLPQLLERA 304

Query: 298 GPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASV 357
           G SE + G++TA+ +VL +GD+  DP+ DS R+ILDGH+VL+R LAE+G YP +D  AS+
Sbjct: 305 GNSENQYGSLTAIYTVLAEGDDQQDPVVDSARAILDGHVVLSRQLAEQGHYPAIDINASI 364

Query: 358 SRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFL 417
           SR  +         + ++   +   + + +++  +GGY+PG D  LD++V   P +  +L
Sbjct: 365 SRCMNTCTQDAHSTIANNFRQMYSNYLQVKELLPLGGYQPGQDPELDQSVAMYPNLRAYL 424

Query: 418 KQSPSD 423
           +Q+ ++
Sbjct: 425 QQAANE 430


>gi|318607492|emb|CBY28990.1| type III secretion cytoplasmic ATP synthase [Yersinia
           enterocolitica subsp. palearctica Y11]
          Length = 451

 Score =  277 bits (709), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 162/374 (43%), Positives = 225/374 (60%), Gaps = 7/374 (1%)

Query: 55  NSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPI 113
           + D L +V+ I      + P      +  G  +   G   R+       GRV++ LG+PI
Sbjct: 58  SPDMLAEVVAIEQQTALLSPFASSAGLRCGQWISPLGHEHRVRVGVDLLGRVLDGLGEPI 117

Query: 114 DGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIG 173
           D    L +G    E+    P  + RQ V++   TGIR ID       GQRIG+FA +G+G
Sbjct: 118 DAGPPL-RGHWR-ELDCPPPDPLTRQPVQQILTTGIRAIDGVLSCGEGQRIGIFAAAGVG 175

Query: 174 KSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLK-KSVVVVATSDESPILRK 232
           KS+LLSM  R    D ++++L+GERGREVREF+E  L    + ++VVVVATSD   + R 
Sbjct: 176 KSSLLSMLCRGCRADIIVLALIGERGREVREFLEQVLTPETRARTVVVVATSDRPALERL 235

Query: 233 MAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPR 292
               TA T+AEYF  +G+ VLL+ DS+TR+A + REI   +GE P    +PTSVF+ LPR
Sbjct: 236 KGIYTATTVAEYFRERGEKVLLMADSLTRYARAAREIGLAAGEHPAMGSFPTSVFAALPR 295

Query: 293 LLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVD 352
           LLER G SE+  G+ITA  +VLV+GD+ N+P+AD VRS+LDGHIVL+R LA  G YP +D
Sbjct: 296 LLERAGNSER--GSITAFYTVLVEGDDMNEPVADEVRSLLDGHIVLSRQLAGAGHYPAID 353

Query: 353 PLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPI 412
             ASVSR+  +  SA+ + L   L H+   ++E   +  +G Y+ G DL  D+A+ + P 
Sbjct: 354 IAASVSRIMPQIVSAEHRALAQKLRHIQACYQEIELLVRVGEYQEGQDLQADEALQRYPG 413

Query: 413 IYDFLKQSPSDLSS 426
           I  FL+Q  S LSS
Sbjct: 414 ICAFLQQE-SALSS 426


>gi|163733137|ref|ZP_02140581.1| flagellum-specific ATP synthase [Roseobacter litoralis Och 149]
 gi|161393672|gb|EDQ17997.1| flagellum-specific ATP synthase [Roseobacter litoralis Och 149]
          Length = 449

 Score =  277 bits (709), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 154/386 (39%), Positives = 229/386 (59%), Gaps = 2/386 (0%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISL 83
           G +  + +    +  L+    +GD VV   +     G++++++ D + I P    E ++L
Sbjct: 24  GRVCRVEAGVIHIAGLAGKARIGDLVVVYRQGDPLSGEILQLDGDTLVILPDQDAEGVAL 83

Query: 84  GDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEK 143
            D         I+PS  W GR+I+  G PIDG   L +G  +  + S  P    R+ +  
Sbjct: 84  NDRAALLEARGIAPSEGWIGRIIDPFGNPIDGKPLL-RGAHARSLRSAPPEPALRRSMGA 142

Query: 144 GFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVR 203
              TG+ V++   P+  GQR+G+FAGSG+GKS+LL   A++   D V+++LVGERGRE+R
Sbjct: 143 RLNTGMSVLNTMLPVVKGQRVGLFAGSGVGKSSLLGHLAQNMTADVVVVALVGERGRELR 202

Query: 204 EFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRF 262
            F+E+ LG + LK+SVVV ATSD+SP++R+     A+++AE+F   G +VL++ DSITRF
Sbjct: 203 HFVEEVLGSEGLKRSVVVCATSDQSPLIRRRCAWAAMSVAEHFRDMGLSVLILADSITRF 262

Query: 263 AHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHND 322
           A + RE+A  SGE PV RGYP S    +  L ER GP E  +G+IT + SVLV G +  +
Sbjct: 263 AEAHREVAVASGEAPVLRGYPPSTAHLIMSLCERAGPGEGSQGDITGIFSVLVAGSDMEE 322

Query: 323 PIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHR 382
           PIAD +R +LDGHIVLNR +AE GRYP +D L S+SR    A    E +L+S +   +  
Sbjct: 323 PIADILRGVLDGHIVLNREIAERGRYPAIDVLKSISRSLPAAADDIENELISIVRRYLSV 382

Query: 383 FEETRDIRLIGGYRPGVDLILDKAVH 408
           +E+   +   G Y  G D  +D A+ 
Sbjct: 383 YEQNEMMIRAGLYSQGSDPEIDAAIQ 408


>gi|22124440|ref|NP_667863.1| type III secretion system ATPase [Yersinia pestis KIM 10]
 gi|51594678|ref|YP_068869.1| type III secretion system ATPase [Yersinia pseudotuberculosis IP
           32953]
 gi|150260685|ref|ZP_01917413.1| putative type III secretion system ATP synthase [Yersinia pestis
           CA88-4125]
 gi|162421510|ref|YP_001608232.1| type III secretion system ATPase [Yersinia pestis Angola]
 gi|165926753|ref|ZP_02222585.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165936441|ref|ZP_02225009.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Yersinia pestis biovar Orientalis str. IP275]
 gi|166010584|ref|ZP_02231482.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166213954|ref|ZP_02239989.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167402195|ref|ZP_02307668.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167418696|ref|ZP_02310449.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167426202|ref|ZP_02317955.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|167470729|ref|ZP_02335433.1| type III secretion system ATPase [Yersinia pestis FV-1]
 gi|186893681|ref|YP_001870793.1| type III secretion system ATPase [Yersinia pseudotuberculosis
           PB1/+]
 gi|218927473|ref|YP_002345348.1| type III secretion system ATPase [Yersinia pestis CO92]
 gi|229836521|ref|ZP_04456687.1| putative type III secretion system ATP synthase [Yersinia pestis
           Pestoides A]
 gi|229840129|ref|ZP_04460288.1| putative type III secretion system ATP synthase [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229842210|ref|ZP_04462365.1| putative type III secretion system ATP synthase [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229904051|ref|ZP_04519164.1| putative type III secretion system ATP synthase [Yersinia pestis
           Nepal516]
 gi|270488963|ref|ZP_06206037.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Yersinia pestis KIM D27]
 gi|294502339|ref|YP_003566401.1| flagellum-specific ATP synthase [Yersinia pestis Z176003]
 gi|21957227|gb|AAM84114.1|AE013654_3 flagellum-specific ATP synthase [Yersinia pestis KIM 10]
 gi|51587960|emb|CAH19563.1| putative type III secretion system ATPase, EscN/SsaN/YscN [Yersinia
           pseudotuberculosis IP 32953]
 gi|115346084|emb|CAL18952.1| putative type III secretion system ATP synthase [Yersinia pestis
           CO92]
 gi|149290093|gb|EDM40170.1| putative type III secretion system ATP synthase [Yersinia pestis
           CA88-4125]
 gi|162354325|gb|ABX88273.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Yersinia pestis Angola]
 gi|165915557|gb|EDR34166.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Yersinia pestis biovar Orientalis str. IP275]
 gi|165921376|gb|EDR38600.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165990674|gb|EDR42975.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166204929|gb|EDR49409.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Yersinia pestis biovar Antiqua str. B42003004]
 gi|166962690|gb|EDR58711.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167048376|gb|EDR59784.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167054913|gb|EDR64715.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|186696707|gb|ACC87336.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Yersinia pseudotuberculosis PB1/+]
 gi|229679821|gb|EEO75924.1| putative type III secretion system ATP synthase [Yersinia pestis
           Nepal516]
 gi|229690520|gb|EEO82574.1| putative type III secretion system ATP synthase [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229696495|gb|EEO86542.1| putative type III secretion system ATP synthase [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229706205|gb|EEO92213.1| putative type III secretion system ATP synthase [Yersinia pestis
           Pestoides A]
 gi|262360419|gb|ACY57140.1| flagellum-specific ATP synthase [Yersinia pestis D106004]
 gi|262364369|gb|ACY60926.1| flagellum-specific ATP synthase [Yersinia pestis D182038]
 gi|270337467|gb|EFA48244.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Yersinia pestis KIM D27]
 gi|294352798|gb|ADE63139.1| flagellum-specific ATP synthase [Yersinia pestis Z176003]
 gi|320013869|gb|ADV97440.1| putative type III secretion system ATP synthase [Yersinia pestis
           biovar Medievalis str. Harbin 35]
          Length = 445

 Score =  277 bits (709), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 158/363 (43%), Positives = 219/363 (60%), Gaps = 6/363 (1%)

Query: 59  LGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRF-RISPSACWCGRVINALGKPIDGDD 117
           L +V+ I  ++  + P    + +  G  V   G   R+   A   GR+++ LG PIDG  
Sbjct: 62  LAEVVSIEQEMALLSPFASSDGLRCGQWVTPLGHMHRVQVGADLAGRILDGLGAPIDGGP 121

Query: 118 SLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
            L  G    E+    P  + RQ VE+   TGIR ID       GQRIG+FA +G+GKSTL
Sbjct: 122 PL-TGQWR-ELDCPPPSPLTRQPVEQMLTTGIRAIDGILSCGEGQRIGIFAAAGVGKSTL 179

Query: 178 LSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLK-KSVVVVATSDESPILRKMAPL 236
           LSM       D ++++L+GERGREVREF+E  L    + ++VVVVATSD   + R     
Sbjct: 180 LSMLCADSAADVMVLALIGERGREVREFLEQVLTPEARARTVVVVATSDRPALERLKGLS 239

Query: 237 TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLER 296
           TA T+AEYF  +G  VLL+ DS+TR+A + REI   +GE P A  +P SVF+ LPRLLER
Sbjct: 240 TATTVAEYFRERGLKVLLLADSLTRYARAAREIGLAAGEPPAAGSFPPSVFANLPRLLER 299

Query: 297 IGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLAS 356
            G S++  G+ITA  +VLV+GD+ N+P+AD VRS+LDGHIVL+R LA  G YP +D  AS
Sbjct: 300 TGNSDR--GSITAFYTVLVEGDDMNEPVADEVRSLLDGHIVLSRRLAGAGHYPAIDIAAS 357

Query: 357 VSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDF 416
           VSR+  +  SA +  +   L  ++  ++E   +  IG Y+ G DL  D+A+ + P I  F
Sbjct: 358 VSRIMPQIVSAGQLAMAQKLRRMLACYQEIELLVQIGEYQAGEDLQADEALQRYPAICAF 417

Query: 417 LKQ 419
           L+Q
Sbjct: 418 LQQ 420


>gi|299066538|emb|CBJ37728.1| Flagellum-specific ATP synthase [Ralstonia solanacearum CMR15]
          Length = 472

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 163/393 (41%), Positives = 237/393 (60%), Gaps = 14/393 (3%)

Query: 53  GKNSDN-LGQVIRINLDIVYICPVGIGEEISLGDLVFHWG---RFRISPSACWCGRVINA 108
           G N+D+ L +V+ I+   + + P G  + ++ G+ V   G    FR+  +    GRVI+A
Sbjct: 75  GANADHVLAEVVGIDGGQIILMPFGSVQGLAAGNEVIALGGRAEFRVGEA--LLGRVIDA 132

Query: 109 LGKPIDGDDSLGKGDLSMEIMS-KVPP--AMNRQRVEKGFKTGIRVIDIFTPLCHGQRIG 165
            G P+DG   L    L  E    K  P   M R R++   +TG+R ID    L  GQRIG
Sbjct: 133 FGAPLDG---LAAPVLLPEARKLKAAPINPMRRPRIDTILETGVRSIDALLTLGRGQRIG 189

Query: 166 VFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATS 224
           +FAGSG+GKSTLL M AR    +  +I+L+GERGREV+EFI+  LG D LK+SVV+VAT+
Sbjct: 190 IFAGSGVGKSTLLGMIARHMDAEVNVIALIGERGREVKEFIDKQLGADGLKRSVVIVATA 249

Query: 225 DESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPT 284
           D+  + R  A   A+TIAEYF   G  V+L +DSITRFA + REI   +GE P ARGY  
Sbjct: 250 DQPALSRVRAVYAALTIAEYFRDLGKQVVLTMDSITRFAMARREIGLAAGEPPTARGYTP 309

Query: 285 SVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAE 344
           SVF+ELP L ER G +    G ITA+++VLV+GD+ N+PI+D++R+ILDGH+VL+R +A 
Sbjct: 310 SVFAELPELCERCG-TAPSGGAITALLTVLVEGDDLNEPISDALRAILDGHVVLSRQIAH 368

Query: 345 EGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILD 404
           +G+YP +D L S SRL     + +E+ +      ++   E  R +  +G Y  G +  LD
Sbjct: 369 QGQYPAIDVLKSASRLLPDLSTPEERAVGGRAIQILAMLERNRQMVELGAYERGTNPELD 428

Query: 405 KAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKL 437
           +A+   P +  +L Q+      ++  Q++   +
Sbjct: 429 RALACAPHLKTWLSQAEGGARRDEAMQQLAAAV 461


>gi|45440276|ref|NP_991815.1| type III secretion system ATPase [Yersinia pestis biovar Microtus
           str. 91001]
 gi|45435132|gb|AAS60692.1| putative type III secretion system ATP synthase [Yersinia pestis
           biovar Microtus str. 91001]
          Length = 446

 Score =  277 bits (708), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 158/363 (43%), Positives = 219/363 (60%), Gaps = 6/363 (1%)

Query: 59  LGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRF-RISPSACWCGRVINALGKPIDGDD 117
           L +V+ I  ++  + P    + +  G  V   G   R+   A   GR+++ LG PIDG  
Sbjct: 63  LAEVVSIEQEMALLSPFASSDGLRCGQWVTPLGHMHRVQVGADLAGRILDGLGAPIDGGP 122

Query: 118 SLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
            L  G    E+    P  + RQ VE+   TGIR ID       GQRIG+FA +G+GKSTL
Sbjct: 123 PL-TGQWR-ELDCPPPSPLTRQPVEQMLTTGIRAIDGILSCGEGQRIGIFAAAGVGKSTL 180

Query: 178 LSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLK-KSVVVVATSDESPILRKMAPL 236
           LSM       D ++++L+GERGREVREF+E  L    + ++VVVVATSD   + R     
Sbjct: 181 LSMLCADSAADVMVLALIGERGREVREFLEQVLTPEARARTVVVVATSDRPALERLKGLS 240

Query: 237 TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLER 296
           TA T+AEYF  +G  VLL+ DS+TR+A + REI   +GE P A  +P SVF+ LPRLLER
Sbjct: 241 TATTVAEYFRERGLKVLLLADSLTRYARAAREIGLAAGEPPAAGSFPPSVFANLPRLLER 300

Query: 297 IGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLAS 356
            G S++  G+ITA  +VLV+GD+ N+P+AD VRS+LDGHIVL+R LA  G YP +D  AS
Sbjct: 301 TGNSDR--GSITAFYTVLVEGDDMNEPVADEVRSLLDGHIVLSRRLAGAGHYPAIDIAAS 358

Query: 357 VSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDF 416
           VSR+  +  SA +  +   L  ++  ++E   +  IG Y+ G DL  D+A+ + P I  F
Sbjct: 359 VSRIMPQIVSAGQLAMAQKLRRMLACYQEIELLVQIGEYQAGEDLQADEALQRYPAICAF 418

Query: 417 LKQ 419
           L+Q
Sbjct: 419 LQQ 421


>gi|224373742|ref|YP_002608114.1| flagellum-specific ATP synthase [Nautilia profundicola AmH]
 gi|223589927|gb|ACM93663.1| flagellum-specific ATP synthase [Nautilia profundicola AmH]
          Length = 432

 Score =  277 bits (708), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 159/407 (39%), Positives = 235/407 (57%), Gaps = 14/407 (3%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISL 83
           G +  I       T L+    +GD V     N + LG V  ++ +   + P    E   +
Sbjct: 20  GIVKKINPTNLIATGLNP--SIGDIVKICSGNHEILGMVTALDENSFVVTPFSFLEGFKI 77

Query: 84  GDLVF-HWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSME----IMSKVPPAMNR 138
           GD ++      +I       GRV++    PID      KGD+  E    IM+K    M R
Sbjct: 78  GDKIYIDENGMQIPVGEGLLGRVVDPFMNPIDD-----KGDIFFETKYPIMTKPISPMKR 132

Query: 139 QRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGER 198
             + + F+T ++ ID       GQ++G+FAGSG+GKSTL+SM  +    D  +I+L+GER
Sbjct: 133 GVINEVFETKVKAIDGLLTCGKGQKLGIFAGSGVGKSTLMSMIVKGASADIKVIALIGER 192

Query: 199 GREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDS 258
           GRE+ EFIE  LG +L  +V++VATSD+S ++RK    +A+ +AEYF  K  +VL ++DS
Sbjct: 193 GREIPEFIEHQLGGDLTNTVIIVATSDDSALMRKYGAFSAMAVAEYFKDKNKDVLFLMDS 252

Query: 259 ITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGD 318
           ITRFA + REI    GE P ++GYP S    LP+L+ER G  EK+KG+ITA  +VLV+GD
Sbjct: 253 ITRFAMAQREIGLAMGEPPTSKGYPPSAIMLLPQLMERAG-KEKDKGSITAFFTVLVEGD 311

Query: 319 NHN-DPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLT 377
           + + DPIAD  RSILDGH +L+R L + G YPP++ L S SR+ +   + +  +      
Sbjct: 312 DTSADPIADQARSILDGHFILSRELTDSGIYPPINILNSASRVMNNVVTKEHLQKAQKFK 371

Query: 378 HLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDL 424
            L    +E   +  IG Y+ GVD  LD+A+++   + +FLKQSP++L
Sbjct: 372 KLYSLLKENEVLIRIGAYQKGVDPELDEAINKKEAMENFLKQSPNEL 418


>gi|268316354|ref|YP_003290073.1| ATPase, FliI/YscN family [Rhodothermus marinus DSM 4252]
 gi|262333888|gb|ACY47685.1| ATPase, FliI/YscN family [Rhodothermus marinus DSM 4252]
          Length = 450

 Score =  277 bits (708), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 151/333 (45%), Positives = 206/333 (61%), Gaps = 4/333 (1%)

Query: 100 CWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLC 159
              GRV++A  +PIDG   L   D    + +  PP ++R+ ++    TGIR ID F  L 
Sbjct: 108 AMLGRVVDANARPIDGKGPLTVTD-EQPVRNDPPPPLSRRMIDTPLFTGIRAIDTFLTLG 166

Query: 160 HGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSV 218
            GQRIG+FAGSG+GKSTLL M AR    D  +I+L+GERGREV+EFI D LG + LK+SV
Sbjct: 167 RGQRIGIFAGSGVGKSTLLGMIARRARADVNVIALIGERGREVQEFIADNLGPEGLKRSV 226

Query: 219 VVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPV 278
           VV  T D++ + R      A+ IAEYF  +G +VLL++DSITR A + REI    GE P 
Sbjct: 227 VVAVTGDQAAMSRVKGASVAMAIAEYFRDRGLDVLLMMDSITRVAMAQREIGLAVGEPPT 286

Query: 279 ARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVL 338
            RGY  SVF+ LPRLLER GP  +  G IT + +VLVD D+ NDPI D+VR ILDGHIVL
Sbjct: 287 TRGYTPSVFAMLPRLLERAGPGAR--GTITGIFTVLVDADDMNDPIGDAVRGILDGHIVL 344

Query: 339 NRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPG 398
           +R LA    +P +D L SVSR+  +  +A+ + LV     L+  ++E  D+  +G Y  G
Sbjct: 345 SRRLAHANHFPAIDVLQSVSRVMPRVTTAEHRALVEEARRLLATYQEAEDLIRVGAYEMG 404

Query: 399 VDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQ 431
               +D+A+     +  FL+Q   +++ + V Q
Sbjct: 405 TRPEIDRAILAHEALMAFLRQGVDEVADDPVAQ 437


>gi|331269317|ref|YP_004395809.1| flagellar protein export ATPase FliI [Clostridium botulinum
           BKT015925]
 gi|329125867|gb|AEB75812.1| flagellar protein export ATPase FliI [Clostridium botulinum
           BKT015925]
          Length = 440

 Score =  277 bits (708), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 159/374 (42%), Positives = 226/374 (60%), Gaps = 8/374 (2%)

Query: 50  VHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLG---DLVFHWGRFRISPSACWCGRVI 106
           ++  +N   + +V+    D V + P  +GE I +G    ++       +  S    G+V+
Sbjct: 50  IYNKENDPIMCEVVGFKEDNVILMP--LGELIGIGPGCRVIPSKKYLTVKCSEKLLGKVL 107

Query: 107 NALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGV 166
           N LGK +  DD      +   + +  P  + R+R++    TG+R ID F     GQR+G+
Sbjct: 108 NGLGKSLKYDDDEVHIGMEYPLDTAPPDPLKRRRIKDSIATGVRAIDGFLTCGEGQRVGI 167

Query: 167 FAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSD 225
           FAGSG+GKST L M AR    D  +I+L+GERGREV +FIE  LG+  LKKSV+V ATSD
Sbjct: 168 FAGSGVGKSTTLGMIAREAKADVNVIALIGERGREVLDFIEKDLGEEGLKKSVIVCATSD 227

Query: 226 ESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTS 285
           +  ++R     TA  IAEYF  KG  V+L++DS+TRFA + RE+    GE P  +GY  S
Sbjct: 228 QPALVRLKGAFTATAIAEYFRDKGKKVILMMDSVTRFAMAQREVGLAIGEPPATKGYTPS 287

Query: 286 VFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEE 345
           VF+ LPRL+ER G S  EKG+ITA  +VLVDGD+ N+PIAD+VR ILDGHIVL+R+LA +
Sbjct: 288 VFAMLPRLMERSGMS--EKGSITAFYTVLVDGDDFNEPIADAVRGILDGHIVLSRALAGK 345

Query: 346 GRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDK 405
             YP +D L SVSRL ++    + KK  S    L+  ++ + D+  IG Y  G +  +D 
Sbjct: 346 NHYPAIDVLNSVSRLMNEIADNEHKKAASFARDLLATYKNSEDLINIGAYAQGSNNKVDM 405

Query: 406 AVHQVPIIYDFLKQ 419
           A+    +I D+L+Q
Sbjct: 406 AIEYNDMINDYLRQ 419


>gi|254499110|ref|ZP_05111800.1| flagellar protein export ATPase FliI [Legionella drancourtii
           LLAP12]
 gi|254351649|gb|EET10494.1| flagellar protein export ATPase FliI [Legionella drancourtii
           LLAP12]
          Length = 430

 Score =  277 bits (708), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 154/382 (40%), Positives = 235/382 (61%), Gaps = 5/382 (1%)

Query: 49  VVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWG-RFRISPSACWCGRVIN 107
           ++ Q + +    +VI      VY+ P     ++ +G  V   G    I+      G V++
Sbjct: 41  ILDQNQQTVMQAEVIGFEQGKVYLMPYD-SVQVCMGYKVRATGNHLSIAVGEALLGHVVD 99

Query: 108 ALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVF 167
           A  +PID    L      +    K+ P + R  + +   TGI+ ID   PL  GQRIG+F
Sbjct: 100 AFAQPIDEQIKLTYTQRVLTKNKKINP-LTRMPINERLTTGIQAIDSLLPLGKGQRIGIF 158

Query: 168 AGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATSDE 226
           AGSG+GKSTLL    ++   +  +I+L+GERGREV +FI ++L +  LKKSV+VV+ SDE
Sbjct: 159 AGSGVGKSTLLGTMVQNLQSEINVIALIGERGREVNDFIVNHLDEATLKKSVLVVSCSDE 218

Query: 227 SPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSV 286
           S ++R+ A  TA  IAEYF  +   V+L +DSITRFA + REI+ + GE P ARGY  SV
Sbjct: 219 SALMRRQAVYTATAIAEYFCQQSKQVMLFMDSITRFAMAQREISLSLGEPPTARGYTPSV 278

Query: 287 FSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEG 346
           F+ LP ++ER G + KE+G+I+A+ +VLV+GD+ N+P+AD +R++LDGHIVL R LA+ G
Sbjct: 279 FALLPGIIERTG-NFKEQGSISALYTVLVEGDDFNEPLADHMRALLDGHIVLTRELAQRG 337

Query: 347 RYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKA 406
            YP +  L SVSRLA    + +E++L++ +   +  +++ +D+  +G Y+PG + +LD+A
Sbjct: 338 HYPAISILQSVSRLAKHIVAPEEQQLINQIIATLSLYQQNKDLIEVGAYKPGNNALLDEA 397

Query: 407 VHQVPIIYDFLKQSPSDLSSED 428
           V ++P I   L Q  +   S D
Sbjct: 398 VERLPAINQLLIQDKNHFLSFD 419


>gi|254463886|ref|ZP_05077297.1| flagellum-specific ATP synthase [Rhodobacterales bacterium Y4I]
 gi|206684794|gb|EDZ45276.1| flagellum-specific ATP synthase [Rhodobacterales bacterium Y4I]
          Length = 442

 Score =  276 bits (707), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 159/421 (37%), Positives = 250/421 (59%), Gaps = 5/421 (1%)

Query: 1   MQKNLETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGD-FVVHQGKNSDNL 59
           M+  L+ L +  +  S  L  Q G ++ I      ++ L+    +GD  V+ +G   +  
Sbjct: 1   MKAELQALTR--QIASTRLATQMGRVTGIAGGEIEISGLASAARIGDRLVLRRGPGDELH 58

Query: 60  GQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSL 119
           G+V++I  + + + P    +  ++GD V        +PS  W GRVI+  G+P+DG   L
Sbjct: 59  GEVLKIKGNNISMLPDRAPDGAAIGDAVLLHPSPEFAPSDHWIGRVIDPFGEPLDGRPML 118

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
             G +  ++M+  P A  R+ + +   TG  +++   P+  GQR+G+FAGSG+GKS+LL+
Sbjct: 119 -PGSVPRDLMAAPPKAAGRRGMGERLPTGQALLNTILPIVRGQRVGLFAGSGVGKSSLLA 177

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTA 238
             A++   D V+++L+GERGREV  F+E  LG + ++++VVV ATSD+S ++R+     A
Sbjct: 178 KLAKAMEADVVVMALIGERGREVNHFVEQVLGPEGMRRAVVVAATSDQSALVRRRCAWAA 237

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
           +T+AE+F  +G NVL + DS+TRFA + REI+  SGE P  RGYP SV   +  L ER G
Sbjct: 238 MTVAEHFRDQGKNVLFLADSVTRFAEAHREISAASGEAPALRGYPPSVTPLITGLCERAG 297

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
           P  + +G+ITAV SVLV G + ++PIAD +R +LDGHIVL+R +AE GR+P +D   SVS
Sbjct: 298 PGGEGQGDITAVFSVLVAGSDMDEPIADILRGVLDGHIVLSREIAERGRFPAIDVSRSVS 357

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R    A +ADE   +  +   +  +E++  +   G Y  G D +LD+AV   P +  F  
Sbjct: 358 RSLPAAATADENAAIQEVRKFLGAYEQSEVMIRAGLYAEGNDAVLDQAVKLWPELDAFFG 417

Query: 419 Q 419
           +
Sbjct: 418 R 418


>gi|229826305|ref|ZP_04452374.1| hypothetical protein GCWU000182_01677 [Abiotrophia defectiva ATCC
           49176]
 gi|229789175|gb|EEP25289.1| hypothetical protein GCWU000182_01677 [Abiotrophia defectiva ATCC
           49176]
          Length = 423

 Score =  276 bits (707), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 159/391 (40%), Positives = 239/391 (61%), Gaps = 8/391 (2%)

Query: 35  TVTCLSQYVCLGDFVVHQGKNSDNLG---QVIRINLDIVYICPVGIGEEISLGDLVFHWG 91
           T+  L     + D  +    N  + G   +V+    + + + P G  E + +G LV   G
Sbjct: 15  TIESLGPSANINDLCIIYANNKYSKGTYAEVVGFRDNRILLMPYGDLEGVGVGSLVESTG 74

Query: 92  R-FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIR 150
             F +       G V++ LG+PID   +  K D S  + +  P  ++RQ +E+    G++
Sbjct: 75  APFHVDVGYDMLGVVVDGLGRPIDTSVTFEKED-SYSVEAMPPDPLSRQMIEEVLPLGVK 133

Query: 151 VIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYL 210
            +D    +  GQR+G+FAGSG+GKSTL+ MFAR+   D  +I+L+GERGREVREFIE  L
Sbjct: 134 AVDALLTVGKGQRVGIFAGSGVGKSTLMGMFARNTKADVNVIALIGERGREVREFIERDL 193

Query: 211 GD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREI 269
           G+  +++SVVVVATSD+  ++RK A  TA  IAE+F  KG++VLL++DS+TRF+ + REI
Sbjct: 194 GEEGMRRSVVVVATSDQPALIRKKAAKTATAIAEFFRDKGEDVLLMMDSLTRFSMAQREI 253

Query: 270 ATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVR 329
              SGE PV RGYP SV+SE+P+LLER G    + G+IT + +VLVDGD+ N+PIAD+ R
Sbjct: 254 GLASGEPPVTRGYPPSVYSEMPKLLERAG--NGKDGSITGLYTVLVDGDDMNEPIADTAR 311

Query: 330 SILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDI 389
            ILDGH VL+R+LA++  YP +D L S+SR        + K+    + +++  +    D+
Sbjct: 312 GILDGHFVLSRTLAQKNHYPAIDVLQSISRCMSAVADKEHKRFAGMMKNVMATYNGAEDL 371

Query: 390 RLIGGYRPGVDLILDKAVHQVPIIYDFLKQS 420
             IG Y+ G +  +D A+ ++  +  FL QS
Sbjct: 372 INIGAYKSGSNPDIDFAISKIKEVNAFLMQS 402


>gi|163800137|ref|ZP_02194038.1| putative flagellum-specific ATP synthase [Vibrio sp. AND4]
 gi|159175580|gb|EDP60374.1| putative flagellum-specific ATP synthase [Vibrio sp. AND4]
          Length = 450

 Score =  276 bits (707), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 140/328 (42%), Positives = 212/328 (64%), Gaps = 4/328 (1%)

Query: 98  SACWCGRVINALGKPIDGDDSLGKGD-LSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFT 156
           S+ W GRV+N LG+P D    L  GD +S+E     P  + R+ V+     G+R I+   
Sbjct: 105 SSQWLGRVVNGLGEPFDDGAPLKGGDRVSLEPKPINP--LKRRPVDTPLDVGVRAINGLL 162

Query: 157 PLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIE-DYLGDNLK 215
            +  GQRIG+ AGSG+GKS L+ M  ++   D +++ L+GERGREVREF+E ++  +  +
Sbjct: 163 TVGKGQRIGLMAGSGVGKSVLMGMITQNTEADVIVVGLIGERGREVREFVERNFTPEARR 222

Query: 216 KSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGE 275
           K++++ A +DESP++R  A L    +AEYF  +G +VLL++DS+TR+A + REIA + GE
Sbjct: 223 KAIIIAAPADESPLMRLRATLLCHRVAEYFRDQGKDVLLLMDSLTRYAMAQREIALSLGE 282

Query: 276 LPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGH 335
            P +RGYP SVFS LP+LLER G SE   G++TA+ +VL +GD+  DP+ DS R+ILDGH
Sbjct: 283 PPASRGYPPSVFSVLPQLLERAGNSENPDGSLTAIYTVLAEGDDQQDPVVDSARAILDGH 342

Query: 336 IVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGY 395
           +VL+R LAE+G YP +D  AS+SR            + ++   L   + + +++  +GGY
Sbjct: 343 VVLSRQLAEQGHYPAIDINASISRCMSACTHEAHSTIANNFRQLYSNYLQVKELLPLGGY 402

Query: 396 RPGVDLILDKAVHQVPIIYDFLKQSPSD 423
           +PG D  LD++V   P +  +L+QS S+
Sbjct: 403 QPGQDPELDQSVSMYPHLRAYLQQSASE 430


>gi|153948731|ref|YP_001402772.1| type III secretion system ATPase [Yersinia pseudotuberculosis IP
           31758]
 gi|152960226|gb|ABS47687.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Yersinia pseudotuberculosis IP 31758]
          Length = 445

 Score =  276 bits (707), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 157/363 (43%), Positives = 219/363 (60%), Gaps = 6/363 (1%)

Query: 59  LGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRF-RISPSACWCGRVINALGKPIDGDD 117
           L +V+ I  ++  + P    + +  G  V   G   R+   A   GR+++ LG PIDG  
Sbjct: 62  LAEVVSIEQEMALLSPFASSDGLRCGQWVTPLGHMHRVQVGADLAGRILDGLGAPIDGGP 121

Query: 118 SLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
            L  G    E+    P  + RQ VE+   TG+R ID       GQRIG+FA +G+GKSTL
Sbjct: 122 PL-TGQWR-ELDCPPPSPLTRQPVEQMLTTGVRAIDGILSCGEGQRIGIFAAAGVGKSTL 179

Query: 178 LSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLK-KSVVVVATSDESPILRKMAPL 236
           LSM       D ++++L+GERGREVREF+E  L    + ++VVVVATSD   + R     
Sbjct: 180 LSMLCADSAADVMVLALIGERGREVREFLEQVLTPEARARTVVVVATSDRPALERLKGLS 239

Query: 237 TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLER 296
           TA T+AEYF  +G  VLL+ DS+TR+A + REI   +GE P A  +P SVF+ LPRLLER
Sbjct: 240 TATTVAEYFRERGLKVLLLADSLTRYARAAREIGLAAGEPPAAGSFPPSVFANLPRLLER 299

Query: 297 IGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLAS 356
            G S++  G+ITA  +VLV+GD+ N+P+AD VRS+LDGHIVL+R LA  G YP +D  AS
Sbjct: 300 TGNSDR--GSITAFYTVLVEGDDMNEPVADEVRSLLDGHIVLSRRLAGAGHYPAIDIAAS 357

Query: 357 VSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDF 416
           VSR+  +  SA +  +   L  ++  ++E   +  IG Y+ G DL  D+A+ + P I  F
Sbjct: 358 VSRIMPQIVSAGQLAMAQKLRRMLACYQEIELLVQIGEYQAGEDLQADEALQRYPAICAF 417

Query: 417 LKQ 419
           L+Q
Sbjct: 418 LQQ 420


>gi|86158021|ref|YP_464806.1| ATPase FliI/YscN [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85774532|gb|ABC81369.1| type III secretion system ATPase, FliI/YscN [Anaeromyxobacter
           dehalogenans 2CP-C]
          Length = 435

 Score =  276 bits (707), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 160/384 (41%), Positives = 222/384 (57%), Gaps = 12/384 (3%)

Query: 59  LGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR---FRISPSACWCGRVINALGKPIDG 115
           L +V+ +  D   + P G    + L   V   GR    R+ P     GRV++ LG+P+DG
Sbjct: 56  LAEVVGLRDDRAVLVPFGELGGVGLDAEVIPTGRPHAIRVGPG--LLGRVLDGLGRPLDG 113

Query: 116 DDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKS 175
              L  G     +    P  + R+ V      G+RV+D       GQRIG+FAGSG+GKS
Sbjct: 114 A-PLPAGLEEWAVDRPAPNPLARRPVAAPLPLGVRVLDGLLTAGEGQRIGLFAGSGVGKS 172

Query: 176 TLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMA 234
           TLL   AR    D  ++ LVGERGREVREF+E  LG D L +SVVV ATSD   ++R  A
Sbjct: 173 TLLGQLARGARADLCVVCLVGERGREVREFLEGPLGADGLARSVVVAATSDAPALVRLKA 232

Query: 235 PLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLL 294
              A  +AE+F+ +GD VLL++DS+TR+A ++RE+   +GE P  +GYP SVF+ LPRLL
Sbjct: 233 AHVATAVAEWFAERGDRVLLLVDSVTRYARALREVGLAAGEPPARQGYPPSVFAALPRLL 292

Query: 295 ERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPL 354
           ER G   + +G ITAV +VLV G +  +PIAD VR ILDGH+VL+R++A  GR+P VDPL
Sbjct: 293 ERAG--NRARGGITAVYTVLVAGGDLEEPIADEVRGILDGHVVLDRAVAAGGRFPAVDPL 350

Query: 355 ASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIY 414
            S+SR+       D       +  L+      RD+  +G YR G D   D A+ ++P + 
Sbjct: 351 QSLSRVMPAVAGPDHLAAAGRVRALLAAHARVRDLVALGAYRAGGDPEADLALARLPALE 410

Query: 415 DFLKQSPSDLSSEDVFQEITKKLQ 438
            FL+Q    L     F+E  ++L+
Sbjct: 411 AFLRQP---LGEPAPFEETLRRLE 431


>gi|260767969|ref|ZP_05876903.1| flagellum-specific ATP synthase FliI [Vibrio furnissii CIP 102972]
 gi|260615999|gb|EEX41184.1| flagellum-specific ATP synthase FliI [Vibrio furnissii CIP 102972]
          Length = 448

 Score =  276 bits (707), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 147/367 (40%), Positives = 227/367 (61%), Gaps = 5/367 (1%)

Query: 60  GQVIRINLDIVYICPVG-IGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDS 118
            QV+  + ++ Y+ P+  +G   +   +V   G   +  S+ W GRV+N LG+ +D    
Sbjct: 66  AQVVGFDHNVAYLMPIRRLGGLFAGAKVVPLEGDSTVQLSSQWLGRVVNGLGEALDDGAP 125

Query: 119 LGKGD-LSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
           L  GD +S+E     P  + R+ V+     G+R I+    +  GQRIG+ AGSG+GKS L
Sbjct: 126 LRGGDRVSLEPKPINP--LKRRPVDTPLDVGVRTINGLLTVGKGQRIGLMAGSGVGKSVL 183

Query: 178 LSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLK-KSVVVVATSDESPILRKMAPL 236
           + M  ++   D +++ L+GERGREVREFIE  L ++ + K++++ A +DESP++R  A L
Sbjct: 184 MGMITQNTEADVIVVGLIGERGREVREFIERNLTEHTRRKAIIIAAPADESPLMRLRATL 243

Query: 237 TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLER 296
               +AEYF  +G +VLL++DS+TR+A + REIA + GE P +RGYP SVFS LP+LLER
Sbjct: 244 LCHRVAEYFRDQGKDVLLLMDSLTRYAMAQREIALSLGEPPASRGYPPSVFSVLPQLLER 303

Query: 297 IGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLAS 356
            G S+   G+++A+ +VL +GD+  DP+ DS R+ILDGH+VL+R LAE+G YP +D  AS
Sbjct: 304 AGNSDNPDGSLSAIYTVLAEGDDQQDPVVDSARAILDGHVVLSRQLAEQGHYPAIDVNAS 363

Query: 357 VSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDF 416
           +SR            + +    L   + + +++  +GGY+PG D  LD+AV   P +  F
Sbjct: 364 ISRCMSAVTPEAHVTVANQFRQLYANYLQVKELLPLGGYQPGQDAELDRAVAMYPHLKAF 423

Query: 417 LKQSPSD 423
           L+QS  +
Sbjct: 424 LQQSAKE 430


>gi|330819409|ref|YP_004348271.1| Type III secretion system ATPase [Burkholderia gladioli BSR3]
 gi|327371404|gb|AEA62759.1| Type III secretion system ATPase [Burkholderia gladioli BSR3]
          Length = 452

 Score =  276 bits (707), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 154/367 (41%), Positives = 219/367 (59%), Gaps = 5/367 (1%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSL 119
           +V+    D+  + P    E +S    V   GR   I       GRV++ LG+PIDG   L
Sbjct: 72  EVVGFTRDVALLSPFARLEHVSRATQVIGLGRPLSIQVGDQLLGRVLDGLGEPIDGGPPL 131

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
              D    ++ + P  M R+ V+    TG+RV+D    L  GQR+G+FA +G+GKSTL+ 
Sbjct: 132 DSDDWR-PVIVQPPDPMKRRMVDTPMPTGVRVVDAMMTLGEGQRMGIFAPAGVGKSTLMG 190

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTA 238
           MFAR    D  +I+L+GERGREVREFIE  LG D + +SVVV ATSD S + R  A  TA
Sbjct: 191 MFARGAACDINVIALIGERGREVREFIELILGPDGMARSVVVCATSDRSSMERAKAAHTA 250

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
             IAEYF  +G  VLL++DS+TRFA + REI   +GE P  RG+P SVF+ELPRLLER G
Sbjct: 251 TAIAEYFRDRGLRVLLMMDSLTRFARAGREIGLAAGEPPARRGFPPSVFAELPRLLERTG 310

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
               + G+ITA+ +VL + +   DP+A+ VR ILDGH++L+R +A   +YP +D L S+S
Sbjct: 311 MG--QTGSITALYTVLAEDETGGDPVAEEVRGILDGHMILSREIAARNQYPAIDVLGSLS 368

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+          +  S +  L+ +  E   +  +G Y+PG + + D+A+ +  +I +FL 
Sbjct: 369 RVMSLVVPDTHNRAASRVRELMAKHREVEVLLQVGEYQPGQNPVADEAIEKADVIREFLC 428

Query: 419 QSPSDLS 425
           Q  SD +
Sbjct: 429 QRTSDYA 435


>gi|330862417|emb|CBX72576.1| putative secretion system apparatus ATP synthase ssaN [Yersinia
           enterocolitica W22703]
          Length = 451

 Score =  276 bits (706), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 162/374 (43%), Positives = 224/374 (59%), Gaps = 7/374 (1%)

Query: 55  NSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPI 113
           + D L +V+ I      + P      +  G  +   G   R+       GRV++ LG+PI
Sbjct: 58  SPDMLAEVVAIEQQTALLSPFASSAGLRCGQWISPLGHEHRVRVGVDLLGRVLDGLGEPI 117

Query: 114 DGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIG 173
           D    L +G    E+    P  + RQ V++   TGIR ID       GQRIG+FA +G+G
Sbjct: 118 DAGPPL-RGHWR-ELDCPPPDPLTRQPVQQILTTGIRAIDGVLSCGEGQRIGIFAAAGVG 175

Query: 174 KSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLK-KSVVVVATSDESPILRK 232
           KS+LLSM  R    D ++++L+GERGREVREF+E  L    + ++VVVVATSD   + R 
Sbjct: 176 KSSLLSMLCRGCRADIIVLALIGERGREVREFLEQVLTPETRARTVVVVATSDRPALERL 235

Query: 233 MAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPR 292
               TA T+AEYF  +G  VLL+ DS+TR+A + REI   +GE P    +PTSVF+ LPR
Sbjct: 236 KGIYTATTVAEYFRERGGKVLLMADSLTRYARAAREIGLAAGEHPAMGSFPTSVFAALPR 295

Query: 293 LLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVD 352
           LLER G SE+  G+ITA  +VLV+GD+ N+P+AD VRS+LDGHIVL+R LA  G YP +D
Sbjct: 296 LLERAGNSER--GSITAFYTVLVEGDDMNEPVADEVRSLLDGHIVLSRQLAGAGHYPAID 353

Query: 353 PLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPI 412
             ASVSR+  +  SA+ + L   L H+   ++E   +  +G Y+ G DL  D+A+ + P 
Sbjct: 354 IAASVSRIMPQIVSAEHRALAQKLRHIQACYQEIELLVRVGEYQEGQDLQADEALQRYPG 413

Query: 413 IYDFLKQSPSDLSS 426
           I  FL+Q  S LSS
Sbjct: 414 ICAFLQQE-SALSS 426


>gi|283955636|ref|ZP_06373129.1| flagellum-specific ATP synthase FliI [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|283792861|gb|EFC31637.1| flagellum-specific ATP synthase FliI [Campylobacter jejuni subsp.
           jejuni 1336]
          Length = 461

 Score =  276 bits (706), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 166/425 (39%), Positives = 240/425 (56%), Gaps = 12/425 (2%)

Query: 4   NLETL-AQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGD---FVVHQGKNSDNL 59
           NLE L ++L ++   NL    G I+ I++    +  L   V  GD    V ++ +N + L
Sbjct: 2   NLEKLRSKLGKE---NLSAIFGEITKISATSIEIRGLKTGV--GDIVKLVSNENENLNTL 56

Query: 60  GQVIRINLDIVYICPVGIGEEISLGDLVF-HWGRFRISPSACWCGRVINALGKPIDGDDS 118
             V+ I     Y+ P    E   +GD  F      +I  S    GRV++   +P DG  +
Sbjct: 57  AMVVEIKEQFSYLSPFSFIEGFKIGDRAFISDAGMQIGVSDELLGRVVDPFMRPKDGKGA 116

Query: 119 LGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLL 178
           +      M IM     AM R  +E+ F  G++ ID       GQ++G+FAGSG+GKSTL+
Sbjct: 117 IEVSKY-MPIMRAPIDAMKRGLIEEVFPVGVKTIDALLTCGVGQKLGIFAGSGVGKSTLM 175

Query: 179 SMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTA 238
            M  ++      +++L+GERGRE+ EFI+  LG  L  +V++VATSD+S ++RK     A
Sbjct: 176 GMIVKNSKAPIKVVALIGERGREIPEFIQKNLGGKLDDTVIIVATSDDSALMRKYGAFCA 235

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
           +++AEYF  +G +VL I+DS+TRFA + REI    GE P  +GYP SV S LP+L+ER G
Sbjct: 236 MSVAEYFKEQGKDVLFIMDSVTRFAMAQREIGLALGEPPTTKGYPPSVLSLLPQLMERTG 295

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
             E+ KG ITA  +VLVDGD+ +DPIAD  RSILDGHIVL+R L + G YPP++   S S
Sbjct: 296 -KEEGKGTITAFFTVLVDGDDMSDPIADQSRSILDGHIVLSRELTDFGIYPPINIQNSAS 354

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+     SA+ K        L    +E   +  IG Y+ G D  LD+A+ +   +  FL 
Sbjct: 355 RVMSDIISAEHKLWARKFKRLNSLLKENEVLLRIGAYQKGSDKELDEAISKKEFMQKFLG 414

Query: 419 QSPSD 423
           Q+P +
Sbjct: 415 QNPEE 419


>gi|296125411|ref|YP_003632663.1| ATPase, FliI/YscN family [Brachyspira murdochii DSM 12563]
 gi|296017227|gb|ADG70464.1| ATPase, FliI/YscN family [Brachyspira murdochii DSM 12563]
          Length = 485

 Score =  276 bits (706), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 154/352 (43%), Positives = 222/352 (63%), Gaps = 13/352 (3%)

Query: 81  ISLGDLVFHWGRFRISPSACWC-----GRVINALGKPIDGDDSLGKGDLSMEIMSKVPPA 135
           I+ G++V+ + R    P +  C     G V++A GKP+ G       +  + +       
Sbjct: 90  ITFGNMVYSFER----PLSVMCCDEILGTVLDARGKPLAGGGH-NFYETPVAVSHNAVNP 144

Query: 136 MNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLV 195
           MNR R++K  +TG+R ID    +  GQR+ + +G+G+GKSTLLSM AR+   D  +I+L+
Sbjct: 145 MNRPRIKKHIQTGVRAIDGLLTVGQGQRMAIMSGTGVGKSTLLSMIARNTNADVNVIALI 204

Query: 196 GERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLL 254
           GER REVR+FIE  LG+  LK+SV+VVATSD++P+LR  A  TA TIAEYF  KG NV+ 
Sbjct: 205 GERRREVRDFIERDLGEEGLKRSVLVVATSDDAPLLRVRAAYTATTIAEYFRDKGKNVMF 264

Query: 255 ILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVL 314
           ++DS+TRFA + REI  + GE P  RGY  SVFSEL +LLER G S   KG ITA  +VL
Sbjct: 265 MVDSVTRFALAQREIGLSRGEPPTTRGYTPSVFSELAKLLERTGTS--NKGTITAFYNVL 322

Query: 315 VDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVS 374
           V+GD+ ++PI D+VR ILDGHIVL+R LA  G +P +D   S+SR+ ++  S   KK   
Sbjct: 323 VEGDDLDEPITDTVRGILDGHIVLSRDLANRGHFPAIDVNKSISRIMNEVVSNMHKKAAR 382

Query: 375 SLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
               +   + E +++ +IGGY  G    +D+A+   P++  +L+Q   ++SS
Sbjct: 383 EFLKMSADYNEAKELIMIGGYAKGSMPEVDRAIDYKPMMDRYLQQDVYEVSS 434


>gi|315179673|gb|ADT86587.1| FliIL [Vibrio furnissii NCTC 11218]
          Length = 448

 Score =  276 bits (706), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 147/367 (40%), Positives = 226/367 (61%), Gaps = 5/367 (1%)

Query: 60  GQVIRINLDIVYICPVG-IGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDS 118
            QV+  + ++ Y+ P+  +G   +   +V   G   +  S+ W GRV+N LG+ +D    
Sbjct: 66  AQVVGFDHNVAYLMPIRRLGGLFAGAKVVPLEGDSTVQLSSQWLGRVVNGLGEALDDGAP 125

Query: 119 LGKGD-LSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
           L  GD +S+E     P  + R+ V+     G+R I+    +  GQRIG+ AGSG+GKS L
Sbjct: 126 LRGGDRVSLEPKPINP--LKRRPVDTPLDVGVRTINGLLTVGKGQRIGLMAGSGVGKSVL 183

Query: 178 LSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLK-KSVVVVATSDESPILRKMAPL 236
           + M  ++   D +++ L+GERGREVREFIE  L +  + K++++ A +DESP++R  A L
Sbjct: 184 MGMITQNTEADVIVVGLIGERGREVREFIERNLTEQARRKAIIIAAPADESPLMRLRATL 243

Query: 237 TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLER 296
               +AEYF  +G +VLL++DS+TR+A + REIA + GE P +RGYP SVFS LP+LLER
Sbjct: 244 LCHRVAEYFRDQGKDVLLLMDSLTRYAMAQREIALSLGEPPASRGYPPSVFSVLPQLLER 303

Query: 297 IGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLAS 356
            G S+   G+++A+ +VL +GD+  DP+ DS R+ILDGH+VL+R LAE+G YP +D  AS
Sbjct: 304 AGNSDNPDGSLSAIYTVLAEGDDQQDPVVDSARAILDGHVVLSRQLAEQGHYPAIDVNAS 363

Query: 357 VSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDF 416
           +SR            + +    L   + + +++  +GGY+PG D  LD+AV   P +  F
Sbjct: 364 ISRCMSAVTPEAHVTVANQFRQLYANYLQVKELLPLGGYQPGQDAELDRAVAMYPHLKAF 423

Query: 417 LKQSPSD 423
           L+QS  +
Sbjct: 424 LQQSAKE 430


>gi|268680771|ref|YP_003305202.1| flagellar protein export ATPase FliI [Sulfurospirillum deleyianum
           DSM 6946]
 gi|268618802|gb|ACZ13167.1| flagellar protein export ATPase FliI [Sulfurospirillum deleyianum
           DSM 6946]
          Length = 434

 Score =  276 bits (706), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 161/411 (39%), Positives = 237/411 (57%), Gaps = 7/411 (1%)

Query: 17  KNLVVQGGYISSITSVYYTVTCLSQYVCLGDFV--VHQGKNSDNLGQVIRINLDIVYICP 74
           K+L    G I+ I+S   T+        +GD V  V    + + LG V  ++ +  +I P
Sbjct: 13  KSLSPMFGTITKISST--TIEACGLRPSIGDIVNIVSLDSDKNELGMVTEVDRNAFFISP 70

Query: 75  VGIGEEISLGDLVFHWGRFRISP-SACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVP 133
            G  E   +GD VF   +  + P      GRV++   +P DG  ++G    S  IM    
Sbjct: 71  FGFIEGFKIGDKVFISEQGMMIPVGEELLGRVVDPFIRPKDGKGAIGARS-SASIMKAPL 129

Query: 134 PAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIIS 193
             M R  + + F  G++ ID       GQ++G+FAGSG+ KSTL+ M  R       +++
Sbjct: 130 DPMKRGLINEPFCVGVKTIDGLLTCGKGQKMGIFAGSGVDKSTLMGMIVRGSEAPIKVVA 189

Query: 194 LVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVL 253
           L+GERGREV EFIE  LG NL+ +V++VATSD+SP++RK    +A+++AEYF ++G +VL
Sbjct: 190 LIGERGREVPEFIEKNLGGNLENTVIIVATSDDSPLMRKYGAFSAMSVAEYFKNQGRDVL 249

Query: 254 LILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISV 313
            ++DS+TRFA + REI    GE P ++GYP SV + LP+L+ER G  E+ KG+ITA  +V
Sbjct: 250 FMMDSVTRFAMAQREIGLALGEPPTSKGYPPSVLALLPQLMERAG-KEEGKGSITAFFTV 308

Query: 314 LVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLV 373
           LV+GD+ +DPIAD  RSILDGHIVL+R L + G YPP++   S SR+       + KK  
Sbjct: 309 LVEGDDLSDPIADQSRSILDGHIVLSRELTDYGIYPPINIQNSASRVMGDVIETEHKKAA 368

Query: 374 SSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDL 424
                L    +E   +  IG Y  G D  LD A+ +   +  FL+Q+P ++
Sbjct: 369 MRFKRLNSILKENEVLIRIGAYEKGNDKELDLAISKKEKMNSFLQQAPEEV 419


>gi|86153685|ref|ZP_01071888.1| flagellar protein export ATPase FliI [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|85842646|gb|EAQ59858.1| flagellar protein export ATPase FliI [Campylobacter jejuni subsp.
           jejuni HB93-13]
          Length = 461

 Score =  276 bits (706), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 165/425 (38%), Positives = 241/425 (56%), Gaps = 12/425 (2%)

Query: 4   NLETL-AQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGD---FVVHQGKNSDNL 59
           NLE L ++L ++   NL    G I+ I++    +  L   V  GD    V ++ +N + L
Sbjct: 2   NLEKLRSKLGKE---NLSAIFGEITKISATSIEIRGLKTGV--GDIVKLVSNENENLNTL 56

Query: 60  GQVIRINLDIVYICPVGIGEEISLGDLVF-HWGRFRISPSACWCGRVINALGKPIDGDDS 118
             V+ I     Y+ P    E   +GD  F      +I  S    GRV++   +P DG  +
Sbjct: 57  AMVVEIKEQFSYLSPFSFIEGFKIGDRAFISDAGMQIGVSDELLGRVVDPFMRPKDGKGA 116

Query: 119 LGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLL 178
           + +    M IM     AM R  +E+ F  G++ ID       GQ++G+FAGSG+GKSTL+
Sbjct: 117 I-EATKYMPIMRAPIDAMKRGLIEEVFPVGVKTIDALLTCGVGQKLGIFAGSGVGKSTLM 175

Query: 179 SMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTA 238
            M  ++      +++L+GERGRE+ EFI+  LG  L  +V++VATSD+S ++RK     A
Sbjct: 176 GMIVKNSKAPIKVVALIGERGREIPEFIQKNLGGKLDDTVIIVATSDDSALMRKYGAFCA 235

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
           +++AEYF  +G +VL I+DS+TRFA + REI    GE P  +GYP SV S LP+L+ER G
Sbjct: 236 MSVAEYFKEQGKDVLFIMDSVTRFAMAQREIGLALGEPPTTKGYPPSVLSLLPQLMERTG 295

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
             E+ KG ITA  +VLVDGD+ +DPIAD  RSILDGHIVL+R L + G YPP++   S S
Sbjct: 296 -KEEGKGTITAFFTVLVDGDDMSDPIADQSRSILDGHIVLSRELTDFGIYPPINIQNSAS 354

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+     S++ K        L    +E   +  IG Y+ G D  LD+A+ +   +  FL 
Sbjct: 355 RVMSDIISSEHKLWARKFKRLNSLLKENEVLLRIGAYQKGSDKELDEAISKKEFMQKFLG 414

Query: 419 QSPSD 423
           Q+P +
Sbjct: 415 QNPEE 419


>gi|330505658|ref|YP_004382527.1| FliI/YscN family ATPase [Pseudomonas mendocina NK-01]
 gi|328919944|gb|AEB60775.1| FliI/YscN family ATPase [Pseudomonas mendocina NK-01]
          Length = 438

 Score =  276 bits (706), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 158/375 (42%), Positives = 219/375 (58%), Gaps = 9/375 (2%)

Query: 50  VHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVF---HWGRFRISPSACWCGRVI 106
           V Q   S    QV+  N DI Y+ P      ++ G  VF        +I  S  W GRV+
Sbjct: 48  VEQADGSLLDAQVVGFNRDITYLMPFKKPVGLAAGSRVFPAKDEALLQIDES--WLGRVV 105

Query: 107 NALGKPIDGDDSL-GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIG 165
           N LG+P+D    L G+  L +E+ S  P  + R+ VE     G+R I+    L  GQR+G
Sbjct: 106 NGLGEPLDERGKLSGRDPLPVELPSVNP--LKRRPVEAALDVGVRAINGLLTLGKGQRVG 163

Query: 166 VFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATS 224
           +FAGSG+GKS LL M  R    D V++ L+GERGREV+EFI   LG+  L+K+VVVVA +
Sbjct: 164 LFAGSGVGKSVLLGMITRQTKADVVVVGLIGERGREVQEFILHSLGEEGLRKAVVVVAPA 223

Query: 225 DESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPT 284
           +ESP++R  A     +IA YF  +G +VLL++DS+TR+A + REIA   GE P  +GYP 
Sbjct: 224 NESPLMRLKATELCHSIAAYFRDQGQDVLLLVDSLTRYAMAQREIALALGEPPATKGYPP 283

Query: 285 SVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAE 344
           SVF  LP L+E  G  E   G+++A+ +VL +GD+H DPI D  R+ILDGHIVL+R LA+
Sbjct: 284 SVFGMLPELVESAGNGESGSGSLSAIYTVLAEGDDHQDPIVDCARAILDGHIVLSRRLAD 343

Query: 345 EGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILD 404
            G YP +D  ASVSR   +                   +E+ +++  +GGY PG+D   D
Sbjct: 344 VGHYPAIDISASVSRCMSQVGEPAHLAAGRQFKEFYSTYEKIKELIPLGGYTPGMDAKTD 403

Query: 405 KAVHQVPIIYDFLKQ 419
           +AV   P +  FL+Q
Sbjct: 404 RAVQLAPSLERFLRQ 418


>gi|125657204|gb|ABN48692.1| flagella biosynthesis/type III secretory pathway ATPase
           [Burkholderia pseudomallei]
          Length = 417

 Score =  276 bits (706), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 162/397 (40%), Positives = 226/397 (56%), Gaps = 9/397 (2%)

Query: 46  GDFVVHQGKNSDNL-GQVIRINLDIVYICPVGIGEEISLGDLVF---HWGRFRISPSACW 101
           G+  V +  + D +  QV+  N +  ++ P      +  G  V      G  RI  S  W
Sbjct: 23  GERCVIESADGDRIDAQVVGFNREETFLMPFKKPVGLVAGAQVLSCERQGLLRIGRS--W 80

Query: 102 CGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHG 161
            GR++N LG+ IDG  SLG GD  +         + ++ V      G+R I+    L  G
Sbjct: 81  LGRIVNGLGEAIDGRGSLG-GDAVLRAHPAPVNPLRKRPVRDVLDVGVRAINGLLTLGRG 139

Query: 162 QRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVV 220
           QRIG+ AGSG+GKS LL M  R+   D V++ L+GERGREVREF++  LG+  L KSV+V
Sbjct: 140 QRIGLMAGSGVGKSMLLGMITRATQADVVVVGLIGERGREVREFVDHALGEAGLAKSVLV 199

Query: 221 VATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVAR 280
            A +DESP++R  A      IA +F   G NVLL++DS+TR+A + REIA + GE P  R
Sbjct: 200 AAPADESPLMRLKAAELCHAIAAHFRDTGANVLLLVDSLTRYAMAQREIALSVGEPPATR 259

Query: 281 GYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNR 340
           GYP SVF  LP+L+E  G  E   G+++A+ +VL +GD+ NDP+ D+ R+ILDGHIVL R
Sbjct: 260 GYPPSVFGMLPQLVETAGNGEG-AGSMSAIYTVLAEGDDQNDPVVDTARAILDGHIVLTR 318

Query: 341 SLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVD 400
            LAE G YP +D   SVSR   +   A+   L   +  +I R E+ RD+  +GGY  G D
Sbjct: 319 ELAERGHYPAIDVPRSVSRCMSQVAGAEHGALARKVKEMIGRHEQIRDLIALGGYVQGAD 378

Query: 401 LILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKL 437
              D+AV +   I  FL+Q   D++  D      K+L
Sbjct: 379 PATDEAVAKAARIDTFLRQDMLDVARHDATLAALKEL 415


>gi|251797442|ref|YP_003012173.1| ATPase, FliI/YscN family [Paenibacillus sp. JDR-2]
 gi|247545068|gb|ACT02087.1| ATPase, FliI/YscN family [Paenibacillus sp. JDR-2]
          Length = 441

 Score =  276 bits (706), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 158/371 (42%), Positives = 226/371 (60%), Gaps = 12/371 (3%)

Query: 70  VYICPVGIGEEISLG-DLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEI 128
           V + P+G    IS G D+V       +   +   G+V++ LGKP+DG  S     +    
Sbjct: 71  VILMPLGELHAISPGCDVVGTGKPLSVQVGSELLGKVLDGLGKPLDG--SFLPSRMQQYS 128

Query: 129 MSKVPP-AMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCF 187
               P   + R RV++    G+R ID    +  GQR+G+FAGSG+GKSTLL M AR+   
Sbjct: 129 THNEPSNPLARPRVQETLSIGVRAIDGLLTVGRGQRVGIFAGSGVGKSTLLGMIARNTSA 188

Query: 188 DKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFS 246
           D  +I+L+GERGREV EFIE  LG + L +SVV+VATSD+  ++R    L A +IAEYF 
Sbjct: 189 DVNVIALIGERGREVLEFIEKDLGPEGLARSVVIVATSDQPALIRIKGALIATSIAEYFR 248

Query: 247 SKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGN 306
            +G NV+L++DS+TR+A + RE+    GE P  RGY  SVF+ LP+LLER G      G+
Sbjct: 249 DRGLNVMLMMDSVTRYAMAQREVGLAIGEPPATRGYTPSVFATLPKLLERAGTGPN--GS 306

Query: 307 ITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWS 366
           ITA  +VLVDGD+ N+PIAD+VR ILDGHIVLNR LA +G +P +D LASVSR+  +  +
Sbjct: 307 ITAFYTVLVDGDDMNEPIADAVRGILDGHIVLNRQLANKGHFPAIDVLASVSRVMKEIVT 366

Query: 367 ADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDL-- 424
            + ++  + L  L+  + ++ D+  IG Y+ G +  +D A+  +  IY F +Q  ++   
Sbjct: 367 EEHQEAANELKMLLSVYRDSEDLINIGAYQRGTNEKIDTAIENIDAIYQFTRQKTNEKVT 426

Query: 425 ---SSEDVFQE 432
              S E + QE
Sbjct: 427 LADSKERLLQE 437


>gi|146309428|ref|YP_001189893.1| FliI/YscN family ATPase [Pseudomonas mendocina ymp]
 gi|145577629|gb|ABP87161.1| ATPase, FliI/YscN family [Pseudomonas mendocina ymp]
          Length = 438

 Score =  276 bits (706), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 156/375 (41%), Positives = 219/375 (58%), Gaps = 9/375 (2%)

Query: 50  VHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVF---HWGRFRISPSACWCGRVI 106
           V Q   S    QV+  N DI Y+ P      ++ G  VF        +I  S  W GRV+
Sbjct: 48  VEQADGSLLDAQVVGFNRDITYLMPFKKPVGLAAGSRVFPAKDEALLQIDES--WLGRVV 105

Query: 107 NALGKPIDGDDSL-GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIG 165
           N LG+P+D    L G+  L +E+ +  P  + R+ VE     G+R I+    L  GQR+G
Sbjct: 106 NGLGEPLDERGKLSGRDPLPVELPTVNP--LKRRPVEAALDVGVRAINALLTLGKGQRVG 163

Query: 166 VFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATS 224
           +FAGSG+GKS LL M  R    D V++ L+GERGREV+EF+   LG+  L+K+VVVVA +
Sbjct: 164 LFAGSGVGKSVLLGMITRQTKADVVVVGLIGERGREVQEFLLHSLGEEGLRKAVVVVAPA 223

Query: 225 DESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPT 284
           +ESP++R  A     +IA YF  +G +VLL++DS+TR+A + REIA   GE P  +GYP 
Sbjct: 224 NESPLMRLKATELCHSIAAYFRDQGQDVLLLVDSLTRYAMAQREIALALGEPPATKGYPP 283

Query: 285 SVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAE 344
           SVF  LP L+E  G  E   G+++A+ +VL +GD+H DPI D  R+ILDGHIVL+R LA+
Sbjct: 284 SVFGMLPELVESAGNGESGSGSLSAIYTVLAEGDDHQDPIVDCARAILDGHIVLSRRLAD 343

Query: 345 EGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILD 404
            G YP +D  ASVSR   +                   +E+ +++  +GGY PG+D   D
Sbjct: 344 VGHYPAIDISASVSRCMSQVGEPAHLGAARQFKEFYSTYEKIKELIPLGGYTPGMDAKTD 403

Query: 405 KAVHQVPIIYDFLKQ 419
           +AV   P +  FL+Q
Sbjct: 404 RAVQLAPSLERFLRQ 418


>gi|149377885|ref|ZP_01895614.1| flagellum-specific ATP synthase [Marinobacter algicola DG893]
 gi|149357827|gb|EDM46320.1| flagellum-specific ATP synthase [Marinobacter algicola DG893]
          Length = 460

 Score =  276 bits (705), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 154/393 (39%), Positives = 228/393 (58%), Gaps = 8/393 (2%)

Query: 32  VYYTVTCLSQYVCLGDFVVHQGKNSDNL-GQVIRINLDIVYICPVGIGEEISLGDLVFHW 90
           V  T+ C+   + +GD  V  G+ +  +  +V+    D VY+ P+   E +  G  V   
Sbjct: 32  VGLTLECVGCPMVVGDRCVITGQGAGTVEAEVVGFEDDRVYLMPLTAIEGLRPGARVVPL 91

Query: 91  G---RFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKT 147
               R  + P     GRV+N  G+P+DG   L + +  + +   +   ++R  V +    
Sbjct: 92  SVASRVPVGPE--LLGRVVNGNGEPLDGKGPL-QAEARVSLSGDIINPLDRAPVRQSMDV 148

Query: 148 GIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIE 207
           GIR I+    +  GQR+G+FAGSG+GKS LL M  R    D  ++ L+GERGREV+EFIE
Sbjct: 149 GIRAINSLMTVGQGQRLGLFAGSGVGKSVLLGMMTRFTNADITVVGLIGERGREVKEFIE 208

Query: 208 DYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSI 266
           D LGD  L +SVVV + +D+SP++R  A +    IAEY+  +G  VLL++DS+TR+A + 
Sbjct: 209 DILGDEGLARSVVVASPADDSPLMRLRAAMLTTRIAEYYRDQGKRVLLLMDSLTRYAQAQ 268

Query: 267 REIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIAD 326
           REIA   GE P  +GYP SVF++LP+L+ER G      G+ITA  +VL +GD+  DPIAD
Sbjct: 269 REIALAVGEPPATKGYPPSVFAKLPQLVERTGNGRPGGGSITAFYTVLTEGDDQQDPIAD 328

Query: 327 SVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEET 386
           + R+ILDGHIVL+R LAEEG YP +D  AS+SR+  +    +          +  R+++ 
Sbjct: 329 AARAILDGHIVLSRRLAEEGHYPAIDVEASISRVMPQVTETEHFARAQRFKQVYSRYQQA 388

Query: 387 RDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
           RD+  +G Y  G D   D A+  +  +  FL+Q
Sbjct: 389 RDLISVGAYVKGSDPETDFAITHIGNMGQFLQQ 421


>gi|255323214|ref|ZP_05364349.1| flagellar protein export ATPase FliI [Campylobacter showae RM3277]
 gi|255299737|gb|EET79019.1| flagellar protein export ATPase FliI [Campylobacter showae RM3277]
          Length = 434

 Score =  276 bits (705), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 159/413 (38%), Positives = 238/413 (57%), Gaps = 7/413 (1%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFV--VHQGKNSDNLGQVIRINLDIVYICPVGIGEEI 81
           G I  I++    ++ L     +GD V    + K+   L  V  +  +   I P G  E  
Sbjct: 21  GVIERISATTIEISGLRP--SIGDIVQICAKDKSKSGLAMVTEVRQNTALISPFGFVEGY 78

Query: 82  SLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQR 140
            +GD V+   +  +I       GRV++    P DG  ++   + +  IM     AM R  
Sbjct: 79  KIGDFVYQSDQGMKIPVGDALLGRVVDPFMNPKDGKGAIAATEYA-PIMRAPIDAMKRGL 137

Query: 141 VEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGR 200
           +++ F  G++ ID       GQ++G+FAGSG+GKSTL+ M  ++      +++L+GERGR
Sbjct: 138 IDEIFSVGVKSIDGLLTCGKGQKLGIFAGSGVGKSTLMGMIVKNSQAPIKVVALIGERGR 197

Query: 201 EVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSIT 260
           EV EFIE  L  +L  +VV+VATSD+SP++RK     A+++AEYF ++G +VL I+DS+T
Sbjct: 198 EVPEFIEKNLRGDLSGTVVIVATSDDSPLMRKYGAFCAMSVAEYFKNQGKDVLFIMDSVT 257

Query: 261 RFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNH 320
           RFA + REI    GE P ++GYP SV + LP+L+ER G  E+ KG+ITA  +VLVDGD+ 
Sbjct: 258 RFAMAQREIGLALGEPPTSKGYPPSVLTLLPQLMERAG-KEEGKGSITAFFTVLVDGDDM 316

Query: 321 NDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLI 380
           +DPIAD  RSILDGHIVL+R + + G YPP++ L S SR+     + + +   + L  L 
Sbjct: 317 SDPIADQSRSILDGHIVLSREMTDFGIYPPINILNSASRVMSDIATKEHRANAAKLKRLY 376

Query: 381 HRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEI 433
              +E   +  IG Y+ G D  LD A+ +   I +FLKQ   +  S +  QE+
Sbjct: 377 SLLKENEVLLRIGAYQKGSDKELDLAISKKEFIDNFLKQDAEEGFSFEQTQEL 429


>gi|284006893|emb|CBA72162.1| type III secretion system ATPase [Arsenophonus nasoniae]
          Length = 429

 Score =  276 bits (705), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 151/355 (42%), Positives = 214/355 (60%), Gaps = 18/355 (5%)

Query: 72  ICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSK 131
           +CP G    + +G  +               G+V++ LG P   ++ + + +    I   
Sbjct: 78  VCPTGTSHLVGVGRHLL--------------GKVLDGLGNPFTAENYI-EPEQWYPIYRD 122

Query: 132 VPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVI 191
            P  M R+ +EK    GIR ID       GQR+G+FA +G GKSTL +   RS   D ++
Sbjct: 123 APAPMQRKLIEKPLSLGIRAIDGLLTCAEGQRMGIFAAAGGGKSTLFASLIRSADVDVIV 182

Query: 192 ISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGD 250
           ++L+GERGREVREFIE+ LG+  LK+SV++VATSD   I R  A   A +IAEYF  +  
Sbjct: 183 LALIGERGREVREFIEEDLGEEGLKRSVLIVATSDRPAIERAKAGFVATSIAEYFRDQNM 242

Query: 251 NVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAV 310
            VLL++DS+TRFA + REI   +GE P  RG+P SVF+ELPRL+ER G S+K  G+ITA+
Sbjct: 243 RVLLLMDSVTRFARAQREIGLAAGEPPTRRGFPPSVFAELPRLMERAGQSDK--GSITAL 300

Query: 311 ISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEK 370
            +VLV+GD+  +PIAD  RSILDGHI+L+R LA    YP +D L SVSR+ D+  S   +
Sbjct: 301 YTVLVEGDDMTEPIADETRSILDGHIILSRKLAAASHYPAIDVLRSVSRVMDRVISRKHQ 360

Query: 371 KLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLS 425
           +    L   + ++EE   +  IG Y+PG D + D+A+ + P I  +L QS  + S
Sbjct: 361 QQAQQLRKWLAKYEEIELLLQIGEYQPGNDQLADEAIKRYPQIQSWLCQSTDEKS 415


>gi|94314183|ref|YP_587392.1| flagellum-specific ATP synthase [Cupriavidus metallidurans CH34]
 gi|93358035|gb|ABF12123.1| flagellum-specific ATP synthase [Cupriavidus metallidurans CH34]
          Length = 486

 Score =  276 bits (705), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 154/336 (45%), Positives = 207/336 (61%), Gaps = 14/336 (4%)

Query: 91  GRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPA------MNRQRVEKG 144
           G  R+       GRV++A G+P+DG   LG     +   S+VP A      + R  +E  
Sbjct: 133 GSKRLPVGDGLLGRVLDAAGRPLDG---LGP----ITAASEVPLAGTQINPLTRAPIETV 185

Query: 145 FKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVRE 204
             TG+R I+    +  GQR+G+FAGSG+GKS LL M AR    D +++ L+GERGREV+E
Sbjct: 186 LDTGVRAINGMLTVGRGQRMGLFAGSGVGKSVLLGMMARYTNADVIVVGLIGERGREVKE 245

Query: 205 FIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFA 263
           FIE+ LG+   K+SVVV A +D SP+LR      A  +AEYF  KG +VLLI+DS+TR+A
Sbjct: 246 FIENILGEEGRKRSVVVAAPADTSPLLRMQGAAYATRLAEYFRDKGQHVLLIMDSLTRYA 305

Query: 264 HSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDP 323
            + REIA   GE P  +GYP SVF++LP L+ER G   +  G+ITA  +VL +GD+  DP
Sbjct: 306 MAQREIALAIGEPPATKGYPPSVFAKLPTLVERTGNGPEGGGSITAFYTVLTEGDDQQDP 365

Query: 324 IADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRF 383
           IADS R+ILDGHIVL+RSLAE G YP +D  AS+SR       A +   V     L+ R+
Sbjct: 366 IADSARAILDGHIVLSRSLAEAGHYPAIDVEASISRAMTALIDAPQFASVRRFKQLMSRY 425

Query: 384 EETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
           +  RD+  +G Y PG D  LD A+   P +  FL+Q
Sbjct: 426 QRNRDLISVGAYVPGSDPELDLAIRMYPRMEAFLQQ 461


>gi|187934498|ref|YP_001885044.1| flagellar protein export ATPase FliI [Clostridium botulinum B str.
           Eklund 17B]
 gi|187722651|gb|ACD23872.1| flagellar protein export ATPase FliI [Clostridium botulinum B str.
           Eklund 17B]
          Length = 435

 Score =  276 bits (705), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 154/327 (47%), Positives = 214/327 (65%), Gaps = 5/327 (1%)

Query: 103 GRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQ 162
           G +I+ LGKP+ G++ +   D  +E  +  P  + R+R+++   TGIR ID F     GQ
Sbjct: 102 GEIIDGLGKPLRGEELVQGEDYPLE--NNPPDPLKRKRIKEIMPTGIRAIDGFLTCGDGQ 159

Query: 163 RIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVV 221
           RIG+FAGSG+GKST L M AR    D  +I+L+GERGREV EFIE  LG + +KKSVVV 
Sbjct: 160 RIGIFAGSGVGKSTTLGMIAREAKADVNVIALIGERGREVLEFIEKDLGPEGMKKSVVVC 219

Query: 222 ATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARG 281
           ATSD+  ++R    LTA  IAEYF  KG  V+L++DS+TRFA + RE+    GE P  +G
Sbjct: 220 ATSDKPALIRLKGALTATAIAEYFRDKGKKVILMMDSVTRFAMAQREVGLAIGEPPATKG 279

Query: 282 YPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRS 341
           Y  SVF++LP+L+E+ G SE   G+ITA  +VLVDGD+ N+PIAD+VR ILDGHIVL+RS
Sbjct: 280 YTPSVFAKLPKLMEKSGTSED--GSITAFYTVLVDGDDFNEPIADAVRGILDGHIVLSRS 337

Query: 342 LAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDL 401
           LA +  YP +D L SVSRL +    ++  K  S    L+  ++E+ D+  IG Y  G + 
Sbjct: 338 LAHKNHYPAIDILNSVSRLMNSIAPSEHIKAASIARDLLATYKESEDLINIGAYVKGSNK 397

Query: 402 ILDKAVHQVPIIYDFLKQSPSDLSSED 428
            +D A+     I +FL+Q+ ++ S+ D
Sbjct: 398 KIDLAISYHDKIEEFLRQTVNEKSNFD 424


>gi|146278633|ref|YP_001168792.1| FliI/YscN family ATPase [Rhodobacter sphaeroides ATCC 17025]
 gi|145556874|gb|ABP71487.1| ATPase, FliI/YscN family [Rhodobacter sphaeroides ATCC 17025]
          Length = 436

 Score =  276 bits (705), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 162/401 (40%), Positives = 233/401 (58%), Gaps = 2/401 (0%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISL 83
           G ++ I       T L+    LGD V+  G N +  G+V+R++   V I P    E +S+
Sbjct: 22  GRVTEIARGTIAATGLTSGAGLGDRVIVHGTNGEIGGEVLRLSHQEVTILPDAAIEGLSI 81

Query: 84  GDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEK 143
           GD V   G   I+P   W GR+++ LG+P+DG   L +G ++  + +  PPA  R+ +  
Sbjct: 82  GDQVELVGSAEIAPDDSWIGRIVDPLGRPLDGR-PLFRGPIARPLRAPAPPAARRRSLGP 140

Query: 144 GFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVR 203
              TG+ V D   PL  GQR G+FAGSG+GKS+LL+ FAR    D V+I L+GERGRE+R
Sbjct: 141 RLPTGVAVFDTMLPLVQGQRTGLFAGSGVGKSSLLAKFARGVGADVVVIGLIGERGRELR 200

Query: 204 EFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRF 262
           +F E  LG   + +SVVV ATSD+SP++R+     A+ +AE+F  +G +VLL+ DSITRF
Sbjct: 201 DFTERVLGARGMARSVVVTATSDQSPLMRRRCGWAAMAVAEHFRDQGLHVLLLADSITRF 260

Query: 263 AHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHND 322
           A + RE+A   GE    RG+P S    +  L ER GP  +  G+ITAV SVLV G +  +
Sbjct: 261 AEAHREVALAGGEEASMRGFPPSTAHTIMSLAERAGPGAEGTGDITAVFSVLVAGSDMEE 320

Query: 323 PIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHR 382
           P+AD +R +LDGH+V++R +AE GR+P +D L SVSR    A S  E  L+     L+  
Sbjct: 321 PVADILRGVLDGHVVMDRRIAERGRFPAIDLLRSVSRSLPDAASDPENDLIVEARRLLGA 380

Query: 383 FEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSD 423
           ++    +   G Y  G D  +D A+   P +  FL +   D
Sbjct: 381 WDRAEMMIQAGLYAKGSDPQVDAAIRVWPALDGFLAEDAPD 421


>gi|218703514|ref|YP_002411033.1| lateral flagellar export/assembly protein [Escherichia coli UMN026]
 gi|293403344|ref|ZP_06647435.1| fliI [Escherichia coli FVEC1412]
 gi|298378956|ref|ZP_06988837.1| fliI [Escherichia coli FVEC1302]
 gi|218430611|emb|CAR11477.1| Flagellum-specific ATP synthase, Lateral flagellar export/assembly
           protein [Escherichia coli UMN026]
 gi|291429197|gb|EFF02217.1| fliI [Escherichia coli FVEC1412]
 gi|298280069|gb|EFI21573.1| fliI [Escherichia coli FVEC1302]
          Length = 445

 Score =  276 bits (705), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 155/383 (40%), Positives = 224/383 (58%), Gaps = 13/383 (3%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFR-ISPSACWCGRVINALGKPIDGDDSL 119
           Q +  N DI Y+ P      +  G  VF   +   I     W GRV+N LG+P+DG   L
Sbjct: 60  QAVGFNRDITYLMPFKQPVGLMAGARVFPEEKAHDILIGESWLGRVVNGLGEPLDGKGRL 119

Query: 120 GKGDLSMEIMSKVPPAMN---RQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKST 176
              DL    +  +PP++N   R+ V++    G++ I+    +  GQR+G+ AGSG+GKS 
Sbjct: 120 NGNDL----LPPLPPSVNPLTRRSVDEPLDVGVKAINGLLTIGKGQRVGLMAGSGVGKSV 175

Query: 177 LLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAP 235
           LL M  R    D V++ L+GERGREV+EFI+  LG D L KS+VVVA +DESP++R  A 
Sbjct: 176 LLGMITRQTKADIVVVGLIGERGREVKEFIDHSLGADGLAKSIVVVAPADESPLMRLKAT 235

Query: 236 LTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLE 295
               +IA +F  +G +VLL++DS+TR+A + REIA + GE P  +GYP S F  +P+L+E
Sbjct: 236 ELCHSIAAWFRDRGHHVLLLVDSLTRYAMAQREIALSLGEPPATKGYPPSAFGMIPKLVE 295

Query: 296 RIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLA 355
             G SE   G++TA+ +VL +GD+  DPI D  R++LDGHIVL R LAE G YP +D   
Sbjct: 296 SAGNSES-AGSMTAIYTVLAEGDDQQDPIVDCARAVLDGHIVLTRKLAEAGHYPAIDIGQ 354

Query: 356 SVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYD 415
           S+SR  ++  S D ++   +L      + E + +  +GGY  G D  +DKAV   P I  
Sbjct: 355 SISRCMNQVTSLDHQQSARALKQNYAAYMEIKPLIPLGGYVAGADASVDKAVKMFPAIER 414

Query: 416 FLKQSPSDLSSEDVFQEITKKLQ 438
           FL+Q   D+      + +  +LQ
Sbjct: 415 FLRQ---DMREPAALELVQSRLQ 434


>gi|134280666|ref|ZP_01767376.1| flagellum-specific ATP synthase FliI [Burkholderia pseudomallei
           305]
 gi|167725915|ref|ZP_02409151.1| flagellum-specific ATP synthase [Burkholderia pseudomallei DM98]
 gi|167905075|ref|ZP_02492280.1| flagellum-specific ATP synthase [Burkholderia pseudomallei NCTC
           13177]
 gi|134247688|gb|EBA47772.1| flagellum-specific ATP synthase FliI [Burkholderia pseudomallei
           305]
          Length = 435

 Score =  276 bits (705), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 162/397 (40%), Positives = 226/397 (56%), Gaps = 9/397 (2%)

Query: 46  GDFVVHQGKNSDNL-GQVIRINLDIVYICPVGIGEEISLGDLVF---HWGRFRISPSACW 101
           G+  V +  + D +  QV+  N +  ++ P      +  G  V      G  RI  S  W
Sbjct: 41  GERCVIESADGDRIDAQVVGFNREETFLMPFKKPVGLVAGAQVLSCERQGLLRIGRS--W 98

Query: 102 CGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHG 161
            GR++N LG+ IDG  SLG GD  +         + ++ V      G+R I+    L  G
Sbjct: 99  LGRIVNGLGEAIDGRGSLG-GDAVLRAHPAPVNPLRKRPVRDVLDVGVRAINGLLTLGRG 157

Query: 162 QRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVV 220
           QRIG+ AGSG+GKS LL M  R+   D V++ L+GERGREVREF++  LG+  L KSV+V
Sbjct: 158 QRIGLMAGSGVGKSMLLGMITRATQADVVVVGLIGERGREVREFVDHALGEAGLAKSVLV 217

Query: 221 VATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVAR 280
            A +DESP++R  A      IA +F   G NVLL++DS+TR+A + REIA + GE P  R
Sbjct: 218 AAPADESPLMRLKAAELCHAIAAHFRDTGANVLLLVDSLTRYAMAQREIALSVGEPPATR 277

Query: 281 GYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNR 340
           GYP SVF  LP+L+E  G  E   G+++A+ +VL +GD+ NDP+ D+ R+ILDGHIVL R
Sbjct: 278 GYPPSVFGMLPQLVETAGNGEG-AGSMSAIYTVLAEGDDQNDPVVDTARAILDGHIVLTR 336

Query: 341 SLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVD 400
            LAE G YP +D   SVSR   +   A+   L   +  +I R E+ RD+  +GGY  G D
Sbjct: 337 ELAERGHYPAIDVPRSVSRCMSQVAGAEHGALARKVKEMIGRHEQIRDLIALGGYVQGAD 396

Query: 401 LILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKL 437
              D+AV +   I  FL+Q   D++  D      K+L
Sbjct: 397 PATDEAVAKAARIDTFLRQDMLDVARHDATLAALKEL 433


>gi|15834665|ref|NP_296424.1| type III secretion system ATPase [Chlamydia muridarum Nigg]
 gi|270284830|ref|ZP_06194224.1| type III secretion system ATPase [Chlamydia muridarum Nigg]
 gi|270288859|ref|ZP_06195161.1| type III secretion system ATPase [Chlamydia muridarum Weiss]
 gi|301336210|ref|ZP_07224412.1| type III secretion system ATPase [Chlamydia muridarum MopnTet14]
 gi|7190080|gb|AAF38931.1| type III secretion cytoplasmic ATPase SctN [Chlamydia muridarum
           Nigg]
          Length = 442

 Score =  276 bits (705), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 161/386 (41%), Positives = 239/386 (61%), Gaps = 16/386 (4%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSL 119
           +V+    + V++ P+G    +S    V   G    I   A   GRV+N LG+PID +   
Sbjct: 61  EVVGFTQNFVFLSPLGELSGVSPSSEVIATGLPLHIRAGAGLLGRVLNGLGEPIDIET-- 118

Query: 120 GKGDL----SMEIMSKVPP-AMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGK 174
            KG L    S+  + K PP  ++R+++     TG+R ID    +  GQRIG+FAG+G+GK
Sbjct: 119 -KGPLENVDSIYPIFKAPPDPLHREKLRTILSTGVRCIDGMLTVAKGQRIGIFAGAGVGK 177

Query: 175 STLLSMFAR-SDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRK 232
           S+LL M AR ++  D  +I+L+GERGREVREFIE+ LG+  +K+SV+VV+TSD+S  LR 
Sbjct: 178 SSLLGMIARNAEEADINVIALIGERGREVREFIENDLGEEGMKRSVIVVSTSDQSSQLRL 237

Query: 233 MAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPR 292
            A      IAEYF  +G  V+L++DS+TRFA ++RE+   +GE P   GY  SVFS LP+
Sbjct: 238 NAAYVGTAIAEYFRDQGKTVVLMMDSVTRFARALREVGLAAGEPPARAGYTPSVFSTLPK 297

Query: 293 LLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVD 352
           LLER G S  EKG ITA  +VLV GD+ N+P+AD V+SILDGHIVL+ +LA+   YP +D
Sbjct: 298 LLERAGAS--EKGTITAFYTVLVAGDDMNEPVADEVKSILDGHIVLSNALAQAYHYPAID 355

Query: 353 PLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPI 412
            LAS+SRL       ++++++     ++ +++    +  IG YR G D  +D A+  +  
Sbjct: 356 VLASISRLLTAIVPEEQRRIIGRAREVLAKYKANEMLIRIGEYRRGSDREVDFAIDHIDK 415

Query: 413 IYDFLKQSPSDLSSEDVFQEITKKLQ 438
           +  FLKQ   D+  +  ++E  ++L+
Sbjct: 416 LNRFLKQ---DIHEKTNYEEAAQQLR 438


>gi|171915738|ref|ZP_02931208.1| type III secretion system ATPase [Verrucomicrobium spinosum DSM
           4136]
          Length = 444

 Score =  276 bits (705), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 157/385 (40%), Positives = 227/385 (58%), Gaps = 16/385 (4%)

Query: 59  LGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRF-RISPSACWCGRVINALGKPIDGDD 117
           + +V+    ++V + P+G  E IS    V   G   R+       GRV++ LG P DG  
Sbjct: 65  MAEVVGFAKNLVLLTPLGELEGISSSTEVTPTGEVHRVPVGPAMLGRVLDGLGNPSDG-- 122

Query: 118 SLGKGDLSME----IMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIG 173
              KG + +E    + +  P AM RQ +      G+R +D       GQR+G+FA +G G
Sbjct: 123 ---KGPIEIEEYYAVTADPPNAMTRQLISTPIHLGVRALDGLLTCGEGQRMGIFAAAGGG 179

Query: 174 KSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRK 232
           KSTLLS   R+   D V++SL+GERGREVREF+E  LG D +K++V V+ATSD   + R 
Sbjct: 180 KSTLLSQIIRNTEADIVVLSLIGERGREVREFLERDLGEDGVKRAVTVIATSDRPAMERL 239

Query: 233 MAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPR 292
                A  IAEYF  KG  VLL++DS+TRFA ++REI   +GE P  RG+P SVF+ LP+
Sbjct: 240 KCAYVATAIAEYFRDKGRKVLLLMDSVTRFARALREIGLAAGEPPTRRGFPPSVFATLPK 299

Query: 293 LLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVD 352
           ++ER G S    G+ITA+ +VLV+GD+  +P+AD  RSILDGHI+L+R L     YP +D
Sbjct: 300 MMERAGCSAN--GSITALYTVLVEGDDMTEPVADETRSILDGHIILSRKLGSANHYPAID 357

Query: 353 PLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPI 412
            LASVSRL     + D ++    L +L+ +++E   +  IG Y+ G D   D+A+ +V  
Sbjct: 358 VLASVSRLMTAIATPDHQRAAGKLRNLLAKYQEVELLVRIGEYKKGSDASSDEAIAKVDA 417

Query: 413 IYDFLKQSPSDLSSEDVFQEITKKL 437
           I +FLKQ    L  +  F++  + +
Sbjct: 418 INNFLKQG---LREQSTFEQTLQAM 439


>gi|168187563|ref|ZP_02622198.1| flagellar protein export ATPase FliI [Clostridium botulinum C str.
           Eklund]
 gi|169294576|gb|EDS76709.1| flagellar protein export ATPase FliI [Clostridium botulinum C str.
           Eklund]
          Length = 438

 Score =  276 bits (705), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 171/427 (40%), Positives = 247/427 (57%), Gaps = 19/427 (4%)

Query: 15  YSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICP 74
           Y++ LV Q   +  +T     +      VC     ++  +N   + +V+    D V + P
Sbjct: 21  YTEGLVKQ---VIGLTIEVEGIKAFVGEVC----TIYNKENEPIMCEVVGFKEDNVILMP 73

Query: 75  VGIGEEISLGD---LVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSK 131
             +GE I +G    +V       +  S    G+V+N LGKP++ ++ L  G +   + + 
Sbjct: 74  --LGELIGIGPGCRVVPSKKYLSVKCSEKLLGKVLNGLGKPLNVEEKLPLG-IDYPLDTA 130

Query: 132 VPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVI 191
            P  + R+R++    TG+R ID F     GQRIG+FAGSG+GKST L M AR    D  +
Sbjct: 131 PPDPLRRRRIKDEIATGVRAIDGFLTCGEGQRIGIFAGSGVGKSTTLGMIAREAKADINV 190

Query: 192 ISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGD 250
           I+L+GERGREV +FIE  LG+  LKKSV+V ATSD+  ++R     TA  IAEYF  KG 
Sbjct: 191 IALIGERGREVLDFIEKDLGEEGLKKSVIVCATSDQPALVRLKGAFTATAIAEYFRDKGK 250

Query: 251 NVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAV 310
            V+L++DS+TRFA + RE+    GE P  +GY  SVF+ LPRL+ER G S+K  G+ITA 
Sbjct: 251 KVILMMDSVTRFAMAQREVGLAIGEPPATKGYTPSVFAMLPRLMERSGMSDK--GSITAF 308

Query: 311 ISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEK 370
            +VLVDGD+ N+PIAD+VR ILDGHIVL+R+LA +  YP +D L SVSRL  +    + K
Sbjct: 309 YTVLVDGDDFNEPIADAVRGILDGHIVLSRALAGKNHYPAIDILNSVSRLMSEIAKDEHK 368

Query: 371 KLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVF 430
           K  S    L+  ++ + D+  IG Y  G +  +D A+     + ++L+Q   + S    F
Sbjct: 369 KAASKARDLLATYKNSEDLINIGAYVKGSNPKVDMAIQYNDKLNEYLRQGIKEHSE---F 425

Query: 431 QEITKKL 437
           QE   +L
Sbjct: 426 QESVTRL 432


>gi|293408356|ref|ZP_06652195.1| flagellar protein export ATPase FliI [Escherichia coli B354]
 gi|291471534|gb|EFF14017.1| flagellar protein export ATPase FliI [Escherichia coli B354]
          Length = 445

 Score =  276 bits (705), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 155/383 (40%), Positives = 224/383 (58%), Gaps = 13/383 (3%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFR-ISPSACWCGRVINALGKPIDGDDSL 119
           Q +  N DI Y+ P      +  G  VF   +   I     W GRV+N LG+P+DG   L
Sbjct: 60  QAVGFNRDITYLMPFKQPVGLMAGARVFPEEKAHDILIGESWLGRVVNGLGEPLDGKGRL 119

Query: 120 GKGDLSMEIMSKVPPAMN---RQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKST 176
              DL    +  +PP++N   R+ V++    G++ I+    +  GQR+G+ AGSG+GKS 
Sbjct: 120 NGNDL----LPPLPPSVNPLTRRSVDEPLDVGVKAINGLLTIGKGQRVGLMAGSGVGKSV 175

Query: 177 LLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAP 235
           LL M  R    D V++ L+GERGREV+EFI+  LG D L KS+VVVA +DESP++R  A 
Sbjct: 176 LLGMITRQTKADIVVVGLIGERGREVKEFIDHSLGADGLAKSIVVVAPADESPLMRLKAT 235

Query: 236 LTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLE 295
               +IA +F  +G +VLL++DS+TR+A + REIA + GE P  +GYP S F  +P+L+E
Sbjct: 236 ELCHSIAAWFRDRGHHVLLLVDSLTRYAMAQREIALSLGEPPATKGYPPSAFGMIPKLVE 295

Query: 296 RIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLA 355
             G SE   G++TA+ +VL +GD+  DPI D  R++LDGHIVL R LAE G YP +D   
Sbjct: 296 SAGNSESS-GSMTAIYTVLAEGDDQQDPIVDCARAVLDGHIVLTRKLAEAGHYPAIDIGQ 354

Query: 356 SVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYD 415
           S+SR  ++  S D ++   +L      + E + +  +GGY  G D  +DKAV   P I  
Sbjct: 355 SISRCMNQVTSLDHQQSARALKQNYAAYMEIKPLIPLGGYVAGADASVDKAVKMFPAIER 414

Query: 416 FLKQSPSDLSSEDVFQEITKKLQ 438
           FL+Q   D+      + +  +LQ
Sbjct: 415 FLRQ---DMREPAALELVQSRLQ 434


>gi|78778279|ref|YP_394594.1| flagellum-specific ATP synthase [Sulfurimonas denitrificans DSM
           1251]
 gi|78498819|gb|ABB45359.1| ATPase FliI/YscN [Sulfurimonas denitrificans DSM 1251]
          Length = 436

 Score =  275 bits (704), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 168/425 (39%), Positives = 239/425 (56%), Gaps = 7/425 (1%)

Query: 16  SKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFV--VHQGKNSDNLGQVIRINLDIVYIC 73
           +K   V  G +  I +   T   LS  V + D V  +      + +G V  I+  I +I 
Sbjct: 12  NKKYSVAFGEVVKINATVITARGLS--VSISDIVKIISNESAQETIGMVTEIDGLIFFIT 69

Query: 74  PVGIGEEISLGDLVF-HWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKV 132
           P    E    GD VF       I  S+   GRV++   +PIDG  S+    LS  I + +
Sbjct: 70  PFSFVEGFRSGDRVFLDQTGLNIPVSSSLLGRVVDPFMRPIDGKGSINDSKLSPIIKAPI 129

Query: 133 PPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVII 192
             AM R  +++ F  G++ ID       GQ++G+FAGSG+GKSTL+ M  R       ++
Sbjct: 130 A-AMKRGMIDEIFSVGVKSIDGLLTCGKGQKLGIFAGSGVGKSTLMGMIVRGANAPIKVV 188

Query: 193 SLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNV 252
           +L+GERGREV EFIE  LG NL+ +V+VVATSD+SP++RK     A+++AE+F  +G +V
Sbjct: 189 ALIGERGREVPEFIEKNLGGNLENTVIVVATSDDSPLMRKYGAFAAMSVAEFFKDQGLDV 248

Query: 253 LLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVIS 312
           L I+DS+TRFA + REI    GE P ++GYP S  + LP+L+ER G  E+ KG+ITA  +
Sbjct: 249 LFIMDSVTRFAMAQREIGLALGEPPTSKGYPPSSLTLLPQLMERAG-KEEGKGSITAFFT 307

Query: 313 VLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKL 372
           VL++GD+  DPIAD  RSILDGHIVL+R + + G YPPV  L S SR+ +   + +  + 
Sbjct: 308 VLIEGDDMGDPIADQSRSILDGHIVLSREMTDFGIYPPVHILNSASRVMNDIITPEHLRA 367

Query: 373 VSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQE 432
           V     L    +E   +  IG Y  G D  LD+A+ +   +  FL Q+ S  S  D   E
Sbjct: 368 VQKFRRLYTLLKENEVLIRIGAYTKGSDSELDEAMAKKSEMEKFLMQNSSTQSDFDETVE 427

Query: 433 ITKKL 437
              KL
Sbjct: 428 TLLKL 432


>gi|119469988|ref|ZP_01612793.1| flagellum-specific ATP synthase [Alteromonadales bacterium TW-7]
 gi|119446698|gb|EAW27971.1| flagellum-specific ATP synthase [Alteromonadales bacterium TW-7]
          Length = 444

 Score =  275 bits (704), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 144/332 (43%), Positives = 211/332 (63%), Gaps = 6/332 (1%)

Query: 100 CWCGRVINALGKPIDGDDSLGK--GDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTP 157
              GRV++ LG+P+DG   LGK   +  ++        + R+ + +    G+R I+    
Sbjct: 103 SLLGRVVDGLGRPLDG---LGKINAEHYLKFAQNTINPLARRPISQPMDVGVRAINSVIT 159

Query: 158 LCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD-NLKK 216
           +  GQR+G+FAGSG+GKS LL M  R    D +++ LVGERGREV+EFIE+ LG+   K+
Sbjct: 160 VGQGQRMGLFAGSGVGKSVLLGMMTRGSEADVIVVGLVGERGREVKEFIEEILGEEGRKR 219

Query: 217 SVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGEL 276
           SVVV A +D SP++R     +AVTIAEYF  +G NVLL+LDS+TR+A + REIA   GE 
Sbjct: 220 SVVVAAPADSSPLMRLKGCESAVTIAEYFRDQGLNVLLLLDSVTRYAMAQREIALAVGEP 279

Query: 277 PVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHI 336
           P  +GYP SVF++LP L+ER G   + +G ITA  +VL +GD+  DPIAD+ R+ILDGHI
Sbjct: 280 PATKGYPPSVFAKLPALVERAGNGGEGQGAITAFFTVLSEGDDMQDPIADAARAILDGHI 339

Query: 337 VLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYR 396
           VL+R LA+ G YP +D   S+SR+  +  S    +    L  +   +++ +D+  +G Y+
Sbjct: 340 VLSRELADSGHYPAIDIEKSISRVMPQVVSEPHMQQARVLKQVYSMYQQNKDMITLGAYQ 399

Query: 397 PGVDLILDKAVHQVPIIYDFLKQSPSDLSSED 428
            G D +LD+A++ +P +  FL+Q   D+ S D
Sbjct: 400 KGTDPMLDQAINMMPRVNGFLQQGMRDVISYD 431


>gi|288553062|ref|YP_003424997.1| flagellum-specific ATP synthase [Bacillus pseudofirmus OF4]
 gi|288544222|gb|ADC48105.1| flagellum-specific ATP synthase [Bacillus pseudofirmus OF4]
          Length = 435

 Score =  275 bits (704), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 152/362 (41%), Positives = 226/362 (62%), Gaps = 5/362 (1%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSL 119
           +V+    + V + P+   +EI+ G LV   G    I   +   G+V++  G+ +D    L
Sbjct: 58  EVVGFRDEYVLLMPLNGIQEIAPGSLVEATGSPLEIKVGSGLIGKVVDGCGELLD-QQKL 116

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
            KG  S    ++ P  + R R+E     G+R ID    +  GQRIG+FAGSG+GKSTLL+
Sbjct: 117 PKGLTSFPTDNEPPNPLKRPRIEHAMSLGVRAIDSLFTVGKGQRIGIFAGSGVGKSTLLA 176

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTA 238
           M A++   D  +I+L+GERGREV++FIE  LG + L ++++VVATSD+  ++R    +TA
Sbjct: 177 MLAKNSSADLNVIALIGERGREVKDFIERDLGAEGLSRTILVVATSDQPALMRIKGAMTA 236

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
             IAEYF ++G +V L++DS+TRFA + RE+   +GE P  +GY  SVF+ LP+LLER G
Sbjct: 237 TAIAEYFRNQGLDVNLMMDSVTRFAMAQREVGLATGEPPTTKGYTPSVFAMLPKLLERSG 296

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
                KG+ITA  +VLVDGD+ N+PIAD+VR ILDGH+VL+R LA +G++P ++ L SVS
Sbjct: 297 --TDAKGSITAFYTVLVDGDDMNEPIADAVRGILDGHLVLDRKLANKGQFPAINVLKSVS 354

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+     +   K+    +  LI  +EE  D+  IG Y+ G    +D+A+   P I +FL 
Sbjct: 355 RVMSDLVNPIHKQAAERVRKLIATYEEAEDLINIGAYKRGSSKEIDEAIQAYPAIIEFLT 414

Query: 419 QS 420
           Q+
Sbjct: 415 QA 416


>gi|254445953|ref|ZP_05059429.1| flagellar protein export ATPase FliI [Verrucomicrobiae bacterium
           DG1235]
 gi|198260261|gb|EDY84569.1| flagellar protein export ATPase FliI [Verrucomicrobiae bacterium
           DG1235]
          Length = 440

 Score =  275 bits (704), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 156/356 (43%), Positives = 222/356 (62%), Gaps = 5/356 (1%)

Query: 85  DLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKG 144
           D+    G  +I       GRV++ +G+PIDG   +   D    +  KVP  + R+R+   
Sbjct: 88  DVKLSSGFNKIPSGNEVLGRVVDGMGRPIDGIGPMHYQDPG-SMTGKVPNPLLRKRITVP 146

Query: 145 FKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVRE 204
           F TG++ ID+F+P+  GQR+GVFAGSG+GKSTLL M AR    D  +I+LVGERGRE+RE
Sbjct: 147 FNTGVKAIDLFSPVGEGQRMGVFAGSGVGKSTLLGMLARGSNADVNVIALVGERGRELRE 206

Query: 205 FIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFA 263
           FIE  LG + + ++VVVVATSD+S  +R  A   A +IAE F   G  VL ++DS+TRFA
Sbjct: 207 FIEKDLGPEGMARTVVVVATSDQSAPMRLRAANMATSIAENFRDSGKRVLFLMDSVTRFA 266

Query: 264 HSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDP 323
            + REI    GE P +RGY  SVFS LPRLLER G S  +KG ITA  +VLV+GD+ N+P
Sbjct: 267 MAQREIGLAVGEPPASRGYTPSVFSTLPRLLERSGNS--DKGTITAFYTVLVEGDDLNEP 324

Query: 324 IADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRF 383
           IAD+VR ILDGHIVL+R LA    +P +D L S+SRL +   + +E          +  +
Sbjct: 325 IADAVRGILDGHIVLSRQLATANHFPAIDVLESISRLRNDISTEEELATAGLARDYLALY 384

Query: 384 EETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSD-LSSEDVFQEITKKLQ 438
            +  DI  +G Y  G +  +D A+     + ++LKQS ++ +  E+ +Q++ + ++
Sbjct: 385 RKNEDIVNLGAYVRGANQKIDAAIIANERVMNYLKQSYTECVPREECYQKLAELIR 440


>gi|77918793|ref|YP_356608.1| flagellum-specific ATP synthase FliI [Pelobacter carbinolicus DSM
           2380]
 gi|77544876|gb|ABA88438.1| type III secretion system ATPase, FliI/YscN [Pelobacter
           carbinolicus DSM 2380]
          Length = 433

 Score =  275 bits (704), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 150/322 (46%), Positives = 209/322 (64%), Gaps = 3/322 (0%)

Query: 103 GRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQ 162
           GRVI+A+G+PID D  L   +  M + +     M R  ++     GIR I+       GQ
Sbjct: 98  GRVIDAMGQPID-DGPLPVRETDMPLYALPAGPMERDTIDTPLDLGIRAINGLLTCGQGQ 156

Query: 163 RIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVV 221
           R+G+ AGSG+GKSTLL M A++   D  +I+L+GERGREVREFIE  LG + L +SVV+V
Sbjct: 157 RMGIMAGSGVGKSTLLGMIAQNTQADVNVIALIGERGREVREFIERDLGPEGLARSVVIV 216

Query: 222 ATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARG 281
           ATSD+SP+LR      A T+AEYFSS+G NVLL++DS+TRFA ++RE+    GE P  +G
Sbjct: 217 ATSDQSPLLRMRGAFVATTVAEYFSSQGLNVLLMMDSVTRFAMAMREVGLAIGEPPTTKG 276

Query: 282 YPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRS 341
           Y  SVF+ LP+LLER G S +  G+IT + +VLV+GD+ N+PIAD+VRSILDGHIVL+R 
Sbjct: 277 YTPSVFATLPKLLERAG-SFRNSGSITGLYTVLVEGDDMNEPIADAVRSILDGHIVLSRR 335

Query: 342 LAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDL 401
           LA +  YP +D L S SR+ +       + L   L  ++  +EE  D+  IG Y+ G + 
Sbjct: 336 LAAKNHYPCIDILHSASRVMNAVVDPGHQDLAGRLREILATYEEAEDLINIGAYKKGSNP 395

Query: 402 ILDKAVHQVPIIYDFLKQSPSD 423
            +D A+  +  +  FL+Q  S+
Sbjct: 396 KIDTALSHIDNVLRFLRQRVSE 417


>gi|194292869|ref|YP_002008776.1| flii: flagellar biosynthesis protein; flagellum-specific ATP
           synthase [Cupriavidus taiwanensis LMG 19424]
 gi|193226773|emb|CAQ72724.1| FliI: Flagellar Biosynthesis protein; flagellum-specific ATP
           synthase [Cupriavidus taiwanensis LMG 19424]
          Length = 502

 Score =  275 bits (704), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 152/333 (45%), Positives = 209/333 (62%), Gaps = 8/333 (2%)

Query: 91  GRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIM---SKVPPAMNRQRVEKGFKT 147
           G  R+   A   GRV++A G+P+DG   LG    +ME+     ++ P M R  +E    T
Sbjct: 140 GSKRLPVGAGLLGRVLDAAGRPLDG---LGPLAAAMEVPLAGEQINPLM-RAPIETVLDT 195

Query: 148 GIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIE 207
           G+R I+    +  GQR+G+FAGSG+GKS LL M AR    D +++ L+GERGREV+EFIE
Sbjct: 196 GVRAINGMLTVGRGQRMGLFAGSGVGKSVLLGMMARYTSADVIVVGLIGERGREVKEFIE 255

Query: 208 DYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSI 266
           + LG +  ++SVVV A +D SP+LR      A  +AEYF  +G +VLLI+DS+TR+A + 
Sbjct: 256 NILGPEGRRRSVVVAAPADCSPLLRMQGAAYATRLAEYFRDQGQHVLLIMDSLTRYAMAQ 315

Query: 267 REIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIAD 326
           REIA   GE P  +GYP SVF++LP L+ER G   +  G+ITA  +VL +GD+  DPIAD
Sbjct: 316 REIALAIGEPPATKGYPPSVFAKLPTLVERTGNGPEGGGSITAFYTVLTEGDDQQDPIAD 375

Query: 327 SVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEET 386
           S R+ILDGHIVL+RSLAE G YP +D  AS+SR        ++   V     L+ R++  
Sbjct: 376 SARAILDGHIVLSRSLAEAGHYPAIDVEASISRAMTALIPHEQFGSVRRFKQLMSRYQRN 435

Query: 387 RDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
           RD+  +G Y PG D  LD A+   P +  FL+Q
Sbjct: 436 RDLISVGAYVPGNDPELDLAIQLHPRMEAFLQQ 468


>gi|157147117|ref|YP_001454436.1| hypothetical protein CKO_02894 [Citrobacter koseri ATCC BAA-895]
 gi|157084322|gb|ABV14000.1| hypothetical protein CKO_02894 [Citrobacter koseri ATCC BAA-895]
          Length = 439

 Score =  275 bits (704), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 150/365 (41%), Positives = 215/365 (58%), Gaps = 4/365 (1%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFR-ISPSACWCGRVINALGKPIDGDDSL 119
           QV+  + D+ Y+ P      +  G  VF  G+   +     W GRV+N LG+P+D    L
Sbjct: 59  QVVGFDRDVTYLMPFKHPSGLIAGARVFPAGKTEGVMIGDQWLGRVVNGLGEPLDNKGKL 118

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
           G   L  + + +V P + RQ V      G+R I+    +  GQR+G+ AGSG+GKS LL 
Sbjct: 119 GGDTLLAQQLPQVHP-LKRQPVHAPLDVGVRAINGLLTIGKGQRVGLMAGSGVGKSVLLG 177

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYL-GDNLKKSVVVVATSDESPILRKMAPLTA 238
           M  R    + V++ L+GERGREV+EFIE+ L  + L KSV+V A +DESP++R  A    
Sbjct: 178 MITRYTRAEVVVVGLIGERGREVKEFIENALQAEGLAKSVIVAAPADESPLMRIKATELC 237

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
            TIA Y+  KG +VLL++DS+TR+A + REIA + GE P  +GYP S F  +PRL+E  G
Sbjct: 238 HTIASYYRDKGKDVLLLVDSLTRYAMAQREIALSLGEPPATKGYPPSAFGMIPRLVESAG 297

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
            SE E G++TA+ +VL +GD+  DPI D  R++LDGHIVL+R LAE G YP +D   S+S
Sbjct: 298 NSESE-GSMTAIYTVLAEGDDQQDPIVDCARAVLDGHIVLSRHLAEAGHYPAIDVGQSIS 356

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R   +    + +    +L  L   ++  + +  +GGY  G D + D+AV   P I  FL+
Sbjct: 357 RCMSQVTEREHQLAARTLKQLYAEYQSIKPLIPLGGYVAGADPLADRAVRLSPAINQFLQ 416

Query: 419 QSPSD 423
           Q   D
Sbjct: 417 QEVQD 421


>gi|160902822|ref|YP_001568403.1| flagellar protein export ATPase FliI [Petrotoga mobilis SJ95]
 gi|160360466|gb|ABX32080.1| flagellar protein export ATPase FliI [Petrotoga mobilis SJ95]
          Length = 442

 Score =  275 bits (704), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 172/419 (41%), Positives = 252/419 (60%), Gaps = 16/419 (3%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNL-GQVIRINLDIVYICPVGIGEEIS 82
           G IS I  V  T+  +   V LGD    + K+   +  + +  + + V + P+     I 
Sbjct: 27  GKISRIVGV--TIESIGPSVALGDLCRIKLKDGSKIFAETVGFSDNKVLLMPLEDVSGIY 84

Query: 83  LGDLVFHW-GRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRV 141
           +G  V     +  +  S+   G V++ LG+ +DG  S  K   S  I    P  + R R+
Sbjct: 85  VGAPVERVDSKINVKISSDLLGHVLDGLGRSMDG--SKVKSYESKSIYRSAPNPLLRNRI 142

Query: 142 EKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGRE 201
           ++    G+R ID F  L  GQRIG+ AGSG+GKSTLL M AR+   D  +I L+GERGRE
Sbjct: 143 KEPLSVGVRAIDAFLTLGKGQRIGIMAGSGVGKSTLLGMIARNTEADINVIGLIGERGRE 202

Query: 202 VREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSIT 260
           V++FIE  LG+  LKKSV++V+TSD   +LR  A  TA TIAEYF   G NVL+++DSIT
Sbjct: 203 VKDFIEKDLGEEGLKKSVLIVSTSDSPALLRVKALYTATTIAEYFRDLGYNVLMMVDSIT 262

Query: 261 RFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNH 320
           R+A + REI  + GE P  RGY  SVF+ +P++LER G S  +KG++TA+ +VLV+ D+ 
Sbjct: 263 RWAMAQREIGLSIGEPPTTRGYTPSVFANMPKILERAGNS--QKGSMTAIYTVLVEADDM 320

Query: 321 NDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSL--TH 378
           NDPI D+VRSI+DGHIVL+RSLA+   YPP+D L+SVSRL  +    DEK L +++    
Sbjct: 321 NDPIGDAVRSIVDGHIVLSRSLADSSHYPPIDILSSVSRLMKEV--VDEKHLKAAMFIRD 378

Query: 379 LIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKL 437
           +   +  ++D+  +G Y+ G +  +D A+ ++  I +FL Q    +  +  F++  KKL
Sbjct: 379 IYASYMNSKDLIEVGAYKKGSNKKVDIALEEIENINNFLTQR---IEEKAPFEQTLKKL 434


>gi|119715003|ref|YP_921968.1| FliI/YscN family ATPase [Nocardioides sp. JS614]
 gi|119535664|gb|ABL80281.1| type III secretion system ATPase, FliI/YscN [Nocardioides sp.
           JS614]
          Length = 435

 Score =  275 bits (704), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 166/405 (40%), Positives = 242/405 (59%), Gaps = 9/405 (2%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISL 83
           G +  +  +  TV+ +S    LGD +  QG       +V+     ++   P+G    + +
Sbjct: 22  GRVVGLLGLRVTVSGVS--AALGDLLEVQGLTGPVPVEVVASGDGMLTCLPLGDTTGLRV 79

Query: 84  GDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPA-MNRQRV 141
           GD V + G   RI       GRV++ LG+P+D  D     DL   ++  +PPA ++R R+
Sbjct: 80  GDHVVNHGEGLRIPVGEALRGRVLDGLGRPMD--DGPALDDLPTVVVDNLPPAALSRPRI 137

Query: 142 EKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGRE 201
           ++    G+R +D       GQR+G+ AGSG+GKS+LLSM AR    +  +I+L+GERGRE
Sbjct: 138 DQQLGLGVRAMDALISCGRGQRLGIMAGSGVGKSSLLSMIARGTDAEISVIALIGERGRE 197

Query: 202 VREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSIT 260
           VREF+E+ LG   L++S+VVVATSDE P++R  A   A  IAE+F   G +V+L++DS+T
Sbjct: 198 VREFLENDLGPAGLRRSIVVVATSDEPPVVRLRAAFVATRIAEWFRDSGRHVVLMMDSLT 257

Query: 261 RFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNH 320
           R A + REI  ++GE P  RG+P SVF+ LPRLLER G S   +G+IT + +VLV+GD+ 
Sbjct: 258 RVALAQREIGLSAGEPPATRGFPPSVFALLPRLLERAGTS--PEGSITGLYTVLVEGDDL 315

Query: 321 NDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLI 380
            DPI DS RSILDGH+VL+R LA  G +P +D L S+SR+A        +     L  L+
Sbjct: 316 QDPIGDSARSILDGHVVLSRDLATSGHFPSIDVLESISRVASAIIEPSGRADGIRLRRLL 375

Query: 381 HRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLS 425
             +   R++  IG Y  G D   D A+  +P I DFL+Q  SD++
Sbjct: 376 AAYRSVRELVEIGAYVAGSDADADDALALMPRINDFLRQDMSDVT 420


>gi|225619607|ref|YP_002720864.1| flagellar biosynthesis/type III secretory pathway ATPase
           [Brachyspira hyodysenteriae WA1]
 gi|225214426|gb|ACN83160.1| flagellar biosynthesis/type III secretory pathway ATPase
           [Brachyspira hyodysenteriae WA1]
          Length = 484

 Score =  275 bits (704), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 165/395 (41%), Positives = 237/395 (60%), Gaps = 20/395 (5%)

Query: 42  YVCLGDFV-VHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSAC 100
           +  LGD   ++   NS    + I      V +   G    I+ G++V+ + R    P + 
Sbjct: 50  FCKLGDMCRIYMNDNSYLDAEAIGFRNQDVLLATYGPVNGITFGNMVYSFER----PLSV 105

Query: 101 WC-----GRVINALGKPIDGDDSLGKGDLSMEI---MSKVPPAMNRQRVEKGFKTGIRVI 152
            C     G V++A GKP+ G    G       I    S V P MNR R+ K  +TG+R I
Sbjct: 106 MCCDEILGTVLDARGKPLAGG---GHNFYETPIPVSHSAVNP-MNRPRINKHIQTGVRAI 161

Query: 153 DIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD 212
           D    +  GQR+ + +G+G+GKSTLLSM AR+   D  +I+L+GER REVR+FIE  LG+
Sbjct: 162 DGLLTVGQGQRMAIMSGTGVGKSTLLSMIARNTNADVNVIALIGERRREVRDFIERDLGE 221

Query: 213 N-LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIAT 271
             LK+S++VVATSD++P+LR  A  TA TIAEYF  KG NV+ ++DS+TRFA + REI  
Sbjct: 222 EGLKRSILVVATSDDAPLLRVRAAYTATTIAEYFRDKGKNVMFMVDSVTRFALAQREIGL 281

Query: 272 NSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSI 331
           + GE P  RGY  SVFSEL +LLER G S   KG+ITA  +VLV+GD+ ++PI D+VR I
Sbjct: 282 SRGEPPTTRGYTPSVFSELAKLLERTGTS--SKGSITAFYNVLVEGDDLDEPITDAVRGI 339

Query: 332 LDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRL 391
           LDGHIVL+R LA  G +P +D   S+SR+ ++  S   K+       +   + E +++ +
Sbjct: 340 LDGHIVLSRDLANRGHFPAIDVNKSISRIMNEVVSNMHKRAAREFLKMSADYNEAKELIM 399

Query: 392 IGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
           IGGY  G    +D+A+   P++  +L+Q   ++SS
Sbjct: 400 IGGYAKGSMPEVDRAIDYKPMMDRYLQQDVYEVSS 434


>gi|57168630|ref|ZP_00367762.1| flagellum-specific ATP synthase [Campylobacter coli RM2228]
 gi|305432742|ref|ZP_07401902.1| flagellar protein export ATPase FliI [Campylobacter coli JV20]
 gi|57019911|gb|EAL56591.1| flagellum-specific ATP synthase [Campylobacter coli RM2228]
 gi|304444251|gb|EFM36904.1| flagellar protein export ATPase FliI [Campylobacter coli JV20]
          Length = 461

 Score =  275 bits (704), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 165/425 (38%), Positives = 240/425 (56%), Gaps = 12/425 (2%)

Query: 4   NLETL-AQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGD---FVVHQGKNSDNL 59
           NLE L ++L ++   NL    G I+ I++    +  L   V  GD    V ++ +N + L
Sbjct: 2   NLEKLRSKLGKE---NLSAVFGEITKISATSIEIRGLKTGV--GDIIKLVSNENENLNTL 56

Query: 60  GQVIRINLDIVYICPVGIGEEISLGDLVF-HWGRFRISPSACWCGRVINALGKPIDGDDS 118
             V+ I     Y+ P    E   +GD  F      +I  S    GRV++   +P DG  +
Sbjct: 57  AMVVEIKEQFSYLSPFSFIEGFKIGDRAFISDAGMQIGVSDELLGRVVDPFMRPKDGKGA 116

Query: 119 LGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLL 178
           + +    M IM     AM R  +E+ F  G++ ID       GQ++G+FAGSG+GKSTL+
Sbjct: 117 I-EATKYMPIMRAPIDAMKRGLIEEVFPVGVKTIDALLTCGVGQKLGIFAGSGVGKSTLM 175

Query: 179 SMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTA 238
            M  ++      +++L+GERGRE+ EFI+  LG  L  +V++VATSD+S ++RK     A
Sbjct: 176 GMIVKNSKAPIKVVALIGERGREIPEFIQKNLGGKLDDTVIIVATSDDSALMRKYGAFCA 235

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
           +++AEYF  +G +VL I+DS+TRFA + REI    GE P  +GYP SV S LP+L+ER G
Sbjct: 236 MSVAEYFKEQGKDVLFIMDSVTRFAMAQREIGLALGEPPTTKGYPPSVLSLLPQLMERTG 295

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
             E+ KG ITA  +VLVDGD+ +DPIAD  RSILDGHIVL+R L + G YPP++   S S
Sbjct: 296 -KEEGKGTITAFFTVLVDGDDMSDPIADQSRSILDGHIVLSRELTDFGIYPPINIQNSAS 354

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+     S + K        L    +E   +  IG Y+ G D  LD+A+ +   +  FL 
Sbjct: 355 RVMGDIISPEHKLWARKFKRLNSLLKENEVLLRIGAYQKGSDKELDEAIAKKEFMQKFLG 414

Query: 419 QSPSD 423
           Q+P +
Sbjct: 415 QNPEE 419


>gi|167567363|ref|ZP_02360279.1| flagellum-specific ATP synthase [Burkholderia oklahomensis EO147]
          Length = 435

 Score =  275 bits (704), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 167/380 (43%), Positives = 232/380 (61%), Gaps = 24/380 (6%)

Query: 61  QVIRINLDIVYICP----VGI--GEEISLGDLVFHWGRFRISPSACWCGRVINALGKPID 114
           QV+  N +  Y+ P    VG+  G ++   D     G  R+  +  W GRVIN LG+PID
Sbjct: 57  QVVGFNREESYLMPFKKPVGLVAGAQVLARD---RKGALRVGRA--WLGRVINGLGEPID 111

Query: 115 GDDSLGKGDLSMEIMSKVPPAMN--RQR-VEKGFKTGIRVIDIFTPLCHGQRIGVFAGSG 171
           G   LG GD   +++++ P A+N  R+R V      G+R I+    L  GQR+G+ AGSG
Sbjct: 112 GHGPLG-GD---QVLNEKPAAVNPLRKRAVRDVLDVGVRAINGALTLGKGQRVGLMAGSG 167

Query: 172 IGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATSDESPIL 230
           +GKS LL M  R+   D V++ L+GERGREVREF+E  LGD  L K+V+VVA +DESP++
Sbjct: 168 VGKSVLLGMMTRATAADVVVVGLIGERGREVREFVEHALGDEGLAKAVLVVAPADESPLM 227

Query: 231 RKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSEL 290
           R  A      IA ++   G +VLL++DS+TR+A + REIA + GE P  RGYP SVF  L
Sbjct: 228 RLRAAELCHAIAAHYRDAGSDVLLLVDSLTRYAMAQREIALSLGEPPATRGYPPSVFGML 287

Query: 291 PRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPP 350
           P+L+E  G  E   G+++A+ +VL +GD+ NDP+ D+ R+ILDGHIVL+R LAE G YP 
Sbjct: 288 PQLVETAGNGEG-SGSMSAIYTVLAEGDDQNDPVVDTARAILDGHIVLSRELAERGHYPA 346

Query: 351 VDPLASVSRLADKAWSADEKKLVSS--LTHLIHRFEETRDIRLIGGYRPGVDLILDKAVH 408
           +D   SVSR    A  AD + +V +  L  +I R E+ RD+  +GGY  G D   D+AV 
Sbjct: 347 IDVTRSVSRC--MAQIADARHVVRAGQLKEMIGRHEQVRDLIPLGGYVQGADAATDRAVA 404

Query: 409 QVPIIYDFLKQSPSDLSSED 428
               I  FL+Q   + +S D
Sbjct: 405 MAERIGAFLRQPMHEAASFD 424


>gi|118442915|ref|YP_877978.1| flagellum-specific ATP synthase [Clostridium novyi NT]
 gi|118133371|gb|ABK60415.1| flagellum-specific ATP synthase [Clostridium novyi NT]
          Length = 438

 Score =  275 bits (704), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 172/434 (39%), Positives = 250/434 (57%), Gaps = 19/434 (4%)

Query: 8   LAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINL 67
           +A+    Y++ LV Q   +  +T     +      VC     ++  +N   + +V+    
Sbjct: 14  IAKCDFKYTEGLVKQ---VIGLTIEVEGIKAFVGEVC----TIYNKENEPIMCEVVGFKE 66

Query: 68  DIVYICPVGIGEEISLG---DLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDL 124
           D V + P  +GE I +G    +V       +  S    G+V+N LGKP+  ++ L  G +
Sbjct: 67  DNVILMP--LGELIGIGPGCKVVPSKKYLSVKCSDDLLGKVLNGLGKPLKSEEELPIG-V 123

Query: 125 SMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARS 184
              + +  P  + R+R++    TG+R +D F     GQRIG+FAGSG+GKST L M AR 
Sbjct: 124 DYPLDTAPPDPLKRRRIKDEIATGVRAVDGFLTCGEGQRIGIFAGSGVGKSTTLGMIARE 183

Query: 185 DCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPLTAVTIAE 243
              D  +I+L+GERGREV +FIE  LG+  LKKSV+V ATSD+  ++R     TA  IAE
Sbjct: 184 AKADINVIALIGERGREVLDFIEKDLGEEGLKKSVIVCATSDQPALVRLKGAFTATAIAE 243

Query: 244 YFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKE 303
           YF  KG  V+L++DS+TRFA + RE+    GE P  +GY  SVF+ LPRL+ER G S+K 
Sbjct: 244 YFRDKGKKVILMMDSVTRFAMAQREVGLAIGEPPATKGYTPSVFAMLPRLMERSGMSDK- 302

Query: 304 KGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADK 363
            G+ITA  +VLVDGD+ N+PIAD+VR ILDGHIVL+R+LA +  YP +D L SVSRL  +
Sbjct: 303 -GSITAFYTVLVDGDDFNEPIADAVRGILDGHIVLSRALAGKNHYPAIDILNSVSRLMSE 361

Query: 364 AWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSD 423
             + + KK  S    L+  ++ + D+  IG Y  G +  +D A+     + D+L+Q   +
Sbjct: 362 IATDEHKKAASLARDLLATYKNSEDLINIGAYVRGSNPKVDMAIQYNDELNDYLRQGIKE 421

Query: 424 LSSEDVFQEITKKL 437
            S    FQE   +L
Sbjct: 422 HSE---FQESVTRL 432


>gi|255261477|ref|ZP_05340819.1| flagellum-specific ATP synthase [Thalassiobium sp. R2A62]
 gi|255103812|gb|EET46486.1| flagellum-specific ATP synthase [Thalassiobium sp. R2A62]
          Length = 461

 Score =  275 bits (703), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 161/405 (39%), Positives = 237/405 (58%), Gaps = 2/405 (0%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISL 83
           G++S I      +T LSQ+   GD +      S    +V++I    +     GI + I +
Sbjct: 23  GHVSEIFQDKIRITGLSQFARTGDILTVGLGESALRAEVVQIGKKDLVAMVDGITDRIQM 82

Query: 84  GDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEK 143
            D V + G  R+ PS  W GR+I+  G P+DG   L  G   + + +  P A  R+ +  
Sbjct: 83  NDSVAYDGVVRLHPSDHWKGRIIDPFGAPMDGK-HLMCGVNPINVRAAPPDASKRRPLGP 141

Query: 144 GFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVR 203
             +TG+   + F P+  GQR+G+FAGSG+GKSTLL M  +    D ++I LVGERGRE+ 
Sbjct: 142 RLETGLAAFNTFLPIVTGQRVGLFAGSGVGKSTLLGMMCQGIQADTIVIGLVGERGRELM 201

Query: 204 EFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRF 262
           EF+ + LG + L +SVVV ATSD++P  R+    TA+ +AEYF  +G NVLL+LDS+TRF
Sbjct: 202 EFVTNVLGQEGLARSVVVAATSDQAPQTRRRCAWTAMAVAEYFRDQGQNVLLLLDSVTRF 261

Query: 263 AHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHND 322
           A + RE+A   GE    RG+P S    +  L ER GP  + KG+ITAV SVLV G +  +
Sbjct: 262 AEAHREVAVAGGEDASLRGFPASTNHMITALCERAGPGPEGKGDITAVFSVLVAGSDMEE 321

Query: 323 PIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHR 382
           PIAD +R +LDGHIVL+R +AE GR+P +D   SVSR   +A +A++ KL+ +   L+  
Sbjct: 322 PIADMMRGVLDGHIVLDREIAERGRFPAIDLQRSVSRALPEAATAEQNKLLLAARKLLAT 381

Query: 383 FEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSE 427
           +  +  +   G Y  G D  +D ++   P I +FL  S  D++++
Sbjct: 382 YTRSEMMIQAGLYVSGSDPDIDASILAYPEIDNFLTLSGQDITAD 426


>gi|86149592|ref|ZP_01067822.1| flagellum-specific ATP synthase FliI [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|88597163|ref|ZP_01100398.1| flagellum-specific ATP synthase FliI [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|148926360|ref|ZP_01810044.1| flagellum-specific ATP synthase [Campylobacter jejuni subsp. jejuni
           CG8486]
 gi|218561874|ref|YP_002343653.1| flagellum-specific ATP synthase [Campylobacter jejuni subsp. jejuni
           NCTC 11168]
 gi|85839860|gb|EAQ57119.1| flagellum-specific ATP synthase FliI [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|88190224|gb|EAQ94198.1| flagellum-specific ATP synthase FliI [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|112359580|emb|CAL34364.1| flagellum-specific ATP synthase [Campylobacter jejuni subsp. jejuni
           NCTC 11168]
 gi|145844752|gb|EDK21857.1| flagellum-specific ATP synthase [Campylobacter jejuni subsp. jejuni
           CG8486]
 gi|284925487|gb|ADC27839.1| flagellum-specific ATP synthase [Campylobacter jejuni subsp. jejuni
           IA3902]
 gi|315928127|gb|EFV07445.1| flagellar protein export ATPase FliI [Campylobacter jejuni subsp.
           jejuni DFVF1099]
          Length = 461

 Score =  275 bits (703), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 165/425 (38%), Positives = 240/425 (56%), Gaps = 12/425 (2%)

Query: 4   NLETL-AQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGD---FVVHQGKNSDNL 59
           NLE L ++L ++   NL    G I+ I++    +  L   V  GD    V ++ +N + L
Sbjct: 2   NLEKLRSKLGKE---NLSAIFGEITKISATSIEIRGLKTGV--GDIVKLVSNENENLNTL 56

Query: 60  GQVIRINLDIVYICPVGIGEEISLGDLVF-HWGRFRISPSACWCGRVINALGKPIDGDDS 118
             V+ I     Y+ P    E   +GD  F      +I  S    GRV++   +P DG  +
Sbjct: 57  AMVVEIKEQFSYLSPFSFIEGFKIGDRAFISDAGMQIGVSDELLGRVVDPFMRPKDGKGA 116

Query: 119 LGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLL 178
           + +    M IM     AM R  +E+ F  G++ ID       GQ++G+FAGSG+GKSTL+
Sbjct: 117 I-EATKYMPIMRAPIDAMKRGLIEEVFPVGVKTIDALLTCGVGQKLGIFAGSGVGKSTLM 175

Query: 179 SMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTA 238
            M  ++      +++L+GERGRE+ EFI+  LG  L  +V++VATSD+S ++RK     A
Sbjct: 176 GMIVKNSKAPIKVVALIGERGREIPEFIQKNLGGKLDDTVIIVATSDDSALMRKYGAFCA 235

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
           +++AEYF  +G +VL I+DS+TRFA + REI    GE P  +GYP SV S LP+L+ER G
Sbjct: 236 MSVAEYFKEQGKDVLFIMDSVTRFAMAQREIGLALGEPPTTKGYPPSVLSLLPQLMERTG 295

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
             E+ KG ITA  +VLVDGD+ +DPIAD  RSILDGHIVL+R L + G YPP++   S S
Sbjct: 296 -KEEGKGTITAFFTVLVDGDDMSDPIADQSRSILDGHIVLSRELTDFGIYPPINIQNSAS 354

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+     S + K        L    +E   +  IG Y+ G D  LD+A+ +   +  FL 
Sbjct: 355 RVMSDIISPEHKLWARKFKRLNSLLKENEVLLRIGAYQKGSDKELDEAISKKEFMQKFLG 414

Query: 419 QSPSD 423
           Q+P +
Sbjct: 415 QNPEE 419


>gi|94500272|ref|ZP_01306805.1| flagellum-specific ATP synthase [Oceanobacter sp. RED65]
 gi|94427571|gb|EAT12548.1| flagellum-specific ATP synthase [Oceanobacter sp. RED65]
          Length = 469

 Score =  275 bits (703), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 168/425 (39%), Positives = 237/425 (55%), Gaps = 18/425 (4%)

Query: 4   NLETLAQLAE--DYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFV-VHQGKNSDNLG 60
            L+TL  +AE   +    VV G     +      V C    V +GD   V QG       
Sbjct: 10  KLKTLKWIAERHQFKSQPVVSGRLTRMVGLTLEAVGC---NVKVGDRCHVEQGSEFIE-A 65

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFH-WGRFRISPSACWCGRVINALGKPIDGDDSL 119
           QV+  + D  ++ PV     +S G  V        I       GRVIN  GKP+DG    
Sbjct: 66  QVVGFDEDKFFLMPVEPANSLSPGAKVTPILDSAEIPVGDMLLGRVINGAGKPLDG---- 121

Query: 120 GKGDL----SMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKS 175
            KGDL    ++ +   +   M R  + +    GIR I+    +  GQR+G+FAGSG+GKS
Sbjct: 122 -KGDLVSQNTLNLDGSIINPMQRAPIRQTMDVGIRAINGLLTVGRGQRMGLFAGSGVGKS 180

Query: 176 TLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATSDESPILRKMA 234
            LL M  R    D +++ LVGERGREV+EFI+D LG+  +K++VVV + +D+SP++R  A
Sbjct: 181 VLLGMMTRFSTADIIVVGLVGERGREVQEFIQDILGEEGMKRAVVVASPADDSPVMRMRA 240

Query: 235 PLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLL 294
              +  IAEYF  +G +VLL++DS+TR+  + REIA   GE P  +GYP SVF+++P+L+
Sbjct: 241 ADLSTAIAEYFRDEGKDVLLLMDSLTRYGQAQREIALAVGEPPATKGYPPSVFAKIPKLV 300

Query: 295 ERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPL 354
           ER G   +  G+ITA  +VL +GD+  DPIADS R+ILDGH+VL R LAEEG+YP +D  
Sbjct: 301 ERAGNGPEGGGSITAFYTVLTEGDDLQDPIADSARAILDGHVVLARRLAEEGQYPAIDIE 360

Query: 355 ASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIY 414
           AS+SR   +  S    +      HL   + +  D+  +G Y PG +  LD AV   PI+ 
Sbjct: 361 ASISRAMPQIVSKASLQNAQKFKHLYSLYRQNMDLISVGAYSPGNNPELDHAVRLHPIMR 420

Query: 415 DFLKQ 419
            F+ Q
Sbjct: 421 TFIMQ 425


>gi|261855057|ref|YP_003262340.1| flagellar protein export ATPase FliI [Halothiobacillus neapolitanus
           c2]
 gi|261835526|gb|ACX95293.1| flagellar protein export ATPase FliI [Halothiobacillus neapolitanus
           c2]
          Length = 465

 Score =  275 bits (703), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 143/355 (40%), Positives = 220/355 (61%), Gaps = 7/355 (1%)

Query: 70  VYICPVGIGEEISLGDLVFHWG---RFRISPSACWCGRVINALGKPIDGDDSLGKGDLSM 126
            Y+ P+     I+ G  V + G   R  + P     GRV++A G+P+D   ++  GD+ +
Sbjct: 92  TYLMPLEALRGIAPGCRVQNQGASIRMPLGPE--LLGRVLDARGQPLDDGPAI-FGDIPV 148

Query: 127 EIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDC 186
           ++  +    + R+ + +    G+R I+    +  GQR+G+FAGSG+GKS LL M  R   
Sbjct: 149 DLQGRSNNPLKRRPIREPLDVGVRAINALLTVGRGQRMGIFAGSGVGKSVLLGMMTRYTT 208

Query: 187 FDKVIISLVGERGREVREFIEDYLGDNLK-KSVVVVATSDESPILRKMAPLTAVTIAEYF 245
            + +++ L+GERGREVREF+ + L D  + +++V+ A +D SP++R      A  IAEYF
Sbjct: 209 AEIIVVGLIGERGREVREFVAEILDDEARSRAIVIAAPADASPLMRLHGASLATAIAEYF 268

Query: 246 SSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKG 305
             +G +VLL++DS+TR+A + REI    GE P  +GYP SVF+ LP L+ER G  E  +G
Sbjct: 269 REQGHDVLLLMDSLTRYAQAQREIGLAIGEPPATKGYPPSVFARLPALVERAGNGESARG 328

Query: 306 NITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAW 365
           ++TA  +VLV+GD+ NDPIAD+ R+ILDGHIVL+R++AE GRYP +D  AS+SRL     
Sbjct: 329 SMTAFYTVLVEGDDQNDPIADAARAILDGHIVLSRAIAERGRYPAIDIEASISRLMPALV 388

Query: 366 SADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQS 420
           S +   L+     L+  + ++RD+  +G YR G D+ LD+A+   P +  F+ QS
Sbjct: 389 SPEHLDLMQRFKQLMSTYNQSRDLLAVGAYRRGHDVRLDRAIDAQPDLEAFISQS 443


>gi|332305662|ref|YP_004433513.1| flagellar protein export ATPase FliI [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332172991|gb|AEE22245.1| flagellar protein export ATPase FliI [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 444

 Score =  275 bits (703), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 166/423 (39%), Positives = 243/423 (57%), Gaps = 17/423 (4%)

Query: 5   LETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIR 64
           LE +  L +   +  VV  G +  +  +  T+  +   + +G   + Q  + +   +V+ 
Sbjct: 6   LENIKALQQQVPQAPVVAAGKL--VRGIGLTLEAVGCQMPVGSQCLIQTVDGEIEAEVVG 63

Query: 65  INLDIVYICPVGIGEEISLGDLVFHWGRFRISP-SACWCGRVINALGKPIDGDDSLGKGD 123
               I Y+ P    + I  G  V    R +  P      GRV++  G+P+DG   LG   
Sbjct: 64  FAEHITYLMPTQAVKGIVPGSRVQPLNREQGLPVGMSLLGRVVDGNGQPLDG---LG--- 117

Query: 124 LSMEIMSKVP---PAMN---RQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
            +++   +VP   P MN   R+ + +    G+R I+    +  GQR+G+FAGSG+GKS L
Sbjct: 118 -AIKAEKRVPLTRPPMNPLSRKPIREPLDVGVRAINSMITVGSGQRMGLFAGSGVGKSVL 176

Query: 178 LSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPL 236
           L M  R    D V++ LVGERGREV+EFI+D LGD   +K+VVV A +D SP++R     
Sbjct: 177 LGMMTRGTSADVVVVGLVGERGREVKEFIQDILGDEERQKAVVVAAPADTSPLMRLKGCE 236

Query: 237 TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLER 296
           TAVTIAEYF  KG NVLL++DS+TR+A + REIA   GE P  +GYP SVF+ LP L+ER
Sbjct: 237 TAVTIAEYFRDKGMNVLLLVDSLTRYAMAQREIALAVGEPPATKGYPPSVFARLPALVER 296

Query: 297 IGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLAS 356
            G   + +G+ITA  +VL +GD+  DPIADS R+ILDGHIVL+R LA+ G YP +D  AS
Sbjct: 297 AGNGGENQGSITAFYTVLTEGDDLQDPIADSARAILDGHIVLSRQLADSGHYPAIDIEAS 356

Query: 357 VSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDF 416
           +SR+     S +  ++   +  +   +++ RD+  IG Y  G D  +D ++   P I  F
Sbjct: 357 ISRVMPMVVSPEHVQVARRIRQVYSTYQQNRDLISIGAYTRGNDPRIDLSIKAEPAINAF 416

Query: 417 LKQ 419
           L+Q
Sbjct: 417 LQQ 419


>gi|308173586|ref|YP_003920291.1| flagellar-specific ATPase [Bacillus amyloliquefaciens DSM 7]
 gi|307606450|emb|CBI42821.1| flagellar-specific ATPase [Bacillus amyloliquefaciens DSM 7]
 gi|328553482|gb|AEB23974.1| flagellum-specific ATP synthase [Bacillus amyloliquefaciens TA208]
 gi|328911727|gb|AEB63323.1| flagellar-specific ATPase [Bacillus amyloliquefaciens LL3]
          Length = 438

 Score =  275 bits (703), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 159/361 (44%), Positives = 221/361 (61%), Gaps = 5/361 (1%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSL 119
           +V+    + + + P      I+ G +V   G   RI   A   G+V++A G+P+DG  +L
Sbjct: 58  EVVGFQDENILLMPYLEAASIAPGSIVEATGESLRIKVGAGLIGQVVDAFGEPLDGR-AL 116

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
            KG   +      P  M R  + +    G+R ID    +  GQRIG+FAGSG+GKSTL+ 
Sbjct: 117 PKGLSPVSTEQPPPNPMKRPPIREKMGVGVRSIDSLLTVGKGQRIGIFAGSGVGKSTLMG 176

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPLTA 238
           M A+    D  II+LVGERGREVREFIE  LG+  LK+S+VVVATSD+  ++R  A  TA
Sbjct: 177 MIAKQTEADLNIIALVGERGREVREFIEKDLGEEGLKRSIVVVATSDQPALMRLKAAYTA 236

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
             IAEYF  KG NV+ ++DS+TR A + REI   +GE P  +GY  SVF+ LPRLLER G
Sbjct: 237 TAIAEYFRDKGRNVMFMMDSVTRVAMAQREIGLAAGEPPTTKGYTPSVFAILPRLLERTG 296

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
            +E+  G ITA  +VLVDGD+ N+PIAD+VR ILDGHIVL+R+LA +G++P V+ L S+S
Sbjct: 297 ANEQ--GTITAFYTVLVDGDDMNEPIADTVRGILDGHIVLDRALANKGQFPAVNILKSIS 354

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+          K  +    L+  ++ + D+  IG Y+ G    +D+A+   P +  FLK
Sbjct: 355 RVMSNISDPAHIKAANKFRDLLSTYQNSEDLINIGAYKRGSSREIDEAIQFYPQLIQFLK 414

Query: 419 Q 419
           Q
Sbjct: 415 Q 415


>gi|580859|emb|CAA39523.1| unnamed protein product [Bacillus subtilis subsp. subtilis str.
           168]
          Length = 440

 Score =  275 bits (703), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 153/361 (42%), Positives = 217/361 (60%), Gaps = 6/361 (1%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSL 119
           +V+    + + + P      I+ G +V   G   R+       G+VI+A G+P+D  +S 
Sbjct: 61  EVVGFQEENILLMPYLEAASIAPGSIVEATGESLRVKVGTGLIGQVIDAFGEPLD--ESF 118

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
            +    +      P  M R  + +    G+R ID    +  GQRIG+FAGSG+GKSTL+ 
Sbjct: 119 CRKVSPVSTEQSPPNPMKRPPIREKMGVGVRSIDSLLTVGKGQRIGIFAGSGVGKSTLMG 178

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTA 238
           M A+    D  +I+LVGERGREVREFIE  LG + LK+S+VVVATSD+  ++R  A  TA
Sbjct: 179 MIAKQTEADLNVIALVGERGREVREFIEKDLGKEGLKRSIVVVATSDQPALMRLKAAYTA 238

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
             IAEYF  KG NV+ ++DS+TR A + REI   +GE P  +GY  SVF+ LPRLLER G
Sbjct: 239 TAIAEYFRDKGQNVMFMMDSVTRVAMAQREIGLAAGEPPTTKGYTPSVFAILPRLLERTG 298

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
            +E   G ITA  +VLVDGD+ N+PIAD+VR ILDGHIVL+R+LA +G++P V+ L S+S
Sbjct: 299 ANEH--GTITAFYTVLVDGDDMNEPIADTVRGILDGHIVLDRALANKGQFPAVNVLKSIS 356

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+     +       +    L+  ++ + D+  IG Y+ G    +D+A+   P +  FLK
Sbjct: 357 RVMSNISTKQHLDAANKFRELLSTYQNSEDLINIGAYKRGSSREIDEAIQFYPQLIQFLK 416

Query: 419 Q 419
           Q
Sbjct: 417 Q 417


>gi|223040079|ref|ZP_03610360.1| flagellar protein export ATPase FliI [Campylobacter rectus RM3267]
 gi|222878665|gb|EEF13765.1| flagellar protein export ATPase FliI [Campylobacter rectus RM3267]
          Length = 434

 Score =  275 bits (703), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 166/434 (38%), Positives = 249/434 (57%), Gaps = 10/434 (2%)

Query: 4   NLETL-AQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFV--VHQGKNSDNLG 60
           NL++L ++L  + S + V   G I  I++    ++ L     +GD V    + K+   L 
Sbjct: 2   NLDSLKSKLGANLSLSSVF--GVIERISATTIEISGLRP--SIGDIVQICAKDKSKSGLA 57

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSL 119
            V  +  +   I P G  E   +GD V+   +  +I       GRV++    P DG  ++
Sbjct: 58  MVTEVRQNTALISPFGFVEGYKIGDFVYQSDQGMKIPVGDALLGRVVDPFMNPKDGKGAI 117

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
              + +  IM     AM R  +++ F  G++ ID       GQ++G+FAGSG+GKSTL+ 
Sbjct: 118 VATEYA-PIMRAPIDAMKRGLIDEIFSVGVKSIDGLLTCGKGQKLGIFAGSGVGKSTLMG 176

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAV 239
           M  ++      +++L+GERGREV EFIE  L  +L  +VV+VATSD+SP++RK     A+
Sbjct: 177 MIVKNSQAPIKVVALIGERGREVPEFIEKNLRGDLSGTVVIVATSDDSPLMRKYGAFCAM 236

Query: 240 TIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGP 299
           ++AEYF ++G +VL I+DS+TRFA + REI    GE P ++GYP SV + LP+L+ER G 
Sbjct: 237 SVAEYFKNQGKDVLFIMDSVTRFAMAQREIGLALGEPPTSKGYPPSVLTLLPQLMERAG- 295

Query: 300 SEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSR 359
            E+ KG+ITA  +VLVDGD+ +DPIAD  RSILDGHIVL+R + + G YPP++ L S SR
Sbjct: 296 KEEGKGSITAFFTVLVDGDDMSDPIADQSRSILDGHIVLSREMTDFGIYPPINILNSASR 355

Query: 360 LADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
           +     S + +   + L  L    +E   +  IG Y+ G D  LD A+ +   I  FLKQ
Sbjct: 356 VMSDIASKEHRANAAKLKRLYSLLKENEVLLRIGAYQKGSDKELDLAISKKEFINAFLKQ 415

Query: 420 SPSDLSSEDVFQEI 433
              +  S +  QE+
Sbjct: 416 DAEEGFSFEQTQEL 429


>gi|253988533|ref|YP_003039889.1| type III secretion system ATPase [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|211637885|emb|CAR66514.1| type iii secretion component protein sctn [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|253779983|emb|CAQ83144.1| type iii secretion component protein sctn [Photorhabdus
           asymbiotica]
          Length = 441

 Score =  275 bits (703), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 162/407 (39%), Positives = 237/407 (58%), Gaps = 27/407 (6%)

Query: 35  TVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFR 94
           T++ L++ +    F  HQ   +  LG++  I+ +   + P G   ++ +GD +       
Sbjct: 57  TLSLLAEVI---GFQQHQALLTP-LGEMFGISSN-TEVSPTGAMHQVGVGDYLL------ 105

Query: 95  ISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDI 154
                   G++++ LG P  G   L +      +    P  M+R+R+E     G+R ID 
Sbjct: 106 --------GQILDGLGNPFSGGQ-LPEPQAWYPVYRDAPAPMSRKRIEHPLSLGVRAIDG 156

Query: 155 FTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN- 213
                 GQR+G+FA +G GKSTLLS   R+   D  +++L+GERGREVREFIE  LG+  
Sbjct: 157 LLTCGEGQRMGIFAAAGGGKSTLLSTLIRNAEVDVTVLALIGERGREVREFIESDLGEEG 216

Query: 214 LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNS 273
           LK+SV+VVATSD   + R  A   A +IAEYF  +G  VLL++DS+TRFA + REI   +
Sbjct: 217 LKRSVLVVATSDRPAMERAKAGFVATSIAEYFRDQGKRVLLLMDSVTRFARAQREIGLAA 276

Query: 274 GELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILD 333
           GE P  RGYP SVF+ LPRL+ER G S  +KG+ITA+ +VLV+GD+  +P+AD  RSILD
Sbjct: 277 GEPPTRRGYPPSVFAALPRLMERAGQS--DKGSITALYTVLVEGDDMTEPVADETRSILD 334

Query: 334 GHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIG 393
           GHI+L+R LA    YP +D L S SR+  +  + + +   + L H + ++EE   +  IG
Sbjct: 335 GHIILSRKLAAANHYPAIDVLRSASRVMSQIITPEHQAQANLLRHWLAKYEEVELLLQIG 394

Query: 394 GYRPGVDLILDKAVHQVPIIYDFLKQ---SPSDLSSEDV-FQEITKK 436
            Y+ G D + D A+  +  I  +L+Q    PSDL    V  Q+ITK+
Sbjct: 395 EYQKGQDPVADNAIAHIEAIRGWLRQGTHEPSDLPQTLVLLQQITKQ 441


>gi|32266064|ref|NP_860096.1| flagellum-specific ATP synthase [Helicobacter hepaticus ATCC 51449]
 gi|32262113|gb|AAP77162.1| flagellum-specific ATP synthase FliI [Helicobacter hepaticus ATCC
           51449]
          Length = 458

 Score =  275 bits (703), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 160/381 (41%), Positives = 229/381 (60%), Gaps = 6/381 (1%)

Query: 56  SDNLGQVIRINLDIVYICPVGIGEEISLGDLV--FHWGRFRISPSACWCGRVINALGKPI 113
           + NLG V+ I  +  +I P    E    GD V   + G   I       GRVIN LG+PI
Sbjct: 74  THNLGMVMAIEGEHFFISPFSFIEGHKCGDKVEILNHG-LHIPVGENMLGRVINPLGEPI 132

Query: 114 DGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIG 173
           D   +L     ++ +M     A+ R  + + F+ G++ ID       GQ++G+FAGSG+G
Sbjct: 133 DDKGALHTSHTTL-LMRPPISALKRGLINEVFEVGVKSIDGILTCGKGQKMGIFAGSGVG 191

Query: 174 KSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKM 233
           KSTL+ M  R       +I+L+GERGREV EFI   L ++L  +++VVATSD+SP++RK 
Sbjct: 192 KSTLMGMIVRGSNAPIKVIALIGERGREVPEFIHKNLNNDLTNTILVVATSDDSPLMRKY 251

Query: 234 APLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRL 293
              +A+ IAEYF S G++VL I+DSITRFA + REI    GE P ++GYP SV + LP+L
Sbjct: 252 GAFSAMAIAEYFKSLGNDVLFIMDSITRFAMAQREIGLALGEPPTSKGYPPSVLTLLPQL 311

Query: 294 LERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDP 353
           +ER G  E   G+ITA  +VLV+GD+ +DP+AD  RSILDGHIVLNR L + G YPP++ 
Sbjct: 312 MERAG-KEDGVGSITAFFTVLVEGDDLSDPVADQSRSILDGHIVLNRDLTDMGIYPPINI 370

Query: 354 LASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPII 413
           L S SR+ +   S +  +++     L    +E   +  IG Y+ G D  LD+A+ +  ++
Sbjct: 371 LNSASRVINDIISPEHLQVIRKFRRLYSLLKENEVLIRIGAYQRGADKELDEAITKRSLM 430

Query: 414 YDFLKQSPSD-LSSEDVFQEI 433
             FLKQ  ++  S E  FQE+
Sbjct: 431 ESFLKQEMNEQWSFERSFQEL 451


>gi|167574676|ref|ZP_02367550.1| flagellum-specific ATP synthase [Burkholderia oklahomensis C6786]
          Length = 435

 Score =  275 bits (703), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 167/380 (43%), Positives = 232/380 (61%), Gaps = 24/380 (6%)

Query: 61  QVIRINLDIVYICP----VGI--GEEISLGDLVFHWGRFRISPSACWCGRVINALGKPID 114
           QV+  N +  Y+ P    VG+  G ++   D     G  R+  +  W GRVIN LG+PID
Sbjct: 57  QVVGFNREESYLMPFKKPVGLVAGAQVLARD---RKGALRVGRA--WLGRVINGLGEPID 111

Query: 115 GDDSLGKGDLSMEIMSKVPPAMN--RQR-VEKGFKTGIRVIDIFTPLCHGQRIGVFAGSG 171
           G   LG GD   +++++ P A+N  R+R V      G+R I+    L  GQR+G+ AGSG
Sbjct: 112 GHGPLG-GD---QVLNEKPAAVNPLRKRAVRDVLDVGVRAINGALTLGKGQRVGLMAGSG 167

Query: 172 IGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATSDESPIL 230
           +GKS LL M  R+   D V++ L+GERGREVREF+E  LGD  L K+V+VVA +DESP++
Sbjct: 168 VGKSVLLGMMTRATAADVVVVGLIGERGREVREFVEHALGDEGLAKAVLVVAPADESPLM 227

Query: 231 RKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSEL 290
           R  A      IA ++   G +VLL++DS+TR+A + REIA + GE P  RGYP SVF  L
Sbjct: 228 RLRAAELCHAIAAHYRDAGSDVLLLVDSLTRYAMAQREIALSLGEPPATRGYPPSVFGML 287

Query: 291 PRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPP 350
           P+L+E  G  E   G+++A+ +VL +GD+ NDP+ D+ R+ILDGHIVL+R LAE G YP 
Sbjct: 288 PQLVETAGNGEG-SGSMSAIYTVLAEGDDQNDPVVDTARAILDGHIVLSRELAERGHYPA 346

Query: 351 VDPLASVSRLADKAWSADEKKLVSS--LTHLIHRFEETRDIRLIGGYRPGVDLILDKAVH 408
           +D   SVSR    A  AD + +V +  L  +I R E+ RD+  +GGY  G D   D+AV 
Sbjct: 347 IDVTRSVSRC--MAQIADARHVVRAGQLKEMIGRHEQVRDLIPLGGYVQGADAATDRAVA 404

Query: 409 QVPIIYDFLKQSPSDLSSED 428
               I  FL+Q   + +S D
Sbjct: 405 MAERIDAFLRQPMHEAASFD 424


>gi|291538498|emb|CBL11609.1| type III secretion system ATPase, FliI/YscN [Roseburia intestinalis
           XB6B4]
          Length = 435

 Score =  275 bits (703), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 152/374 (40%), Positives = 236/374 (63%), Gaps = 6/374 (1%)

Query: 48  FVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVI 106
            ++ + +N   + +V+      + + P    E I +G +V + G    +       G  +
Sbjct: 45  IIIDREQNISTMAEVVGFRDKHLLLMPFESVEGIGVGCIVENTGHPLTVKVGEELLGHTL 104

Query: 107 NALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGV 166
           + +G+P D ++ L   D  +E +   P  M R+ +++    G++ +D    +  GQRIG+
Sbjct: 105 DGIGRPTDVEELLLPYDYPVEALP--PDPMARKIIDEVLPLGVKAVDGLITVGKGQRIGI 162

Query: 167 FAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSD 225
           FAGSG+GKSTLL MFAR+   D  +I+L+GERGREVREF+E  LG+  +K+SVV+VATSD
Sbjct: 163 FAGSGVGKSTLLGMFARNTKADINVIALIGERGREVREFVERDLGEEGMKRSVVIVATSD 222

Query: 226 ESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTS 285
           +  ++R  A  TA  IAEYF  +G +VLL++DS+TRF+ + REI   SGE PV RGYP S
Sbjct: 223 KPALIRNKAAKTATAIAEYFRDQGKDVLLMMDSLTRFSMAQREIGLASGEPPVTRGYPPS 282

Query: 286 VFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEE 345
           V+SE+P+LLER G S  +KG+IT + +VLVDGD+ N+PI D+ RSILDGHI+L+R L ++
Sbjct: 283 VYSEMPKLLERAGTS--DKGSITGLYTVLVDGDDMNEPITDTARSILDGHIMLSRKLGQK 340

Query: 346 GRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDK 405
             YP +D L S+SR+     +++ K+L   L +++  + E  D+  IG Y+ G +  +D 
Sbjct: 341 NHYPAIDVLQSISRVMSSIATSEHKELAGKLRNVMATYNEAEDLINIGAYKNGTNREIDY 400

Query: 406 AVHQVPIIYDFLKQ 419
           A+ ++  + +FL Q
Sbjct: 401 AIQKIQAVNEFLMQ 414


>gi|257457883|ref|ZP_05623042.1| flagellar protein export ATPase FliI [Treponema vincentii ATCC
           35580]
 gi|257444596|gb|EEV19680.1| flagellar protein export ATPase FliI [Treponema vincentii ATCC
           35580]
          Length = 479

 Score =  275 bits (702), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 150/326 (46%), Positives = 207/326 (63%), Gaps = 4/326 (1%)

Query: 99  ACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPL 158
           +   GRV+++LG+  DG        L   I+++ P  + R+ +++   TGIR ID    +
Sbjct: 98  SVLLGRVVDSLGRAADGKQE-PYSPLHYPILAQPPDPLERRPIKERIVTGIRAIDALLAV 156

Query: 159 CHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKS 217
             GQRIG+FAGSGIGKSTL+ M AR+   D  +I+L+GERGREV +F+E  LG + LK S
Sbjct: 157 GRGQRIGIFAGSGIGKSTLMGMIARNTSADVNVIALIGERGREVNDFLEHDLGPEGLKHS 216

Query: 218 VVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELP 277
           VVV ATSD SP+ R     TA  IAEYF  +G +V+L+ DS+TRFA + REI+   GE P
Sbjct: 217 VVVTATSDTSPLARIRGAYTATAIAEYFRDQGKDVMLLFDSVTRFAKAQREISLAIGEPP 276

Query: 278 VARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIV 337
             RGY  SVF  LP+LLER G S K  G+IT   +VLVDGD+ ++PI+D+VR ILDGHIV
Sbjct: 277 ATRGYTPSVFEVLPKLLERSGTSAK--GSITGFYTVLVDGDDMDEPISDAVRGILDGHIV 334

Query: 338 LNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRP 397
           LNR LA+ G YP +D L S+SRLA++      KK    +  L+  + +  D+  +G Y+ 
Sbjct: 335 LNRKLAQCGHYPAIDVLGSISRLANRVAGECSKKAAQYMRKLMAVYADAEDMIQVGAYQK 394

Query: 398 GVDLILDKAVHQVPIIYDFLKQSPSD 423
           G +  +D+A+     I  FL+Q  +D
Sbjct: 395 GSNPAIDEAIDHHDKIETFLQQEVND 420


>gi|27550061|gb|AAO18044.1| LscN [Photorhabdus luminescens]
          Length = 440

 Score =  275 bits (702), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 162/406 (39%), Positives = 239/406 (58%), Gaps = 27/406 (6%)

Query: 35  TVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFR 94
           T++ L++ +    F  HQ   +  LG++  I+ +   + P G   ++ +GD +       
Sbjct: 57  TLSLLAEVI---GFQQHQALLTP-LGEMFGISSN-TEVSPTGAMHQVGVGDYLL------ 105

Query: 95  ISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDI 154
                   G+V++ LG P  G   L +      +    P  M+R+R+E     G+R ID 
Sbjct: 106 --------GQVLDGLGNPFAGGQ-LPEPQAWYPVYRDAPAPMSRKRIEHPLSLGVRAIDG 156

Query: 155 FTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN- 213
                 GQR+G+FA +G GKSTLLS   RS   D  +++L+GERGREVREFIE  LG+  
Sbjct: 157 LLTCGEGQRMGIFAAAGGGKSTLLSTLIRSAEVDVTVLALIGERGREVREFIESDLGEEG 216

Query: 214 LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNS 273
           LK+SV+VVATSD   + R  A   A +IAEYF  +G  VLL++DS+TRFA + REI   +
Sbjct: 217 LKRSVLVVATSDRPAMERAKAGFVATSIAEYFRDQGKRVLLLMDSVTRFARAQREIGLAA 276

Query: 274 GELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILD 333
           GE P  RGYP SVF+ LPRL+ER G S  +KG+ITA+ +VLV+GD+  +P+AD  RSILD
Sbjct: 277 GEPPTRRGYPPSVFAALPRLMERAGQS--DKGSITALYTVLVEGDDMTEPVADETRSILD 334

Query: 334 GHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIG 393
           GHI+L+R LA    YP +D L S SR+ ++  + + +     L + + ++EE   +  IG
Sbjct: 335 GHIILSRKLAAANHYPAIDVLRSASRVMNQIITPEHQAQAGLLRNWLAKYEEVELLLQIG 394

Query: 394 GYRPGVDLILDKAVHQVPIIYDFLKQ---SPSDL-SSEDVFQEITK 435
            Y+ G DL+ D A+ ++  I  +L+Q    PSDL  +  + Q+IT+
Sbjct: 395 EYQKGQDLVADNAIARIDAIRSWLRQGTHEPSDLPQTLALLQQITR 440


>gi|15615018|ref|NP_243321.1| flagellum-specific ATP synthase [Bacillus halodurans C-125]
 gi|10175075|dbj|BAB06174.1| flagellar-specific ATP synthase [Bacillus halodurans C-125]
          Length = 437

 Score =  275 bits (702), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 151/380 (39%), Positives = 239/380 (62%), Gaps = 6/380 (1%)

Query: 59  LGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDD 117
           + +V+    + V + P+    EI+ G LV   GR  ++       G VI+  G+P+ G+ 
Sbjct: 55  MAEVVGFKEERVLLMPLNGTAEIAPGSLVEGTGRPLQVKVGYSLIGHVIDGCGRPLTGE- 113

Query: 118 SLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
           +L  G       +  P  ++R R+++    G+R ID    +  GQR+G+FAGSG+GKSTL
Sbjct: 114 ALPNGLTPYPTDNPPPNPISRPRIKEAMHLGVRAIDGLLTVGKGQRVGIFAGSGVGKSTL 173

Query: 178 LSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPL 236
           L+M A++   D  II+L+GERGREV++FIE  LG D L++S++VVATSD+  ++R    +
Sbjct: 174 LAMLAKNAAADLNIIALIGERGREVKDFIERDLGEDGLRRSIIVVATSDQPALMRIKGAM 233

Query: 237 TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLER 296
           TA  +AEYF  +G +V L++DS+TRFA + REI    GE P  +GY  SVF+ LP+LLER
Sbjct: 234 TATALAEYFRDQGLHVNLMMDSVTRFAMAQREIGLAVGEPPTTKGYTPSVFALLPKLLER 293

Query: 297 IGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLAS 356
            G + K  G+IT   +VLVDGD+ N+PI+D+VR ILDGH VL+R LA +G YP ++ L S
Sbjct: 294 AGTNGK--GSITGFYTVLVDGDDLNEPISDTVRGILDGHFVLDRELANKGHYPAINILKS 351

Query: 357 VSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDF 416
           VSR+ +   + ++K+    +  L+  ++E+ D+  IG Y+ G    +D+A+ + P +  F
Sbjct: 352 VSRVMNDIVTDEQKRAAEHVRSLLSVYKESEDLINIGAYKRGSSKQIDEAIERQPEVISF 411

Query: 417 LKQSPSDLS-SEDVFQEITK 435
           L+Q+  +++ +E   Q++ +
Sbjct: 412 LRQNTDEVAIAEHSIQQLIQ 431


>gi|154686040|ref|YP_001421201.1| flagellum-specific ATP synthase [Bacillus amyloliquefaciens FZB42]
 gi|154351891|gb|ABS73970.1| FliI [Bacillus amyloliquefaciens FZB42]
          Length = 438

 Score =  275 bits (702), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 158/361 (43%), Positives = 221/361 (61%), Gaps = 5/361 (1%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSL 119
           +V+    + + + P      I+ G +V   G   RI   A   G+V++A G+P+DG  +L
Sbjct: 58  EVVGFQDENILLMPYLEAASIAPGSIVEATGESLRIKVGAGLIGQVVDAFGEPLDGR-AL 116

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
            KG   +      P  M R  + +    G+R ID    +  GQRIG+FAGSG+GKSTL+ 
Sbjct: 117 PKGLSPVSTEQPPPNPMKRPPIREKMGVGVRSIDSLLTVGKGQRIGIFAGSGVGKSTLMG 176

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPLTA 238
           M A+    D  II+LVGERGREVREFIE  LG+  LK+S+VVVATSD+  ++R  A  TA
Sbjct: 177 MIAKQTEADLNIIALVGERGREVREFIEKDLGEEGLKRSIVVVATSDQPALMRLKAAYTA 236

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
             IAEYF  KG NV+ ++DS+TR A + REI   +GE P  +GY  SVF+ LPRLLER G
Sbjct: 237 TAIAEYFRDKGRNVMFMMDSVTRVAMAQREIGLAAGEPPTTKGYTPSVFAILPRLLERTG 296

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
            +E+  G ITA  +VLVDGD+ N+PIAD+VR ILDGHIVL+R+LA +G++P V+ L S+S
Sbjct: 297 ANEQ--GTITAFYTVLVDGDDMNEPIADTVRGILDGHIVLDRALANKGQFPAVNILKSIS 354

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+          +  +    L+  ++ + D+  IG Y+ G    +D+A+   P +  FLK
Sbjct: 355 RVMSNISDTSHIEAANKFRDLLSTYQNSEDLINIGAYKRGSSREIDEAIQFYPQLIQFLK 414

Query: 419 Q 419
           Q
Sbjct: 415 Q 415


>gi|224438105|ref|ZP_03659040.1| flagellum-specific ATP synthase [Helicobacter cinaedi CCUG 18818]
 gi|313144545|ref|ZP_07806738.1| flagellum-specific ATP synthase FliI [Helicobacter cinaedi CCUG
           18818]
 gi|313129576|gb|EFR47193.1| flagellum-specific ATP synthase FliI [Helicobacter cinaedi CCUG
           18818]
          Length = 472

 Score =  275 bits (702), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 158/370 (42%), Positives = 222/370 (60%), Gaps = 5/370 (1%)

Query: 52  QGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLV--FHWGRFRISPSACWCGRVINAL 109
           QG+   +LG VI I  +  +I P    E    GD V   + G   I       GRV+N L
Sbjct: 85  QGEKKQSLGMVIAIEGEKFFISPFSFVEGHKCGDKVEILNHG-LNIPVGEAMLGRVVNPL 143

Query: 110 GKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAG 169
           G+PID   SL     +  +M     A+ R  +++ F+ G++ ID       GQ++G+FAG
Sbjct: 144 GEPIDDKGSL-HTQATTPLMRSPLSALKRGLIDEVFEVGVKSIDSILTCGKGQKMGIFAG 202

Query: 170 SGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPI 229
           SG+GKSTL+ M  R       +I+L+GERGREV EFI   L ++L  +++VVATSD+SP+
Sbjct: 203 SGVGKSTLMGMIVRGAKAPIKVIALIGERGREVPEFIYKNLNNDLTNTILVVATSDDSPL 262

Query: 230 LRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSE 289
           +RK    +A+ IAEYF S G++VL I+DS+TRFA + REI    GE P ++GYP SV + 
Sbjct: 263 MRKYGAFSAMAIAEYFKSLGNDVLFIMDSVTRFAMAQREIGLALGEPPTSKGYPPSVLTL 322

Query: 290 LPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYP 349
           LP+L+ER G  E   G+ITA  +VLV+GD+ +DPIAD  RSILDGHIVLNR L + G YP
Sbjct: 323 LPQLMERAG-KEDSVGSITAFFTVLVEGDDLSDPIADQSRSILDGHIVLNRDLTDMGIYP 381

Query: 350 PVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQ 409
           P++ L S SR+ +   S +    V     L    +E   +  IG Y+ G D+ LD+A+++
Sbjct: 382 PINILNSASRIINDIISPEHLGYVRKFRRLYSLIKENEVLIRIGAYQRGADIELDEAINK 441

Query: 410 VPIIYDFLKQ 419
              +  FLKQ
Sbjct: 442 RTAMEAFLKQ 451


>gi|269792943|ref|YP_003317847.1| ATPase, FliI/YscN family [Thermanaerovibrio acidaminovorans DSM
           6589]
 gi|269100578|gb|ACZ19565.1| ATPase, FliI/YscN family [Thermanaerovibrio acidaminovorans DSM
           6589]
          Length = 441

 Score =  275 bits (702), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 165/399 (41%), Positives = 239/399 (59%), Gaps = 10/399 (2%)

Query: 43  VCLGDFVVHQGKNSDN--LGQVIRINLDIVYICPVGIGEEISLG-DLVFHWGRFRISPSA 99
           V +GD      +N  N    +V+    D V + P+G   +I  G D+        +    
Sbjct: 41  VQVGDLCEISFRNRRNPLKAEVVGFRSDRVLLMPLGDLNDIGPGCDVAALGPTLGVHVGE 100

Query: 100 CWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLC 159
              GR+++ LG PID    +G  +    + +  P  + RQ +++    G+RVID    L 
Sbjct: 101 DLLGRILDGLGNPIDDLGPVGASEF-YPLYAPPPHPLKRQMIDRPLSVGVRVIDGLLTLG 159

Query: 160 HGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSV 218
            GQR+G+FAGSG+GKS LL M AR+   D  +I+LVGERGREVREF+E  LG + LK+SV
Sbjct: 160 QGQRVGIFAGSGVGKSVLLGMMARNTEADVNVIALVGERGREVREFVERDLGPEGLKRSV 219

Query: 219 VVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPV 278
           VVVATSD+ P++R  A LTA  +AEYF  +G NVLL++DS+TR A + R++    GE P 
Sbjct: 220 VVVATSDQPPLVRLKASLTATAVAEYFRDQGANVLLMMDSVTRVAMAQRDVGLAIGEPPA 279

Query: 279 ARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVL 338
            +GY  SVF+ LPRLLER G    ++G+ITA+ +VLV+GD+ N+P+AD+VR ILDGHIVL
Sbjct: 280 TKGYTPSVFAFLPRLLERSGAG--DRGSITAIYTVLVEGDDMNEPVADTVRGILDGHIVL 337

Query: 339 NRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPG 398
           +RSLA +  YP V+   SVSR+     S +  +    +  L+  +EE +D+  IG Y+ G
Sbjct: 338 SRSLAAKNHYPSVEVGRSVSRVMPHIVSREHLESAGRVRELLAVYEEAQDLVNIGAYKAG 397

Query: 399 VDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKL 437
            +  +D A+  +  + +FL+Q   + SS   F E   +L
Sbjct: 398 SNPRIDWALANLEDVRNFLRQGMHERSS---FDETVSRL 433


>gi|302392393|ref|YP_003828213.1| type III secretion system ATPase, FliI/YscN [Acetohalobium
           arabaticum DSM 5501]
 gi|302204470|gb|ADL13148.1| type III secretion system ATPase, FliI/YscN [Acetohalobium
           arabaticum DSM 5501]
          Length = 439

 Score =  275 bits (702), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 152/333 (45%), Positives = 209/333 (62%), Gaps = 5/333 (1%)

Query: 103 GRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQ 162
           G V++ LG P+  D  L +      + +  P  + RQR+ +    GIR ID       GQ
Sbjct: 105 GHVLDGLGNPLT-DLDLDQLHKEYSVNNPPPNPLVRQRITEPLSVGIRSIDGLLTCGRGQ 163

Query: 163 RIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVV 221
           R+G+FAGSG+GKSTLL M AR+   D  +I L+GERGREVREFIED LG + LK+SVVVV
Sbjct: 164 RLGIFAGSGVGKSTLLGMIARNTAADVNVIGLIGERGREVREFIEDDLGTEGLKRSVVVV 223

Query: 222 ATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARG 281
           ATSD+  ++R    L   TIAEYF  +G +V+L++DSITRFA + RE+    GE P  RG
Sbjct: 224 ATSDQPALVRLKGALVTTTIAEYFRDQGQDVMLMMDSITRFARAQREVGLAVGEPPATRG 283

Query: 282 YPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRS 341
           Y  SVF+ LP+LLER G    E G IT + +VLV+GD+ N+PIAD+VR I+DGHI L+R 
Sbjct: 284 YTPSVFAMLPKLLERAG--NNEVGTITGLYNVLVEGDDMNEPIADAVRGIVDGHITLSRD 341

Query: 342 LAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDL 401
           LA +  YP VD L SVSR+ D   + + +     L  ++  +EE++D+  IG Y  G + 
Sbjct: 342 LATQNHYPAVDVLESVSRVMDDVVTEEHQTAAQQLREVLATYEESKDLVNIGAYEEGNNP 401

Query: 402 ILDKAVHQVPIIYDFLKQSPSDLSS-EDVFQEI 433
            LD A+ ++  + DFL+Q   + S  E   Q++
Sbjct: 402 ELDYALSKLDEVNDFLQQGVEEKSDFETTLQQL 434


>gi|301646800|ref|ZP_07246653.1| flagellar protein export ATPase FliI [Escherichia coli MS 146-1]
 gi|307136847|ref|ZP_07496203.1| FliI/YscN family ATPase [Escherichia coli H736]
 gi|307315208|ref|ZP_07594787.1| flagellar protein export ATPase FliI [Escherichia coli W]
 gi|331640702|ref|ZP_08341849.1| flagellar protein export ATPase FliI [Escherichia coli H736]
 gi|331666535|ref|ZP_08367409.1| flagellar protein export ATPase FliI [Escherichia coli TA271]
 gi|301075006|gb|EFK89812.1| flagellar protein export ATPase FliI [Escherichia coli MS 146-1]
 gi|306905389|gb|EFN35926.1| flagellar protein export ATPase FliI [Escherichia coli W]
 gi|315059477|gb|ADT73804.1| flagellum-specific ATP synthase [Escherichia coli W]
 gi|315616838|gb|EFU97455.1| flagellum-specific ATP synthase [Escherichia coli 3431]
 gi|323379965|gb|ADX52233.1| ATPase, FliI/YscN family [Escherichia coli KO11]
 gi|331040076|gb|EGI12284.1| flagellar protein export ATPase FliI [Escherichia coli H736]
 gi|331065759|gb|EGI37643.1| flagellar protein export ATPase FliI [Escherichia coli TA271]
          Length = 445

 Score =  275 bits (702), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 153/376 (40%), Positives = 223/376 (59%), Gaps = 10/376 (2%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFR-ISPSACWCGRVINALGKPIDGDDSL 119
           Q +  N DI Y+ P      +  G  VF   +   I     W GRV+N LG+P+DG   L
Sbjct: 60  QAVGFNRDITYLMPFKQPVGLMAGARVFPEEKAHDILIGESWLGRVVNGLGEPLDGKGRL 119

Query: 120 GKGDLSMEIMSKVPPAMN---RQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKST 176
              DL    +  +PP++N   R+ V++    G++ I+    +  GQR+G+ AGSG+GKS 
Sbjct: 120 NGNDL----LPPLPPSVNPLTRRSVDEPLDVGVKAINGLLTIGKGQRVGLMAGSGVGKSV 175

Query: 177 LLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAP 235
           LL M  R    D V++ L+GERGREV+EFI+  LG D L KS+VVVA +DESP++R  A 
Sbjct: 176 LLGMITRQTKADIVVVGLIGERGREVKEFIDHSLGADGLAKSIVVVAPADESPLMRLKAT 235

Query: 236 LTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLE 295
               +IA +F  +G +VLL++DS+TR+A + REIA + GE P  +GYP S F  +P+L+E
Sbjct: 236 ELCHSIAAWFRDRGHHVLLLVDSLTRYAMAQREIALSLGEPPATKGYPPSAFGMIPKLVE 295

Query: 296 RIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLA 355
             G SE   G++TA+ +VL +GD+  DPI D  R++LDGHIVL R LAE G YP +D   
Sbjct: 296 SAGNSES-AGSMTAIYTVLAEGDDQQDPIVDCARAVLDGHIVLTRKLAEAGHYPAIDIGQ 354

Query: 356 SVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYD 415
           S+SR  ++  S + ++   +L      + E + +  +GGY  G D  +DKAV   P I  
Sbjct: 355 SISRCMNQVTSLEHQQSARALKQNYAAYMEIKPLIPLGGYVAGADASVDKAVKMFPAIER 414

Query: 416 FLKQSPSDLSSEDVFQ 431
           FL+Q   + +S ++ Q
Sbjct: 415 FLRQEMREPASLELVQ 430


>gi|320535384|ref|ZP_08035498.1| flagellar protein export ATPase FliI [Treponema phagedenis F0421]
 gi|320147786|gb|EFW39288.1| flagellar protein export ATPase FliI [Treponema phagedenis F0421]
          Length = 478

 Score =  274 bits (701), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 162/384 (42%), Positives = 227/384 (59%), Gaps = 7/384 (1%)

Query: 44  CLGDFVVHQGKNSDN--LGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSA-C 100
            +G+    +  NS +  + +V+ ++   V +      + I LG  V   G     P    
Sbjct: 40  VVGELCKIKANNSSDPIMAEVVGLDEGTVKLMSYSDLQGIELGSEVIAEGEILSVPVGDA 99

Query: 101 WCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCH 160
             GRVINALGK IDG   +        ++   P  M+R+ + +   TG+R ID    +  
Sbjct: 100 LLGRVINALGKAIDGKQEVYSSK-RYPVLQTPPNPMDRKPIRQRIVTGVRAIDSLLAVGC 158

Query: 161 GQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVV 219
           GQR+G+F+GSG+GKSTL+ M AR+   D  +I+L+GERGREV +FIE  LG + LKKSVV
Sbjct: 159 GQRLGIFSGSGVGKSTLMGMIARNTNADVNVIALIGERGREVMDFIEHDLGPEGLKKSVV 218

Query: 220 VVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVA 279
           V ATSDESP+ R     TA  IAEYF  +G +V+L+ DS+TRFA + REI   +GE    
Sbjct: 219 VTATSDESPLARIRGAYTATAIAEYFRDQGKDVMLLFDSVTRFAKAQREIGLAAGEPAAT 278

Query: 280 RGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLN 339
           RGY  SVF  LP+LLER G S   KG+IT   +VLVDGD+ ++PI+D+VR I+DGHIVL+
Sbjct: 279 RGYTPSVFETLPKLLERSGTS--SKGSITGFYTVLVDGDDLDEPISDAVRGIIDGHIVLS 336

Query: 340 RSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGV 399
           R LA+   YP +D L S+SRLA +       + V ++   I  +EE+ D+  +G Y+ G 
Sbjct: 337 RKLAQRSHYPAIDILNSISRLAHRVSGRFTNQAVLAMRKSIAIYEESADMIQVGAYQKGS 396

Query: 400 DLILDKAVHQVPIIYDFLKQSPSD 423
              +DKA+     I +FL Q  +D
Sbjct: 397 SEEVDKAIALHQPIEEFLMQEVTD 420


>gi|59889770|emb|CAH19125.1| Lateral flagellar export/assembly protein (LfiI-like) [Escherichia
           coli]
 gi|284920034|emb|CBG33090.1| lateral flagellar specific ATP synthase (FliI-like) [Escherichia
           coli 042]
          Length = 445

 Score =  274 bits (701), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 153/376 (40%), Positives = 223/376 (59%), Gaps = 10/376 (2%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFR-ISPSACWCGRVINALGKPIDGDDSL 119
           Q +  N DI Y+ P      +  G  VF   +   I     W GRV+N LG+P+DG   L
Sbjct: 60  QAVGFNRDITYLMPFKQPVGLMAGARVFPEEKAHDILIGESWLGRVVNGLGEPLDGKGRL 119

Query: 120 GKGDLSMEIMSKVPPAMN---RQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKST 176
              DL    +  +PP++N   R+ V++    G++ I+    +  GQR+G+ AGSG+GKS 
Sbjct: 120 NGNDL----LPPLPPSVNPLTRRSVDEPLDVGVKAINGLLTIGKGQRVGLMAGSGVGKSV 175

Query: 177 LLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAP 235
           LL M  R    D V++ L+GERGREV+EFI+  LG D L KS+VVVA +DESP++R  A 
Sbjct: 176 LLGMITRQTKADIVVVGLIGERGREVKEFIDHSLGADGLAKSIVVVAPADESPLMRLKAT 235

Query: 236 LTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLE 295
               +IA +F  +G +VLL++DS+TR+A + REIA + GE P  +GYP S F  +P+L+E
Sbjct: 236 ELCHSIAAWFRDRGHHVLLLVDSLTRYAMAQREIALSLGEPPATKGYPPSAFGMIPKLVE 295

Query: 296 RIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLA 355
             G SE   G++TA+ +VL +GD+  DPI D  R++LDGHIVL R LAE G YP +D   
Sbjct: 296 SAGNSES-SGSMTAIYTVLAEGDDQQDPIVDCARAVLDGHIVLTRKLAEAGHYPAIDIGQ 354

Query: 356 SVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYD 415
           S+SR  ++  S + ++   +L      + E + +  +GGY  G D  +DKAV   P I  
Sbjct: 355 SISRCMNQVTSLEHQQSARALKQNYAAYMEIKPLIPLGGYVAGADASVDKAVKMFPAIER 414

Query: 416 FLKQSPSDLSSEDVFQ 431
           FL+Q   + +S ++ Q
Sbjct: 415 FLRQEMREPASLELVQ 430


>gi|323181535|gb|EFZ66955.1| flagellum-specific ATP synthase [Escherichia coli 1357]
          Length = 445

 Score =  274 bits (701), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 153/376 (40%), Positives = 223/376 (59%), Gaps = 10/376 (2%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFR-ISPSACWCGRVINALGKPIDGDDSL 119
           Q +  N DI Y+ P      +  G  VF   +   I     W GRV+N LG+P+DG   L
Sbjct: 60  QAVGFNRDITYLMPFKQPVGLMAGARVFPEEKAHDILIGESWLGRVVNGLGEPLDGKGRL 119

Query: 120 GKGDLSMEIMSKVPPAMN---RQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKST 176
              DL    +  +PP++N   R+ V++    G++ I+    +  GQR+G+ AGSG+GKS 
Sbjct: 120 NGNDL----LPPLPPSVNPLTRRSVDEPLDVGVKAINGLLTIGKGQRVGLMAGSGVGKSV 175

Query: 177 LLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAP 235
           LL M  R    D V++ L+GERGREV+EFI+  LG D L KS+VVVA +DESP++R  A 
Sbjct: 176 LLGMITRQTKADIVVVGLIGERGREVKEFIDHSLGADGLAKSIVVVAPADESPLMRLKAT 235

Query: 236 LTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLE 295
               +IA +F  +G +VLL++DS+TR+A + REIA + GE P  +GYP S F  +P+L+E
Sbjct: 236 ELCHSIAAWFRDRGHHVLLLVDSLTRYAMAQREIALSLGEPPATKGYPPSAFGMIPKLVE 295

Query: 296 RIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLA 355
             G SE   G++TA+ +VL +GD+  DPI D  R++LDGHIVL R LAE G YP +D   
Sbjct: 296 SAGNSES-AGSMTAIYTVLAEGDDQQDPIVDCARAVLDGHIVLTRKLAEAGHYPAIDIGQ 354

Query: 356 SVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYD 415
           S+SR  ++  S + ++   +L      + E + +  +GGY  G D  +DKAV   P I  
Sbjct: 355 SISRCMNQVTSLEHQQSARALKQNYAAYMEIKPLIPLGGYVAGADASVDKAVKMFPAIER 414

Query: 416 FLKQSPSDLSSEDVFQ 431
           FL+Q   + +S ++ Q
Sbjct: 415 FLRQEMREPASLELVQ 430


>gi|291613065|ref|YP_003523222.1| flagellar protein export ATPase FliI [Sideroxydans lithotrophicus
           ES-1]
 gi|291583177|gb|ADE10835.1| flagellar protein export ATPase FliI [Sideroxydans lithotrophicus
           ES-1]
          Length = 498

 Score =  274 bits (701), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 143/319 (44%), Positives = 201/319 (63%), Gaps = 2/319 (0%)

Query: 102 CGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHG 161
            GRV++  G+P+D    L +   S  + S+    + R  +++    G+R I+    +  G
Sbjct: 158 LGRVLDGAGRPLDQFGPLLESK-SAPLQSRPINPLERAAIKEALDVGVRAINSLLTVGRG 216

Query: 162 QRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVV 220
           QR+G+FAGSG+GKS LL M AR    D +++ L+GERGREV+EFI D LG + L++SVVV
Sbjct: 217 QRMGLFAGSGVGKSVLLGMMARYTSADVIVVGLIGERGREVKEFITDILGQEGLRRSVVV 276

Query: 221 VATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVAR 280
            A +D SP++R      A TIAEYF  +G NVLLI+DS+TR+A + REIA   GE P  +
Sbjct: 277 AAPADTSPLMRLQGAAYATTIAEYFRDQGKNVLLIMDSLTRYAMAQREIALAIGEPPATK 336

Query: 281 GYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNR 340
           GYP SVF++LP+L+ER G   +  G+ITA  +VL +GD+  DPIADS R+ILDGHIVL+R
Sbjct: 337 GYPPSVFAKLPQLVERAGNGAEGGGSITAFYTVLTEGDDQQDPIADSARAILDGHIVLSR 396

Query: 341 SLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVD 400
            LAE+G YP +D  AS+SR  +   S      V    H+   ++   D+  +G Y  G D
Sbjct: 397 RLAEQGHYPAIDIEASISRAMNHLVSPQHFLQVQRFKHMYAHYQRNHDLISVGAYVKGSD 456

Query: 401 LILDKAVHQVPIIYDFLKQ 419
            +LD+A+   P +  FLKQ
Sbjct: 457 PLLDQAIQLYPHMEHFLKQ 475


>gi|170021371|ref|YP_001726325.1| FliI/YscN family ATPase [Escherichia coli ATCC 8739]
 gi|188494378|ref|ZP_03001648.1| lateral flagellar export/assembly protein LfiI [Escherichia coli
           53638]
 gi|256020217|ref|ZP_05434082.1| FliI/YscN family ATPase [Shigella sp. D9]
 gi|300817283|ref|ZP_07097501.1| flagellar protein export ATPase FliI [Escherichia coli MS 107-1]
 gi|300936113|ref|ZP_07151053.1| flagellar protein export ATPase FliI [Escherichia coli MS 21-1]
 gi|332281379|ref|ZP_08393792.1| lateral flagellar export/assembly protein [Shigella sp. D9]
 gi|169756299|gb|ACA78998.1| ATPase, FliI/YscN family [Escherichia coli ATCC 8739]
 gi|188489577|gb|EDU64680.1| lateral flagellar export/assembly protein LfiI [Escherichia coli
           53638]
 gi|300458733|gb|EFK22226.1| flagellar protein export ATPase FliI [Escherichia coli MS 21-1]
 gi|300530259|gb|EFK51321.1| flagellar protein export ATPase FliI [Escherichia coli MS 107-1]
 gi|323171050|gb|EFZ56699.1| flagellum-specific ATP synthase [Escherichia coli LT-68]
 gi|332103731|gb|EGJ07077.1| lateral flagellar export/assembly protein [Shigella sp. D9]
          Length = 445

 Score =  274 bits (701), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 153/376 (40%), Positives = 223/376 (59%), Gaps = 10/376 (2%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFR-ISPSACWCGRVINALGKPIDGDDSL 119
           Q +  N DI Y+ P      +  G  VF   +   I     W GRV+N LG+P+DG   L
Sbjct: 60  QAVGFNRDITYLMPFKQPVGLMAGARVFPEEKAHDILIGESWLGRVVNGLGEPLDGKGRL 119

Query: 120 GKGDLSMEIMSKVPPAMN---RQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKST 176
              DL    +  +PP++N   R+ V++    G++ I+    +  GQR+G+ AGSG+GKS 
Sbjct: 120 NGNDL----LPPLPPSVNPLTRRSVDEPLDVGVKAINGLLTIGKGQRVGLMAGSGVGKSV 175

Query: 177 LLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAP 235
           LL M  R    D V++ L+GERGREV+EFI+  LG D L KS+VVVA +DESP++R  A 
Sbjct: 176 LLGMITRQTKADIVVVGLIGERGREVKEFIDHSLGADGLAKSIVVVAPADESPLMRLKAT 235

Query: 236 LTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLE 295
               +IA +F  +G +VLL++DS+TR+A + REIA + GE P  +GYP S F  +P+L+E
Sbjct: 236 ELCHSIAAWFRDRGHHVLLLVDSLTRYAMAQREIALSLGEPPATKGYPPSAFGMIPKLVE 295

Query: 296 RIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLA 355
             G SE   G++TA+ +VL +GD+  DPI D  R++LDGHIVL R LAE G YP +D   
Sbjct: 296 SAGNSES-AGSMTAIYTVLAEGDDQQDPIVDCARAVLDGHIVLTRKLAEAGHYPAIDIGQ 354

Query: 356 SVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYD 415
           S+SR  ++  S + ++   +L      + E + +  +GGY  G D  +DKAV   P I  
Sbjct: 355 SISRCMNQVTSLEHQQSARALKQNYAAYMEIKPLIPLGGYVAGADASVDKAVKMFPAIER 414

Query: 416 FLKQSPSDLSSEDVFQ 431
           FL+Q   + +S ++ Q
Sbjct: 415 FLRQEMREPASLELVQ 430


>gi|288942633|ref|YP_003444873.1| flagellar protein export ATPase FliI [Allochromatium vinosum DSM
           180]
 gi|288898005|gb|ADC63841.1| flagellar protein export ATPase FliI [Allochromatium vinosum DSM
           180]
          Length = 461

 Score =  274 bits (701), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 155/394 (39%), Positives = 229/394 (58%), Gaps = 6/394 (1%)

Query: 46  GDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISP-SACWCGR 104
           G   +H    +    +V+    +  ++ P G  E ++ G  +    + R  P      GR
Sbjct: 62  GRAAIHTANGTRLGAEVVGFQGERTFLMPEGKLEGLAPGARIEPLEQARRIPVGPALLGR 121

Query: 105 VINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRI 164
           V++ALGKP+DG   +   +++      + P + R  V +    GIR ++    +  GQRI
Sbjct: 122 VVDALGKPLDGGGPIRTAEMAPIEGRPINP-LGRVPVTEPLDVGIRALNGLLSVGRGQRI 180

Query: 165 GVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVAT- 223
           G+FAGSG+GKS LL M  R    D +++ L+GERGREV EFI D L +  +K  VVVA  
Sbjct: 181 GLFAGSGVGKSVLLGMMTRHTAADVIVVGLIGERGREVNEFIYDILDEESRKRTVVVAVP 240

Query: 224 SDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYP 283
           +D+SP+LR+     + TIAE F  +G NVLL++DS+TRFA   REIA   GE P  +GY 
Sbjct: 241 ADQSPLLRQHGAWVSTTIAESFRDRGLNVLLLMDSLTRFAQGAREIAMAIGEPPATKGYS 300

Query: 284 TSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLA 343
            SVF+ LP+L+ER G  +K  G+ITA  +VL +GD+ NDPI DS R+ILDGH+VL+R +A
Sbjct: 301 ASVFARLPQLVERAGNGDKGGGSITAFYTVLAEGDDQNDPIVDSARAILDGHVVLSREIA 360

Query: 344 EEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLIL 403
           E GRYP +D  ASVSR+     + + +K      +L+  +   RD+  +G YR G D  L
Sbjct: 361 ETGRYPAIDVGASVSRVMSAVVTPEHQKAAYRFRNLMSTYARNRDLIAVGAYRKGSDPQL 420

Query: 404 DKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKL 437
           D+AV   P +  +L Q+  + +S   F++  ++L
Sbjct: 421 DEAVAMNPRLEAYLGQNRLEKAS---FEDSRRQL 451


>gi|218778525|ref|YP_002429843.1| ATPase FliI/YscN [Desulfatibacillum alkenivorans AK-01]
 gi|218759909|gb|ACL02375.1| ATPase FliI/YscN [Desulfatibacillum alkenivorans AK-01]
          Length = 442

 Score =  274 bits (701), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 154/395 (38%), Positives = 238/395 (60%), Gaps = 9/395 (2%)

Query: 43  VCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSA-CW 101
           VC  D V  QG+      +V+      + + P G  + I LG  +    +  ++P    +
Sbjct: 42  VC--DLVTTQGRRIP--AEVVGFKEKRMLLMPYGEMQGIQLGCRIVPRQQQPLAPVGDAY 97

Query: 102 CGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHG 161
            GRVI+ LG+P+D    +   D+   + + V  A++R+ V +    G+RVI+ F  +  G
Sbjct: 98  LGRVIDGLGQPMDDKGPIAATDM-YPLYADVVNALHRRSVNQVSDVGVRVINSFITVGQG 156

Query: 162 QRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVV 220
           QR+ + AGSG+GKS L+ M +R    D  I++L+GERGREV++F+++ LG D + +S+VV
Sbjct: 157 QRVAIMAGSGVGKSVLMGMISRHMASDVCIVALIGERGREVKDFVDEILGPDGMGRSIVV 216

Query: 221 VATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVAR 280
            ATSD SP++R      A T+AEYF  +G NV+L++DS+TRFA S R++   +GE P  +
Sbjct: 217 AATSDTSPLVRMRGAYLATTLAEYFRDQGKNVILMMDSVTRFAMSSRDVGLAAGEPPTVK 276

Query: 281 GYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNR 340
           GY  S F +LP+LLER G S + KG+IT + +VLV+GD+ NDP+ D+VRSI+DGHIVL+R
Sbjct: 277 GYTPSFFVKLPKLLERAG-SVQGKGSITGIYTVLVEGDDMNDPVGDAVRSIVDGHIVLSR 335

Query: 341 SLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVD 400
            LA +G YP VD LASVSR+     S +  ++      ++  ++   D+  IG Y  G D
Sbjct: 336 KLANQGHYPAVDVLASVSRVMRATVSGEHTRMAQRFREVLAAYQNVEDLISIGAYVDGSD 395

Query: 401 LILDKAVHQVPIIYDFLKQSPSD-LSSEDVFQEIT 434
             +D A   +  +  FL+Q   + +S E+  Q++T
Sbjct: 396 PDVDYAKSMIGKMKQFLRQDMMEGVSYEECVQQLT 430


>gi|86151231|ref|ZP_01069446.1| flagellum-specific ATP synthase FliI [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|121613240|ref|YP_999914.1| flagellum-specific ATP synthase [Campylobacter jejuni subsp. jejuni
           81-176]
 gi|157414504|ref|YP_001481760.1| flagellum-specific ATP synthase [Campylobacter jejuni subsp. jejuni
           81116]
 gi|167004874|ref|ZP_02270632.1| flagellum-specific ATP synthase [Campylobacter jejuni subsp. jejuni
           81-176]
 gi|315123794|ref|YP_004065798.1| flagellum-specific ATP synthase FliI [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
 gi|85841578|gb|EAQ58825.1| flagellum-specific ATP synthase FliI [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|87250392|gb|EAQ73350.1| flagellum-specific ATP synthase FliI [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|157385468|gb|ABV51783.1| flagellum-specific ATP synthase FliI [Campylobacter jejuni subsp.
           jejuni 81116]
 gi|307747146|gb|ADN90416.1| Flagellum-specific ATP synthase [Campylobacter jejuni subsp. jejuni
           M1]
 gi|315017516|gb|ADT65609.1| flagellum-specific ATP synthase FliI [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
          Length = 461

 Score =  274 bits (701), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 165/425 (38%), Positives = 239/425 (56%), Gaps = 12/425 (2%)

Query: 4   NLETL-AQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGD---FVVHQGKNSDNL 59
           NLE L ++L ++   NL    G I+ I++    +  L   V  GD    V ++ +N + L
Sbjct: 2   NLEKLRSKLGKE---NLSAIFGEITKISATSIEIRGLKTGV--GDIVKLVSNENENLNTL 56

Query: 60  GQVIRINLDIVYICPVGIGEEISLGDLVF-HWGRFRISPSACWCGRVINALGKPIDGDDS 118
             V+ I     Y+ P    E   +GD  F      +I  S    GRV++   +P DG  +
Sbjct: 57  AMVVEIKEQFSYLSPFSFIEGFKIGDRAFISDAGMQIGVSDELLGRVVDPFMRPKDGKGA 116

Query: 119 LGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLL 178
           +      M IM     AM R  +E+ F  G++ ID       GQ++G+FAGSG+GKSTL+
Sbjct: 117 IEVSKY-MPIMRAPIDAMKRGLIEEVFPVGVKTIDALLTCGVGQKLGIFAGSGVGKSTLM 175

Query: 179 SMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTA 238
            M  ++      +++L+GERGRE+ EFI+  LG  L  +V++VATSD+S ++RK     A
Sbjct: 176 GMIVKNSKAPIKVVALIGERGREIPEFIQKNLGGKLDDTVIIVATSDDSALMRKYGAFCA 235

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
           +++AEYF  +G +VL I+DS+TRFA + REI    GE P  +GYP SV S LP+L+ER G
Sbjct: 236 MSVAEYFKEQGKDVLFIMDSVTRFAMAQREIGLALGEPPTTKGYPPSVLSLLPQLMERTG 295

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
             E+ KG ITA  +VLVDGD+ +DPIAD  RSILDGHIVL+R L + G YPP++   S S
Sbjct: 296 -KEEGKGTITAFFTVLVDGDDMSDPIADQSRSILDGHIVLSRELTDFGIYPPINIQNSAS 354

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+     S + K        L    +E   +  IG Y+ G D  LD+A+ +   +  FL 
Sbjct: 355 RVMSDIISPEHKLWARKFKRLNSLLKENEVLLRIGAYQKGSDKELDEAISKKEFMQKFLG 414

Query: 419 QSPSD 423
           Q+P +
Sbjct: 415 QNPEE 419


>gi|323191525|gb|EFZ76786.1| flagellum-specific ATP synthase [Escherichia coli RN587/1]
          Length = 446

 Score =  274 bits (701), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 152/376 (40%), Positives = 223/376 (59%), Gaps = 10/376 (2%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFR-ISPSACWCGRVINALGKPIDGDDSL 119
           Q +  N DI Y+ P      +  G  VF   +   I     W GRV+N LG+P+DG   L
Sbjct: 60  QAVGFNRDITYLMPFKQPVGLMAGARVFPEEKAHDILIGESWLGRVVNGLGEPLDGKGRL 119

Query: 120 GKGDLSMEIMSKVPPAMN---RQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKST 176
              DL    +  +PP++N   R+ V++    G++ I+    +  GQR+G+ AGSG+GKS 
Sbjct: 120 NGNDL----LPPLPPSVNPLTRRSVDEPLDVGVKAINGLLTIGKGQRVGLMAGSGVGKSV 175

Query: 177 LLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAP 235
           LL M  R    D V++ L+GERGREV+EFI+  LG D L KS+VVVA +DESP++R  A 
Sbjct: 176 LLGMITRQTKADIVVVGLIGERGREVKEFIDHSLGADGLAKSIVVVAPADESPLMRLKAT 235

Query: 236 LTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLE 295
               +IA +F  +G +VLL++DS+TR+A + REIA + GE P  +GYP S F  +P+L+E
Sbjct: 236 ELCHSIAAWFRDRGHHVLLLVDSLTRYAMAQREIALSLGEPPATKGYPPSAFGMIPKLVE 295

Query: 296 RIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLA 355
             G SE   G++TA+ +VL +GD+  DPI D  R++LDGHIVL R LAE G YP +D   
Sbjct: 296 SAGNSES-SGSMTAIYTVLAEGDDQQDPIVDCARAVLDGHIVLTRKLAEAGHYPAIDIGQ 354

Query: 356 SVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYD 415
           S+SR  ++  S + ++   ++      + E + +  +GGY  G D  +DKAV   P I  
Sbjct: 355 SISRCMNQVTSPEHQQSARAMKQHYAAYMEIKPLIPLGGYVAGADASVDKAVKMFPAIER 414

Query: 416 FLKQSPSDLSSEDVFQ 431
           FL+Q   + +S ++ Q
Sbjct: 415 FLRQEMHEPASLELVQ 430


>gi|315932002|gb|EFV10955.1| flagellar protein export ATPase FliI [Campylobacter jejuni subsp.
           jejuni 327]
          Length = 461

 Score =  274 bits (701), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 165/425 (38%), Positives = 239/425 (56%), Gaps = 12/425 (2%)

Query: 4   NLETL-AQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGD---FVVHQGKNSDNL 59
           NLE L ++L ++   NL    G I+ I++    +  L   V  GD    V ++ +N + L
Sbjct: 2   NLEKLRSKLGKE---NLSAIFGEITKISATSIEIRGLKTGV--GDIVKLVSNENENLNTL 56

Query: 60  GQVIRINLDIVYICPVGIGEEISLGDLVF-HWGRFRISPSACWCGRVINALGKPIDGDDS 118
             V+ I     Y+ P    E   +GD  F      +I  S    GRV++   +P DG  +
Sbjct: 57  AMVVEIKEQFSYLSPFSFIEGFKIGDRAFISDAGMQIGVSDELLGRVVDPFMRPKDGKGA 116

Query: 119 LGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLL 178
           +      M IM     AM R  +E+ F  G++ ID       GQ++G+FAGSG+GKSTL+
Sbjct: 117 IEVSKY-MPIMRAPIDAMKRGLIEEVFPVGVKTIDALLTCGVGQKLGIFAGSGVGKSTLM 175

Query: 179 SMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTA 238
            M  ++      +++L+GERGRE+ EFI+  LG  L  +V++VATSD+S ++RK     A
Sbjct: 176 GMIVKNSKAPIKVVALIGERGREIPEFIQKNLGGKLDDTVIIVATSDDSALMRKYGAFCA 235

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
           +++AEYF  +G +VL I+DS+TRFA + REI    GE P  +GYP SV S LP+L+ER G
Sbjct: 236 MSVAEYFKEQGKDVLFIMDSVTRFAMAQREIGLALGEPPTTKGYPPSVLSLLPQLMERTG 295

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
             E+ KG ITA  +VLVDGD+ +DPIAD  RSILDGHIVL+R L + G YPP++   S S
Sbjct: 296 -KEEGKGTITAFFTVLVDGDDMSDPIADQSRSILDGHIVLSRELTDFGIYPPINIQNSAS 354

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+     S + K        L    +E   +  IG Y+ G D  LD+A+ +   +  FL 
Sbjct: 355 RVMSDIISPEHKLWARKFKRLNSLLKENEVLLRIGAYQKGSDKELDEAISKKEFMQKFLG 414

Query: 419 QSPSD 423
           Q+P +
Sbjct: 415 QNPEE 419


>gi|83589626|ref|YP_429635.1| ATPase FliI/YscN [Moorella thermoacetica ATCC 39073]
 gi|83572540|gb|ABC19092.1| type III secretion system ATPase, FliI/YscN [Moorella thermoacetica
           ATCC 39073]
          Length = 436

 Score =  274 bits (701), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 158/401 (39%), Positives = 240/401 (59%), Gaps = 9/401 (2%)

Query: 22  QGGYISSITSVYYTVTCLSQYVCLGDFV-VHQGKNSDNLGQVIRINLDIVYICPVGIGEE 80
           +GG ++ +T +  T+        +G+   ++   +   + +V+    ++  + P+G  E 
Sbjct: 22  RGGKVTRVTGL--TIEARGLKAAIGELCRIYNNGSGPIVAEVVGFREEVTLLMPLGELEG 79

Query: 81  ISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQ 139
           I  G  V   GR   I       GRV++ LG+ +DG   L  GD    + ++ P  ++R+
Sbjct: 80  IGPGCRVIATGRGHYIRVGEELLGRVLDGLGRSLDGT-VLVSGD-PQPVNNRPPNPLSRR 137

Query: 140 RVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERG 199
           R+++   TG++ ID       GQR+G+FAGSG+GKSTLL M AR    D  +I+L+GERG
Sbjct: 138 RIKEVLATGVKAIDALLTCGCGQRVGIFAGSGVGKSTLLGMIARHSTADINVIALIGERG 197

Query: 200 REVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDS 258
           REVR+FIE  LG + L +S+VV ATSD+  ++R     TA  IAEYF  +G NVLL++DS
Sbjct: 198 REVRDFIEGDLGPEGLARSIVVAATSDQPALVRIKGAFTATAIAEYFRDQGKNVLLMMDS 257

Query: 259 ITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGD 318
           +TRFA + RE+    GE P  RGY  SVF+ LP+L+ER G    E+G+IT + +VLV+GD
Sbjct: 258 LTRFAIAQREVGLAIGEPPTTRGYTPSVFASLPKLVERAG--NGERGSITGLYTVLVEGD 315

Query: 319 NHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTH 378
           + N+P+AD+VR +LDGHIVL+R LA    YP +D L S+SRL  +  S ++++    L  
Sbjct: 316 DMNEPVADTVRGLLDGHIVLSRRLAAANHYPAIDVLQSISRLMPEITSREQQEQAGKLRD 375

Query: 379 LIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
           L+  ++E  D+  IG Y+ G +  +D A+     I  FL+Q
Sbjct: 376 LLAAYQEAADLIEIGAYQAGSNPRVDAALKYHEAIQSFLRQ 416


>gi|116696307|ref|YP_841883.1| flagellum-specific ATP synthase [Ralstonia eutropha H16]
 gi|113530806|emb|CAJ97153.1| Flagellum-specific ATP synthase [Ralstonia eutropha H16]
          Length = 491

 Score =  274 bits (701), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 152/333 (45%), Positives = 208/333 (62%), Gaps = 8/333 (2%)

Query: 91  GRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIM---SKVPPAMNRQRVEKGFKT 147
           G  R+   A   GRV++A G+P+DG   LG    +ME+     ++ P M R  +E    T
Sbjct: 133 GSKRLPVGAGLLGRVLDAAGRPLDG---LGPITAAMEVPLAGEQINPLM-RAPIETVLDT 188

Query: 148 GIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIE 207
           G+R I+    +  GQR+G+FAGSG+GKS LL M AR    D +++ L+GERGREV+EFIE
Sbjct: 189 GVRAINGMLTVGRGQRMGLFAGSGVGKSVLLGMMARYTSADVIVVGLIGERGREVKEFIE 248

Query: 208 DYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSI 266
           + LG +   +SVVV A +D SP+LR      A  +AEYF  +G +VLLI+DS+TR+A + 
Sbjct: 249 NILGPEGRARSVVVAAPADTSPLLRMQGAAYATRLAEYFRDQGQHVLLIMDSLTRYAMAQ 308

Query: 267 REIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIAD 326
           REIA   GE P  +GYP SVF++LP L+ER G   +  G+ITA  +VL +GD+  DPIAD
Sbjct: 309 REIALAIGEPPATKGYPPSVFAKLPTLVERTGNGPEGGGSITAFYTVLTEGDDQQDPIAD 368

Query: 327 SVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEET 386
           S R+ILDGHIVL+RSLAE G YP +D  AS+SR        ++   V     L+ R++  
Sbjct: 369 SARAILDGHIVLSRSLAESGHYPAIDVEASISRAMTALIPDEQFGSVRRFKQLMSRYQRN 428

Query: 387 RDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
           RD+  +G Y PG D  LD A+   P +  FL+Q
Sbjct: 429 RDLISVGAYVPGNDPELDLAMRLHPRMEAFLQQ 461


>gi|170026119|ref|YP_001722624.1| type III secretion system ATPase [Yersinia pseudotuberculosis
           YPIII]
 gi|169752653|gb|ACA70171.1| ATPase, FliI/YscN family [Yersinia pseudotuberculosis YPIII]
          Length = 445

 Score =  274 bits (701), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 157/363 (43%), Positives = 218/363 (60%), Gaps = 6/363 (1%)

Query: 59  LGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRF-RISPSACWCGRVINALGKPIDGDD 117
           L +V+ I  ++  + P    + +  G  V   G   R+   A   GR+++ LG PIDG  
Sbjct: 62  LAEVVSIEQEMALLSPFASSDGLRCGQWVTPLGHMHRVQVGADLAGRILDGLGAPIDGGP 121

Query: 118 SLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
            L  G    E+    P  + RQ VE+   TG R ID       GQRIG+FA +G+GKSTL
Sbjct: 122 PL-TGQWR-ELDCPPPSPLTRQPVEQMLTTGGRAIDGILSCGEGQRIGIFAAAGVGKSTL 179

Query: 178 LSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLK-KSVVVVATSDESPILRKMAPL 236
           LSM       D ++++L+GERGREVREF+E  L    + ++VVVVATSD   + R     
Sbjct: 180 LSMLCADSAADVMVLALIGERGREVREFLEQVLTPEARARTVVVVATSDRPALERLKGLS 239

Query: 237 TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLER 296
           TA T+AEYF  +G  VLL+ DS+TR+A + REI   +GE P A  +P SVF+ LPRLLER
Sbjct: 240 TATTVAEYFRERGLKVLLLADSLTRYARAAREIGLAAGEPPAAGSFPPSVFANLPRLLER 299

Query: 297 IGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLAS 356
            G S++  G+ITA  +VLV+GD+ N+P+AD VRS+LDGHIVL+R LA  G YP +D  AS
Sbjct: 300 TGNSDR--GSITAFYTVLVEGDDMNEPVADEVRSLLDGHIVLSRRLAGAGHYPAIDIAAS 357

Query: 357 VSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDF 416
           VSR+  +  SA +  +   L  ++  ++E   +  IG Y+ G DL  D+A+ + P I  F
Sbjct: 358 VSRIMPQIVSAGQLAMAQKLRRMLACYQEIELLVQIGEYQAGEDLQADEALQRYPAICAF 417

Query: 417 LKQ 419
           L+Q
Sbjct: 418 LQQ 420


>gi|310641546|ref|YP_003946304.1| flagellar protein export atpase flii [Paenibacillus polymyxa SC2]
 gi|309246496|gb|ADO56063.1| Flagellar protein export ATPase FliI [Paenibacillus polymyxa SC2]
          Length = 439

 Score =  274 bits (701), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 156/387 (40%), Positives = 241/387 (62%), Gaps = 8/387 (2%)

Query: 50  VHQGKNSDNL-GQVIRINLDIVYICPVGIGEEISLG-DLVFHWGRFRISPSACWCGRVIN 107
           ++ GK +  L  +V+    + V + P+G  + I  G D+V       +   +   G+V++
Sbjct: 48  IYPGKAAKPLQAEVVGFRDNKVLLMPLGELQSIGPGCDVVGTGKPLNVQVGSELLGKVLD 107

Query: 108 ALGKPIDGDDSLGKGDLSMEIMSKVPP-AMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGV 166
            LG+P+DG  SL    ++      +P   +NR RV++    G+R ID    +  GQR+G+
Sbjct: 108 GLGQPLDG--SLIPSRMARYSTFNIPSNPLNRPRVQEPISIGVRAIDGLLTIGKGQRVGI 165

Query: 167 FAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSD 225
           FAGSG+GKSTL+ M AR+   D  +I+L+GERGREV +FIE  LG + L++SVV+VATSD
Sbjct: 166 FAGSGVGKSTLMGMIARNTEADVNVIALIGERGREVLDFIERDLGPEGLERSVVIVATSD 225

Query: 226 ESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTS 285
           +  ++R    L A TIAEYF  +G NV+L++DS+TR+A + RE+    GE P  RGY  S
Sbjct: 226 QPALIRIKGALIATTIAEYFRDRGLNVMLMMDSVTRYAMAQREVGLAVGEPPAMRGYTPS 285

Query: 286 VFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEE 345
           VF+ LP+LLER G      G+ITA  +VLVDGD+ N+PIAD+VR ILDGHIVLNR +A +
Sbjct: 286 VFASLPKLLERAGTGPT--GSITAFYTVLVDGDDMNEPIADAVRGILDGHIVLNRGIANK 343

Query: 346 GRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDK 405
           G +P +D LAS+SR+     + D+     ++  L+  ++++ D+  IG Y+ G +  +D+
Sbjct: 344 GHFPAIDVLASISRVMKDIATRDQIDAAENIKRLMAIYKDSEDLINIGAYQQGSNAEIDE 403

Query: 406 AVHQVPIIYDFLKQSPSDLSSEDVFQE 432
           ++ ++  I+DF +Q   + +  D  +E
Sbjct: 404 SMERIRDIWDFTRQRTDEKAELDEVRE 430


>gi|304404247|ref|ZP_07385909.1| ATPase, FliI/YscN family [Paenibacillus curdlanolyticus YK9]
 gi|304347225|gb|EFM13057.1| ATPase, FliI/YscN family [Paenibacillus curdlanolyticus YK9]
          Length = 441

 Score =  274 bits (701), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 158/380 (41%), Positives = 237/380 (62%), Gaps = 10/380 (2%)

Query: 61  QVIRINLDIVYICPVGIGEEISLG-DLVFHWGRFRISPSACWCGRVINALGKPIDGDDSL 119
           +V+    + V + P+G  E I  G D+V       +   +   G+V++ LG+P+DG  S 
Sbjct: 62  EVVGFKDNKVILMPLGELESIGPGCDVVGTGKPLTVQVGSELLGKVLDGLGQPLDG--SF 119

Query: 120 GKGDLSMEIMSKVP--PAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
               +     + VP  P M R RV++    G+R ID    +  GQR+G+FAGSG+GKSTL
Sbjct: 120 IPSRMPHSSTNNVPNNPLM-RPRVKQPLGIGVRAIDGLLTVGQGQRVGIFAGSGVGKSTL 178

Query: 178 LSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPL 236
           L M AR+   D  +I+L+GERGREV EFIE  LG + L +SVV+VATSD+  ++R    L
Sbjct: 179 LGMIARNTSADVNVIALIGERGREVLEFIEKDLGPEGLARSVVIVATSDQPALIRMKGAL 238

Query: 237 TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLER 296
            A TIAEYF  +G NV+L++DS+TR+A ++RE+    GE P  RGY  SVF+ LP+LLER
Sbjct: 239 IATTIAEYFRDRGLNVMLMMDSVTRYAMALREVGLAIGEPPATRGYTPSVFAALPKLLER 298

Query: 297 IGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLAS 356
            G      G+ITA  +VLVDGD+ N+PIAD+VR ILDGHIVL+R LA +G +P +D LAS
Sbjct: 299 AGTGPT--GSITAFYTVLVDGDDMNEPIADAVRGILDGHIVLSRDLAHQGHFPAIDVLAS 356

Query: 357 VSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDF 416
           +SR+  +  + +++   +SL  L+  ++ + D+  IG Y+ G +  +D+A+  +  I  +
Sbjct: 357 ISRVMKEIVTDEQQDAANSLKGLLATYKSSEDLINIGAYQYGSNAKIDQAIEAIDEIRAY 416

Query: 417 LKQSPSD-LSSEDVFQEITK 435
            +Q  ++ +  ED  Q++ +
Sbjct: 417 TRQKTNEKVILEDAQQQLIQ 436


>gi|255523701|ref|ZP_05390667.1| ATPase FliI/YscN [Clostridium carboxidivorans P7]
 gi|296186704|ref|ZP_06855106.1| flagellar protein export ATPase FliI [Clostridium carboxidivorans
           P7]
 gi|255512570|gb|EET88844.1| ATPase FliI/YscN [Clostridium carboxidivorans P7]
 gi|296048741|gb|EFG88173.1| flagellar protein export ATPase FliI [Clostridium carboxidivorans
           P7]
          Length = 435

 Score =  274 bits (701), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 153/339 (45%), Positives = 220/339 (64%), Gaps = 15/339 (4%)

Query: 103 GRVINALGKPIDGDD-SLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHG 161
           G+V++ LG+P++G++  +G       + ++ P  + R+R+++   TGIR ID FT    G
Sbjct: 102 GKVLDGLGQPLNGEEIDIGT---VYPLDTEPPDPLKRRRIKEVIPTGIRAIDGFTTCGEG 158

Query: 162 QRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVV 220
           QRIG+FAGSG+GKST L M AR    D  +I+L+GERGREV++FIE  LG+  +KKS++V
Sbjct: 159 QRIGIFAGSGVGKSTTLGMIARYAEADVNVIALIGERGREVKDFIEKDLGEEGMKKSIIV 218

Query: 221 VATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVAR 280
            ATSD+  ++R     TA  IAEYF  +G+ V+L++DS+TRFA + REI    GE P  +
Sbjct: 219 CATSDKPALVRLKGAFTATAIAEYFRDRGNKVILMMDSVTRFAMAQREIGLAIGEPPATK 278

Query: 281 GYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNR 340
           GY  SVF+ LPRL+ER G S+K  G+ITA  +VLVDGD+ N+PIAD+VR ILDGHIVL+R
Sbjct: 279 GYTPSVFAMLPRLMERAGMSDK--GSITAFYTVLVDGDDFNEPIADAVRGILDGHIVLSR 336

Query: 341 SLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVD 400
           +LA +  YP +D L+S+SRL  +    + KK  S    L+  ++ + D+  IG Y  G +
Sbjct: 337 ALAAKNHYPAIDILSSISRLMSEVAEDEHKKAASFARDLLATYKNSEDLINIGAYVKGSN 396

Query: 401 LILDKAVHQVPIIYDFLKQ--------SPSDLSSEDVFQ 431
             +D ++     I  +LKQ        S S LS E++FQ
Sbjct: 397 EKVDTSIQYYDDIIGYLKQGMKEHTTFSESVLSLENIFQ 435


>gi|15639393|ref|NP_218842.1| flagellum-specific ATP synthase (fliI) [Treponema pallidum subsp.
           pallidum str. Nichols]
 gi|189025635|ref|YP_001933407.1| flagellum-specific ATP synthase [Treponema pallidum subsp. pallidum
           SS14]
 gi|6016024|sp|O83417|FLII_TREPA RecName: Full=Flagellum-specific ATP synthase
 gi|3322685|gb|AAC65390.1| flagellum-specific ATP synthase (fliI) [Treponema pallidum subsp.
           pallidum str. Nichols]
 gi|189018210|gb|ACD70828.1| flagellum-specific ATP synthase [Treponema pallidum subsp. pallidum
           SS14]
 gi|291059792|gb|ADD72527.1| flagellar protein export ATPase FliI [Treponema pallidum subsp.
           pallidum str. Chicago]
          Length = 447

 Score =  274 bits (701), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 148/325 (45%), Positives = 202/325 (62%), Gaps = 4/325 (1%)

Query: 100 CWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLC 159
              GRV+NA GK IDG   +    L  E++      M R  + +   TG+RV+D    + 
Sbjct: 100 ALLGRVLNAFGKAIDGKGEI-YAPLRSEVLRASSNPMERLPITRQMVTGVRVLDSLLAVG 158

Query: 160 HGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSV 218
            GQR+G+F+GSG+GKSTL+ M AR+   D  +I+L+GERGREV +F+   LG + LK+SV
Sbjct: 159 CGQRLGIFSGSGVGKSTLMGMIARNTDADVSVIALIGERGREVMDFVAHDLGPEGLKRSV 218

Query: 219 VVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPV 278
           +V ATSDESP+ R     TA  IAEYF  +G  VLL+ DS+TRFA + REI   SGELP 
Sbjct: 219 IVSATSDESPLARVRGAYTATAIAEYFRDQGKQVLLLFDSLTRFAKAQREIGLASGELPA 278

Query: 279 ARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVL 338
            RGY   VF  LP+LLER G      G++TA  +VLVDGD+ ++PI+D+VR I+DGHIVL
Sbjct: 279 TRGYTPGVFETLPKLLERAG--SFSMGSVTAFYTVLVDGDDLDEPISDAVRGIVDGHIVL 336

Query: 339 NRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPG 398
           +R+LA+   YP +D L SVSRLA +   AD K+ V  +   +  + E  D+  +G Y+ G
Sbjct: 337 SRALAQRNHYPAIDVLQSVSRLAHRVLGADMKEAVRIVRRALAVYAEVEDLVRVGAYQQG 396

Query: 399 VDLILDKAVHQVPIIYDFLKQSPSD 423
            D  LD+A+     +  FL Q   +
Sbjct: 397 SDAELDRAIAMRAELERFLTQGAQE 421


>gi|57237200|ref|YP_178212.1| flagellum-specific ATP synthase [Campylobacter jejuni RM1221]
 gi|57166004|gb|AAW34783.1| flagellum-specific ATP synthase FliI [Campylobacter jejuni RM1221]
 gi|315057632|gb|ADT71961.1| Flagellum-specific ATP synthase FliI [Campylobacter jejuni subsp.
           jejuni S3]
          Length = 461

 Score =  274 bits (700), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 165/425 (38%), Positives = 240/425 (56%), Gaps = 12/425 (2%)

Query: 4   NLETL-AQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGD---FVVHQGKNSDNL 59
           NLE L ++L ++   NL    G I+ I++    +  L   V  GD    V ++ +N + L
Sbjct: 2   NLEKLRSKLGKE---NLSAIFGEITKISATSIEIRGLKTGV--GDIVKLVSNENENLNTL 56

Query: 60  GQVIRINLDIVYICPVGIGEEISLGDLVF-HWGRFRISPSACWCGRVINALGKPIDGDDS 118
             V+ I     Y+ P    E   +GD  F      +I  S    GRV++   +P DG  +
Sbjct: 57  AMVVEIKEQFSYLSPFSFIEGFKIGDRAFISDAGMQIGVSDELLGRVVDPFMRPKDGKGA 116

Query: 119 LGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLL 178
           + +    M IM     AM R  +E+ F  G++ ID       GQ++G+FAGSG+GKSTL+
Sbjct: 117 I-EVTKYMPIMRAPIDAMKRGLIEEVFPVGVKTIDALLTCGVGQKLGIFAGSGVGKSTLM 175

Query: 179 SMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTA 238
            M  ++      +++L+GERGRE+ EFI+  LG  L  +V++VATSD+S ++RK     A
Sbjct: 176 GMIVKNSKAPIKVVALIGERGREIPEFIQKNLGGKLDDTVIIVATSDDSALMRKYGAFCA 235

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
           +++AEYF  +G +VL I+DS+TRFA + REI    GE P  +GYP SV S LP+L+ER G
Sbjct: 236 MSVAEYFKEQGKDVLFIMDSVTRFAMAQREIGLALGEPPTTKGYPPSVLSLLPQLMERTG 295

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
             E+ KG ITA  +VLVDGD+ +DPIAD  RSILDGHIVL+R L + G YPP++   S S
Sbjct: 296 -KEEGKGTITAFFTVLVDGDDMSDPIADQSRSILDGHIVLSRELTDFGIYPPINIQNSAS 354

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+     S + K        L    +E   +  IG Y+ G D  LD+A+ +   +  FL 
Sbjct: 355 RVMSDIISPEHKLWARKFKRLNSLLKENEVLLRIGAYQKGSDKELDEAISKKEFMQKFLG 414

Query: 419 QSPSD 423
           Q+P +
Sbjct: 415 QNPEE 419


>gi|149908454|ref|ZP_01897117.1| flagellum-specific ATP synthase [Moritella sp. PE36]
 gi|149808617|gb|EDM68552.1| flagellum-specific ATP synthase [Moritella sp. PE36]
          Length = 445

 Score =  274 bits (700), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 137/318 (43%), Positives = 201/318 (63%), Gaps = 2/318 (0%)

Query: 103 GRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQ 162
           GRV++ +GKPIDG   +  G  +     ++ P + R+++ K    G++ I+    +  GQ
Sbjct: 102 GRVLDGVGKPIDGKGEIITGQTTSFTAKRINP-LARKKISKPLDVGVKAINAMLTVGQGQ 160

Query: 163 RIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVVV 221
           R+G+FAGSG+GKS LL M  R    D V++ L+GERGREV+EFIE+ LG+  L +SVVV 
Sbjct: 161 RMGLFAGSGVGKSVLLGMMTRGSTADVVVVGLIGERGREVKEFIEEILGEEGLARSVVVA 220

Query: 222 ATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARG 281
           A +D SP++R     T++ IAEYF  +G NVLL++DS+TRFA + REIA   GE P  +G
Sbjct: 221 APADSSPLMRLKGCETSLAIAEYFRDQGLNVLLLMDSLTRFAQAQREIALAVGEPPATKG 280

Query: 282 YPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRS 341
           YP SVF++LP+L+ER G    E+G+ITA  +VL +GD+  DPIAD+ R+ILDGHIVL+R 
Sbjct: 281 YPPSVFAKLPQLVERAGNGSDEQGSITAFFTVLTEGDDLQDPIADAARAILDGHIVLSRE 340

Query: 342 LAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDL 401
           L + G YP +D   S+SR+     +   +            +++ +D+  IG Y  G D 
Sbjct: 341 LTDAGHYPAIDIEKSISRVMPMVTTDFHQAAARGFKQAYSLYQQNKDLVAIGAYSKGSDA 400

Query: 402 ILDKAVHQVPIIYDFLKQ 419
            +D+A+   P +  FL+Q
Sbjct: 401 KIDRAIRLKPAMDQFLQQ 418


>gi|110677657|ref|YP_680664.1| flagellum-specific ATP synthase [Roseobacter denitrificans OCh 114]
 gi|109453773|gb|ABG29978.1| flagellum-specific ATP synthase [Roseobacter denitrificans OCh 114]
          Length = 449

 Score =  274 bits (700), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 151/386 (39%), Positives = 229/386 (59%), Gaps = 2/386 (0%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISL 83
           G +  + +    ++ L+    +GD VV   +     G++++++ D + I P    E ++L
Sbjct: 24  GRVCRVEAGVIHISGLAGKARIGDLVVVYRQGEPLSGEILQLDGDTLVILPDQDAEGVAL 83

Query: 84  GDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEK 143
            D         I+PS  W GR+I+  G PIDG   L +G  +  + S  P    R+ +  
Sbjct: 84  NDRAALLEARGIAPSQGWIGRIIDPFGNPIDGKPLL-RGAEARSLRSAPPEPALRRPMGT 142

Query: 144 GFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVR 203
              TG+ V++   P+  GQR+G+FAGSG+GKS+LL   A++   D V+++L+GERGRE+R
Sbjct: 143 RLNTGMSVLNTMLPVVKGQRVGLFAGSGVGKSSLLGHLAQNMTADVVVVALIGERGRELR 202

Query: 204 EFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRF 262
            F+E+ LG + LK+SVV+ ATSD+SP++R+     A+++AE+F   G + L++ DSITRF
Sbjct: 203 HFVEEVLGPEGLKRSVVICATSDQSPLIRRRCAWAAMSVAEHFRDMGLSALILADSITRF 262

Query: 263 AHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHND 322
           A + RE+A  SGE PV RGYP S    +  L ER GP E  +G+IT + SVLV G +  +
Sbjct: 263 AEAHREVAVASGEAPVLRGYPPSTAHLIMSLCERAGPGEGAQGDITGIFSVLVAGSDMEE 322

Query: 323 PIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHR 382
           PIAD +R +LDGHIVLNR +AE GRYP +D L S+SR    A    E +L+S +   +  
Sbjct: 323 PIADILRGVLDGHIVLNREIAERGRYPAIDVLKSISRSLPAAADDIENELISIVRRYLSI 382

Query: 383 FEETRDIRLIGGYRPGVDLILDKAVH 408
           +E+   +   G Y  G D  +D A+ 
Sbjct: 383 YEQNEMMIRAGLYSQGSDPDIDAAIQ 408


>gi|150390484|ref|YP_001320533.1| flagellar protein export ATPase FliI [Alkaliphilus metalliredigens
           QYMF]
 gi|149950346|gb|ABR48874.1| flagellar protein export ATPase FliI [Alkaliphilus metalliredigens
           QYMF]
          Length = 436

 Score =  274 bits (700), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 158/373 (42%), Positives = 228/373 (61%), Gaps = 11/373 (2%)

Query: 70  VYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEI 128
           V + P+G  E I  G  V   G    I+      GR+++ LG PIDG   +        +
Sbjct: 69  VLLMPLGEMEGIGPGSKVEATGSTLSINVGEALLGRILDGLGNPIDGKGPIEAHTAYPAM 128

Query: 129 MSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFD 188
            S V P + R+ +++    G++ ID      +GQRIG+FAGSG+GKSTLL M AR+   D
Sbjct: 129 GSPVNPLL-RKTIKEPLSLGVKAIDGLLSCGNGQRIGIFAGSGVGKSTLLGMIARNTRAD 187

Query: 189 KVIISLVGERGREVREFIE-DYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSS 247
             +I+L+GERGREV+EFIE D   + LK+SVV+VATSD+  ++R    L A ++AEYF  
Sbjct: 188 INVIALIGERGREVKEFIEKDLKEEGLKRSVVIVATSDQPALIRMKGALLATSVAEYFRD 247

Query: 248 KGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNI 307
              NV+L++DS+TRF+ + RE+    GE PV +GY  SVF+ LP+LLER G S+K  G I
Sbjct: 248 HNKNVMLLMDSLTRFSMAQREVGLAIGEPPVTKGYTPSVFAILPKLLERSGTSDK--GAI 305

Query: 308 TAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSA 367
           T + +VLVDGD+ N+PIAD+VR ILDGHIVL+R +A    YP +D LASVSR+ D     
Sbjct: 306 TGLYTVLVDGDDMNEPIADAVRGILDGHIVLSRKIANRNHYPAIDVLASVSRVMDSIVGK 365

Query: 368 DEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSE 427
           +  KL + L  ++  + +  D+  IG Y  G +  +D+A+ ++  + +FL Q+  +   +
Sbjct: 366 EHIKLANELKEILSTYNDAEDLINIGAYVKGSNPKIDRAIEKIDAVNEFLIQTTDE---K 422

Query: 428 DVFQE---ITKKL 437
             FQE   I KK+
Sbjct: 423 ITFQESVDIMKKI 435


>gi|170682099|ref|YP_001742360.1| lateral flagellar export/assembly protein LfiI [Escherichia coli
           SMS-3-5]
 gi|170519817|gb|ACB17995.1| lateral flagellar export/assembly protein LfiI [Escherichia coli
           SMS-3-5]
          Length = 445

 Score =  274 bits (700), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 152/376 (40%), Positives = 223/376 (59%), Gaps = 10/376 (2%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFR-ISPSACWCGRVINALGKPIDGDDSL 119
           Q +  N DI Y+ P      +  G  VF   +   I     W GRV+N LG+P+DG   L
Sbjct: 60  QAVGFNRDITYLMPFKQPVGLMAGARVFPEEKAHDILIGESWLGRVVNGLGEPLDGKGRL 119

Query: 120 GKGDLSMEIMSKVPPAMN---RQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKST 176
              DL    +  +PP++N   R+ V++    G++ I+    +  GQR+G+ AGSG+GKS 
Sbjct: 120 NGNDL----LPPLPPSVNPLTRRSVDEPLDVGVKAINGLLTIGKGQRVGLMAGSGVGKSV 175

Query: 177 LLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAP 235
           LL M  R    D V++ L+GERGREV+EFI+  LG D L KS+VVVA +DESP++R  A 
Sbjct: 176 LLGMITRQTKADIVVVGLIGERGREVKEFIDHSLGADGLAKSIVVVAPADESPLMRLKAT 235

Query: 236 LTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLE 295
               ++A +F  +G +VLL++DS+TR+A + REIA + GE P  +GYP S F  +P+L+E
Sbjct: 236 ELCHSVAAWFRDRGHHVLLLVDSLTRYAMAQREIALSLGEPPATKGYPPSAFGMIPKLVE 295

Query: 296 RIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLA 355
             G SE   G++TA+ +VL +GD+  DPI D  R++LDGHIVL R LAE G YP +D   
Sbjct: 296 SAGNSES-AGSMTAIYTVLAEGDDQQDPIVDCARAVLDGHIVLTRKLAEAGHYPAIDIGQ 354

Query: 356 SVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYD 415
           S+SR  ++  S + ++   +L      + E + +  +GGY  G D  +DKAV   P I  
Sbjct: 355 SISRCMNQVTSLEHQQSARALKQNYAAYMEIKPLIPLGGYVAGADASVDKAVKMFPAIER 414

Query: 416 FLKQSPSDLSSEDVFQ 431
           FL+Q   + +S ++ Q
Sbjct: 415 FLRQEMREPASLELVQ 430


>gi|83816428|ref|YP_446712.1| flagellar protein export ATPase FliI [Salinibacter ruber DSM 13855]
 gi|83757822|gb|ABC45935.1| flagellar protein export ATPase FliI [Salinibacter ruber DSM 13855]
          Length = 442

 Score =  274 bits (700), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 156/320 (48%), Positives = 203/320 (63%), Gaps = 4/320 (1%)

Query: 101 WCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCH 160
             GRVI+A G+PIDG   LG  D    I    P  ++R  ++    TGIR ID F  +  
Sbjct: 102 LLGRVIDAGGRPIDGKGPLGT-DAREPIHRDPPSPLDRPLIDTPLSTGIRSIDAFLKMGK 160

Query: 161 GQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVV 219
           GQR G+FAGSG+GKSTLL M AR    D  +I+L+GERGREVREFI D LG+  L++SV+
Sbjct: 161 GQRTGIFAGSGVGKSTLLGMIARRAEADVNVIALIGERGREVREFIVDNLGEEGLRRSVL 220

Query: 220 VVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVA 279
           V  T DE+ + R  A   A+ IAE+F  +G +VLL++DSITR A + REI    GE P  
Sbjct: 221 VAVTGDEAAMSRVKAASAAMAIAEHFRDRGQDVLLMMDSITRVAQAQREIGLAVGEPPTR 280

Query: 280 RGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLN 339
           RGYP SVF+ LPRLLER GP+E   G IT + +VLV+GD+ ++PI+D+ R ILDGHIVL+
Sbjct: 281 RGYPPSVFALLPRLLERAGPAEA--GTITGIFTVLVEGDDMSEPISDAARGILDGHIVLS 338

Query: 340 RSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGV 399
           R LAE G YP VD L SVSR+  +  S + +        L+  +EE  D+  +G Y  G 
Sbjct: 339 RELAEAGHYPAVDVLQSVSRVMPRVASLEAEAAAQEARELLSAYEEVEDLISVGAYEEGS 398

Query: 400 DLILDKAVHQVPIIYDFLKQ 419
           D   D+AV   P + DFL+Q
Sbjct: 399 DPETDRAVEAYPALADFLQQ 418


>gi|294508647|ref|YP_003572706.1| flagellum-specific ATP synthase [Salinibacter ruber M8]
 gi|294344976|emb|CBH25754.1| Flagellum-specific ATP synthase [Salinibacter ruber M8]
          Length = 448

 Score =  274 bits (700), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 156/320 (48%), Positives = 203/320 (63%), Gaps = 4/320 (1%)

Query: 101 WCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCH 160
             GRVI+A G+PIDG   LG  D    I    P  ++R  ++    TGIR ID F  +  
Sbjct: 108 LLGRVIDAGGRPIDGKGPLGT-DAREPIHRDPPSPLDRPLIDTPLSTGIRSIDAFLKMGK 166

Query: 161 GQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVV 219
           GQR G+FAGSG+GKSTLL M AR    D  +I+L+GERGREVREFI D LG+  L++SV+
Sbjct: 167 GQRTGIFAGSGVGKSTLLGMIARRAEADVNVIALIGERGREVREFIVDNLGEEGLRRSVL 226

Query: 220 VVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVA 279
           V  T DE+ + R  A   A+ IAE+F  +G +VLL++DSITR A + REI    GE P  
Sbjct: 227 VAVTGDEAAMSRVKAASAAMAIAEHFRDRGQDVLLMMDSITRVAQAQREIGLAVGEPPTR 286

Query: 280 RGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLN 339
           RGYP SVF+ LPRLLER GP+E   G IT + +VLV+GD+ ++PI+D+ R ILDGHIVL+
Sbjct: 287 RGYPPSVFALLPRLLERAGPAEA--GTITGIFTVLVEGDDMSEPISDAARGILDGHIVLS 344

Query: 340 RSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGV 399
           R LAE G YP VD L SVSR+  +  S + +        L+  +EE  D+  +G Y  G 
Sbjct: 345 RELAEAGHYPAVDVLQSVSRVMPRVASLEAEAAAQEARELLSAYEEVEDLISVGAYEEGS 404

Query: 400 DLILDKAVHQVPIIYDFLKQ 419
           D   D+AV   P + DFL+Q
Sbjct: 405 DPETDRAVEAYPALADFLQQ 424


>gi|195941358|ref|ZP_03086740.1| flagellum-specific ATP synthase (fliI) [Borrelia burgdorferi 80a]
 gi|216264447|ref|ZP_03436439.1| flagellar protein export ATPase FliI [Borrelia burgdorferi 156a]
 gi|215980920|gb|EEC21727.1| flagellar protein export ATPase FliI [Borrelia burgdorferi 156a]
          Length = 436

 Score =  274 bits (700), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 148/341 (43%), Positives = 222/341 (65%), Gaps = 4/341 (1%)

Query: 81  ISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQ 139
           I +G+ V+   +   I+ S    GRVI++LG+PID   S         I  K+ P +NR 
Sbjct: 78  IEVGNKVYSLNKGLEINLSDELLGRVIDSLGRPIDNKGSFLNNSYKELIFEKINP-INRS 136

Query: 140 RVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERG 199
             E    TG++V+D F P+  GQR+G+F+GSG+GKSTLLSM A++   D  +I+ +GERG
Sbjct: 137 IFEDQILTGVKVLDGFLPVAKGQRVGIFSGSGVGKSTLLSMIAKNSNADVNVIAFIGERG 196

Query: 200 REVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDS 258
           RE+ EFIE  LG+  LKKSV+VV+TSDESPI R      A  IAEYF  +G +V+L+ DS
Sbjct: 197 RELNEFIEHELGEERLKKSVLVVSTSDESPISRYKGAYVATMIAEYFREQGKDVVLLFDS 256

Query: 259 ITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGD 318
           ITRFA++ RE++ + GE PVA+GYP SVF E+P LLER G +    G++T   +VLV+GD
Sbjct: 257 ITRFANAKREMSLSLGEPPVAKGYPPSVFVEIPILLERSGFN-GNGGSVTGFYTVLVEGD 315

Query: 319 NHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTH 378
           +  +P+AD+++++LDGHI+L+R L + G YP ++ L+S SR   +  S +++KL+    +
Sbjct: 316 DFTEPVADNIKAVLDGHIILDRDLFDRGIYPSINVLSSTSRSIHRIMSLEKQKLIMKARN 375

Query: 379 LIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
           L+  +++  D+   G Y  G +  +D A+ + P I +F+ Q
Sbjct: 376 LLSIYKDYEDLIRTGIYLKGSNKDVDFAISKYPKIINFISQ 416


>gi|308068655|ref|YP_003870260.1| flagellum-specific ATP synthase [Paenibacillus polymyxa E681]
 gi|305857934|gb|ADM69722.1| Flagellum-specific ATP synthase [Paenibacillus polymyxa E681]
          Length = 439

 Score =  274 bits (700), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 156/387 (40%), Positives = 240/387 (62%), Gaps = 8/387 (2%)

Query: 50  VHQGKNSDNL-GQVIRINLDIVYICPVGIGEEISLG-DLVFHWGRFRISPSACWCGRVIN 107
           ++ GK +  L  +V+    + V + P+G  + I  G D+V       +   +   G+V++
Sbjct: 48  IYPGKTAKPLQAEVVGFRDNKVLLMPLGELQSIGPGCDVVGTGKPLNVQVGSELLGKVLD 107

Query: 108 ALGKPIDGDDSLGKGDLSMEIMSKVPP-AMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGV 166
            LG+P+DG  SL    ++      +P   +NR RV++    G+R ID    +  GQR+G+
Sbjct: 108 GLGQPLDG--SLIPSRMARYSTFNIPSNPLNRPRVQEPISIGVRAIDGLLTIGKGQRVGI 165

Query: 167 FAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSD 225
           FAGSG+GKSTL+ M AR+   D  +I+L+GERGREV +FIE  LG + L++SVV+VATSD
Sbjct: 166 FAGSGVGKSTLMGMIARNTEADVNVIALIGERGREVLDFIERDLGPEGLERSVVIVATSD 225

Query: 226 ESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTS 285
           +  ++R    L A TIAEYF  +G NV+L++DS+TR+A + RE+    GE P  RGY  S
Sbjct: 226 QPALIRIKGALIATTIAEYFRDRGLNVMLMMDSVTRYAMAQREVGLAVGEPPAMRGYTPS 285

Query: 286 VFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEE 345
           VF+ LP+LLER G      G+ITA  +VLVDGD+ N+PIAD+VR ILDGHIVLNR +A +
Sbjct: 286 VFASLPKLLERAGTGPT--GSITAFYTVLVDGDDMNEPIADAVRGILDGHIVLNRGIANK 343

Query: 346 GRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDK 405
           G +P +D LAS+SR+       D+     ++  L+  ++++ D+  IG Y+ G +  +D+
Sbjct: 344 GHFPAIDVLASISRVMKDIAPRDQIDAAENIKRLMAVYKDSEDLINIGAYQQGSNAEIDE 403

Query: 406 AVHQVPIIYDFLKQSPSDLSSEDVFQE 432
           ++ ++  I+DF +Q   + +  D  +E
Sbjct: 404 SMERIRDIWDFTRQRTDEKAELDEVRE 430


>gi|153951633|ref|YP_001397442.1| flagellum-specific ATP synthase [Campylobacter jejuni subsp. doylei
           269.97]
 gi|152939079|gb|ABS43820.1| flagellum-specific ATP synthase FliI [Campylobacter jejuni subsp.
           doylei 269.97]
          Length = 461

 Score =  274 bits (700), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 164/425 (38%), Positives = 240/425 (56%), Gaps = 12/425 (2%)

Query: 4   NLETL-AQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGD---FVVHQGKNSDNL 59
           NLE L ++L ++   NL    G I+ I++    +  L     +GD    V ++ +N + L
Sbjct: 2   NLEKLRSKLGKE---NLSAIFGEITKISATSIEIRGLK--TGIGDIVKLVSNENENLNTL 56

Query: 60  GQVIRINLDIVYICPVGIGEEISLGDLVF-HWGRFRISPSACWCGRVINALGKPIDGDDS 118
             V+ I     Y+ P    E   +GD  F      +I  S    GRV++   +P DG  +
Sbjct: 57  AMVVEIKEQFSYLSPFSFIEGFKIGDRAFISDAGMQIGVSDELLGRVVDPFMRPKDGKGA 116

Query: 119 LGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLL 178
           + +    M IM     AM R  +E+ F  G++ ID       GQ++G+FAGSG+GKSTL+
Sbjct: 117 I-EVTKYMPIMRAPIDAMKRGLIEEVFPVGVKTIDALLTCGVGQKLGIFAGSGVGKSTLM 175

Query: 179 SMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTA 238
            M  ++      +++L+GERGRE+ EFI+  LG  L  +V++VATSD+S ++RK     A
Sbjct: 176 GMIVKNSKAPIKVVALIGERGREIPEFIQKNLGGKLDDTVIIVATSDDSALMRKYGAFCA 235

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
           +++AEYF  +G +VL I+DS+TRFA + REI    GE P  +GYP SV S LP+L+ER G
Sbjct: 236 MSVAEYFKEQGKDVLFIMDSVTRFAMAQREIGLALGEPPTTKGYPPSVLSLLPQLMERTG 295

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
             E+ KG ITA  +VLVDGD+ +DPIAD  RSILDGHIVL+R L + G YPP++   S S
Sbjct: 296 -KEEGKGTITAFFTVLVDGDDMSDPIADQSRSILDGHIVLSRELTDFGIYPPINIQNSAS 354

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+     S + K        L    +E   +  IG Y+ G D  LD+A+ +   +  FL 
Sbjct: 355 RVMSDIISPEHKLWARKFKRLNSLLKENEVLLRIGAYQKGSDKELDEAISKKEFMQKFLG 414

Query: 419 QSPSD 423
           Q+P +
Sbjct: 415 QNPEE 419


>gi|126445125|ref|YP_001061232.1| flagellum-specific ATP synthase [Burkholderia pseudomallei 668]
 gi|254182906|ref|ZP_04889499.1| flagellum-specific ATP synthase [Burkholderia pseudomallei 1655]
 gi|254299701|ref|ZP_04967150.1| flagellum-specific ATP synthase [Burkholderia pseudomallei 406e]
 gi|126224616|gb|ABN88121.1| flagellum-specific ATP synthase FliI [Burkholderia pseudomallei
           668]
 gi|157809533|gb|EDO86703.1| flagellum-specific ATP synthase [Burkholderia pseudomallei 406e]
 gi|184213440|gb|EDU10483.1| flagellum-specific ATP synthase [Burkholderia pseudomallei 1655]
          Length = 435

 Score =  273 bits (699), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 161/397 (40%), Positives = 225/397 (56%), Gaps = 9/397 (2%)

Query: 46  GDFVVHQGKNSDNL-GQVIRINLDIVYICPVGIGEEISLGDLVF---HWGRFRISPSACW 101
           G+  V +  + D +  QV+  N +  ++ P      +  G  V      G  RI  S  W
Sbjct: 41  GERCVIESADGDRIDAQVVGFNREETFLMPFKKPVGLVAGAQVLSCERQGLLRIGRS--W 98

Query: 102 CGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHG 161
            GR++N LG+ IDG   LG GD  +         + ++ V      G+R I+    L  G
Sbjct: 99  LGRIVNGLGEAIDGRGPLG-GDAVLRAHPAPVNPLRKRPVRDVLDVGVRAINGLLTLGRG 157

Query: 162 QRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVV 220
           QRIG+ AGSG+GKS LL M  R+   D V++ L+GERGREVREF++  LG+  L KSV+V
Sbjct: 158 QRIGLMAGSGVGKSMLLGMITRATQADVVVVGLIGERGREVREFVDHALGEAGLAKSVLV 217

Query: 221 VATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVAR 280
            A +DESP++R  A      IA +F   G NVLL++DS+TR+A + REIA + GE P  R
Sbjct: 218 AAPADESPLMRLKAAELCHAIAAHFRDTGANVLLLVDSLTRYAMAQREIALSVGEPPATR 277

Query: 281 GYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNR 340
           GYP SVF  LP+L+E  G  E   G+++A+ +VL +GD+ NDP+ D+ R+ILDGHIVL R
Sbjct: 278 GYPPSVFGMLPQLVETAGNGEG-AGSMSAIYTVLAEGDDQNDPVVDTARAILDGHIVLTR 336

Query: 341 SLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVD 400
            LAE G YP +D   SVSR   +   A+   L   +  +I R E+ RD+  +GGY  G D
Sbjct: 337 ELAERGHYPAIDVPRSVSRCMSQVAGAEHGALARKVKEMIGRHEQIRDLIALGGYVQGAD 396

Query: 401 LILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKL 437
              D+AV +   I  FL+Q   D++  D      K+L
Sbjct: 397 PATDEAVAKAARIDTFLRQDMLDVARHDATLAALKEL 433


>gi|253681702|ref|ZP_04862499.1| flagellar protein export ATPase FliI [Clostridium botulinum D str.
           1873]
 gi|253561414|gb|EES90866.1| flagellar protein export ATPase FliI [Clostridium botulinum D str.
           1873]
          Length = 439

 Score =  273 bits (699), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 163/393 (41%), Positives = 230/393 (58%), Gaps = 11/393 (2%)

Query: 49  VVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLG---DLVFHWGRFRISPSACWCGRV 105
            ++  +N   + +V+    D V + P  +GE I +G    ++       +  S    G+V
Sbjct: 48  TIYNKENDPIMCEVVGFKEDNVILMP--LGELIGIGPGCRVIPSKNYLTVKCSDKLLGKV 105

Query: 106 INALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIG 165
           +N LGK +  DD          + +  P  + R+R++    TG+R ID F     GQR+G
Sbjct: 106 LNGLGKSLKQDDEQLYIGTEYPLDTAPPDPLKRRRIKDSIATGVRAIDGFLTCGEGQRVG 165

Query: 166 VFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATS 224
           +FAGSG+GKST L M AR    D  +I+L+GERGREV +FIE  LG+  LKKSV+V ATS
Sbjct: 166 IFAGSGVGKSTTLGMIAREAKADVNVIALIGERGREVLDFIEKDLGEEGLKKSVIVCATS 225

Query: 225 DESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPT 284
           D+  ++R     TA  IAEYF  KG  V+L++DS+TRFA + RE+    GE P  +GY  
Sbjct: 226 DQPALVRLKGAFTATAIAEYFRDKGKKVILMMDSVTRFAMAQREVGLAIGEPPATKGYTP 285

Query: 285 SVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAE 344
           SVF+ LPRL+ER G SEK  G+ITA  +VLVDGD+ N+PIAD+VR ILDGHIVL+R+LA 
Sbjct: 286 SVFAMLPRLMERSGMSEK--GSITAFYTVLVDGDDFNEPIADAVRGILDGHIVLSRALAG 343

Query: 345 EGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILD 404
           +  YP +D L SVSRL ++    + KK  S    L+  ++ + D+  IG Y  G +  +D
Sbjct: 344 KNHYPAIDVLNSVSRLMNEIADDEHKKTASFARDLLATYKNSEDLINIGAYAQGSNSKVD 403

Query: 405 KAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKL 437
            A+     I ++L+Q   + S    F E   KL
Sbjct: 404 MAIQYNDEINNYLRQGIKEHSE---FSESINKL 433


>gi|261407981|ref|YP_003244222.1| flagellar protein export ATPase FliI [Paenibacillus sp. Y412MC10]
 gi|329929287|ref|ZP_08283040.1| flagellar protein export ATPase FliI [Paenibacillus sp. HGF5]
 gi|261284444|gb|ACX66415.1| flagellar protein export ATPase FliI [Paenibacillus sp. Y412MC10]
 gi|328936656|gb|EGG33099.1| flagellar protein export ATPase FliI [Paenibacillus sp. HGF5]
          Length = 439

 Score =  273 bits (699), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 154/366 (42%), Positives = 230/366 (62%), Gaps = 7/366 (1%)

Query: 70  VYICPVGIGEEISLG-DLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEI 128
           V + P+G    I  G D+V       +   +   G+V++ LG+P+DG  S+    +    
Sbjct: 69  VLLMPLGELHSIGPGCDVVGTGKPLSVQVGSELLGKVLDGLGQPLDG--SIIPARMPHYS 126

Query: 129 MSKVPP-AMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCF 187
              VP   +NR RV++    G+R ID    +  GQR+G+FAGSG+GKSTL+ M AR+   
Sbjct: 127 THNVPQNPLNRPRVQEPISIGVRAIDGLLSIGKGQRVGIFAGSGVGKSTLMGMIARNTSA 186

Query: 188 DKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFS 246
           D  +I+L+GERGREV +FIE  LG + LK+SVV+VATSD+  ++R    L A TIAEYF 
Sbjct: 187 DVNVIALIGERGREVLDFIERDLGPEGLKRSVVIVATSDQPALIRIKGALIATTIAEYFR 246

Query: 247 SKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGN 306
            +G NV+L++DS+TR+A + RE+    GE P  RGY  SVF+ LP+LLER G      G+
Sbjct: 247 DRGLNVMLMMDSVTRYAMAQREVGLAVGEPPAMRGYTPSVFASLPKLLERAGTGPT--GS 304

Query: 307 ITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWS 366
           ITA  +VLVDGD+ N+PIAD+VR ILDGHIVLNR++A +G +P +D LAS+SR+      
Sbjct: 305 ITAFYTVLVDGDDMNEPIADAVRGILDGHIVLNRNIANKGHFPAIDVLASISRVMKDISP 364

Query: 367 ADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
            ++     ++  L+  ++++ D+  IG Y+ G +  +D+++  +  I+DF KQ  ++ ++
Sbjct: 365 EEQIDASENVKRLMAIYKDSEDLINIGAYQQGSNADIDESIEYIGRIWDFTKQKVNEKTT 424

Query: 427 EDVFQE 432
            D  QE
Sbjct: 425 LDEVQE 430


>gi|289523571|ref|ZP_06440425.1| flagellar protein export ATPase FliI [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
 gi|289503263|gb|EFD24427.1| flagellar protein export ATPase FliI [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
          Length = 442

 Score =  273 bits (699), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 160/381 (41%), Positives = 232/381 (60%), Gaps = 7/381 (1%)

Query: 43  VCLGDF--VVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLG-DLVFHWGRFRISPSA 99
           V +GD   + ++  +S    +V+  N D V + P+G   +I  G D+V    +  +    
Sbjct: 44  VRVGDLCEIRYRDSSSSLCAEVVGFNEDRVLLMPLGELADIGPGCDVVAVGQKLGVRVGP 103

Query: 100 CWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLC 159
              GRV+N LG+PID    +  GD+   + ++ P  + R+ +      G++ ID    L 
Sbjct: 104 GLLGRVLNGLGEPIDDKGPVMAGDV-YPLYARPPHPLLRKSISSPLPVGVKAIDGMLTLG 162

Query: 160 HGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSV 218
            GQRIG+F+GSG+GKSTL+ M  R+   +  +I L+GERGREV EF+E  LG + LK+SV
Sbjct: 163 RGQRIGIFSGSGVGKSTLMGMMVRNTEAEVSVIGLIGERGREVGEFLERDLGSSGLKRSV 222

Query: 219 VVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPV 278
           VVVATSD+ P++R  A LTA  IAEYF  KG +VLL++DSITR A + R++    GE P 
Sbjct: 223 VVVATSDQPPLVRLKAALTATAIAEYFRDKGKDVLLLMDSITRVAMAQRDVGLAIGEPPA 282

Query: 279 ARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVL 338
            RGY  SVF+ LP+LLER G    E+G+IT + +VLV+GD+ N+P+AD+VR ILDGHIVL
Sbjct: 283 TRGYTPSVFAFLPKLLERAGAG--ERGSITGIYNVLVEGDDMNEPVADTVRGILDGHIVL 340

Query: 339 NRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPG 398
           +R LA +G YP +D L SVSR+     S         +  L+  +E+  D+  IG Y+ G
Sbjct: 341 SRKLASKGHYPAIDILRSVSRVMPNIVSQKHLAAAQRVRELLAIYEDAEDLVNIGAYKVG 400

Query: 399 VDLILDKAVHQVPIIYDFLKQ 419
            +  +D A+  +  + DFL+Q
Sbjct: 401 SNPNIDWALEHLDDVLDFLRQ 421


>gi|330719817|gb|EGG98317.1| Flagellum-specific ATP synthase FliI [gamma proteobacterium
           IMCC2047]
          Length = 447

 Score =  273 bits (699), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 150/391 (38%), Positives = 234/391 (59%), Gaps = 4/391 (1%)

Query: 32  VYYTVTCLSQYVCLGDFVVHQGKNSDNL-GQVIRINLDIVYICPVGIGEEISLGDLVFHW 90
           V  T+  +   V LGD       N  ++  +V+    + V++ P+G  E I  G  V   
Sbjct: 32  VGLTLEAVGCNVALGDHCEIDMANGRHIEAEVVGFADNRVFLMPLGPVEGIRPGARVRPV 91

Query: 91  GRFRISPSA-CWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGI 149
            R +  P      GRV+N +G+P+D    L + D    +  +    ++R  + +    GI
Sbjct: 92  QRSKEVPVGYGLLGRVLNGVGEPLDDKGPL-QADAKTGLEGQYINPLSRNPIHESLDVGI 150

Query: 150 RVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDY 209
           R I+    +  GQR+G+FAGSG+GKS LL M  R    D V++ LVGERGREV+EFI+D 
Sbjct: 151 RAINALLTVGRGQRLGLFAGSGVGKSVLLGMMTRFTEADIVVVGLVGERGREVKEFIDDC 210

Query: 210 LGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIRE 268
           LG   L ++VVV + +D+SP++R  + +   +IAEYF  +G NVLL++DS+TR+A + RE
Sbjct: 211 LGPAGLARAVVVASPADDSPLMRLRSAMLTTSIAEYFRDQGKNVLLLMDSLTRYAQAQRE 270

Query: 269 IATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSV 328
           +A   GE P  +GYP SVF++LP+L+ER G +   +G+ITA  +VL +GD+  DP+AD+ 
Sbjct: 271 LALAVGEPPATKGYPPSVFAKLPQLVERAGNAAAGEGSITAFYTVLTEGDDQQDPVADAA 330

Query: 329 RSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRD 388
           R+ILDGHIVL+R LAE G YP +D  ASVSR+  +  + ++ +L      +   ++++ D
Sbjct: 331 RAILDGHIVLSRRLAEAGHYPAIDVEASVSRVMPQVVNPEQMQLAQQFRQVYANYQQSSD 390

Query: 389 IRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
           +  +G Y  G +   D A+ ++P++  FL+Q
Sbjct: 391 LISVGAYVAGSNPETDFAIQRMPVMKQFLQQ 421


>gi|220917455|ref|YP_002492759.1| ATPase, FliI/YscN family [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219955309|gb|ACL65693.1| ATPase, FliI/YscN family [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 435

 Score =  273 bits (699), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 159/382 (41%), Positives = 221/382 (57%), Gaps = 12/382 (3%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGR---FRISPSACWCGRVINALGKPIDGDD 117
           +V+ +  D   + P G    + L   V   GR    R  P     GRV++ LG+P+DG  
Sbjct: 58  EVVGLRDDRAVLVPFGDLGGVGLDAEVVPTGRAHTIRAGPG--LLGRVLDGLGRPLDGA- 114

Query: 118 SLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
            L  G     +    P  + R+ V      G+RV+D F     GQRIG+FAGSG+GKSTL
Sbjct: 115 PLPAGLEEWAVDRPAPNPLARRPVAAPLPLGVRVLDGFLTAGEGQRIGLFAGSGVGKSTL 174

Query: 178 LSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPL 236
           L   AR    D  ++ LVGERGREVREF+E  LG + L +SVVV ATSD   ++R  A  
Sbjct: 175 LGQLARGARADLCVVCLVGERGREVREFLEGPLGAEGLARSVVVAATSDAPALVRLKAAH 234

Query: 237 TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLER 296
            A  +AE+F+ +GD VLL++DS+TR+A ++RE+   +GE P  +GYP SVF+ LPRLLER
Sbjct: 235 VATAVAEWFAERGDRVLLLVDSVTRYARALREVGLAAGEPPARQGYPPSVFAALPRLLER 294

Query: 297 IGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLAS 356
            G   + +G ITAV +VLV G +  +PIAD VR ILDGH+VL+R++A  GR+P VDPL S
Sbjct: 295 AG--NRARGGITAVYTVLVAGGDLEEPIADEVRGILDGHVVLDRAVASGGRFPAVDPLQS 352

Query: 357 VSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDF 416
           +SR+     +         +  L+      RD+  +G YR G D   D A+ ++P I  F
Sbjct: 353 LSRVMPAVAAPAHLAAAGRVRALLAAHARVRDLVALGAYRAGADPEADLALARLPAIEAF 412

Query: 417 LKQSPSDLSSEDVFQEITKKLQ 438
           L+Q    L     F+E  ++L+
Sbjct: 413 LRQP---LGEAAPFEETLRRLE 431


>gi|188588315|ref|YP_001920205.1| flagellar protein export ATPase FliI [Clostridium botulinum E3 str.
           Alaska E43]
 gi|251778789|ref|ZP_04821709.1| flagellar protein export ATPase FliI [Clostridium botulinum E1 str.
           'BoNT E Beluga']
 gi|188498596|gb|ACD51732.1| flagellar protein export ATPase FliI [Clostridium botulinum E3 str.
           Alaska E43]
 gi|243083104|gb|EES48994.1| flagellar protein export ATPase FliI [Clostridium botulinum E1 str.
           'BoNT E Beluga']
          Length = 435

 Score =  273 bits (699), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 155/331 (46%), Positives = 215/331 (64%), Gaps = 8/331 (2%)

Query: 103 GRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQ 162
           G +I+ LGKP+ G++ +   D  +E  +  P  + R+R+++   TGIR ID F     GQ
Sbjct: 102 GEIIDGLGKPLRGEELVEGEDYPLE--NNPPDPLKRKRIKEIMPTGIRAIDGFLTCGDGQ 159

Query: 163 RIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVV 221
           RIG+FAGSG+GKST L M AR    D  +I+L+GERGREV EFIE  LG + +KKSVVV 
Sbjct: 160 RIGIFAGSGVGKSTTLGMIAREAKADVNVIALIGERGREVLEFIEKDLGPEGMKKSVVVC 219

Query: 222 ATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARG 281
           ATSD+  ++R    LTA  IAEYF  KG  V+L++DS+TRFA + RE+    GE P  +G
Sbjct: 220 ATSDKPALIRLKGALTATAIAEYFRDKGKKVILMMDSVTRFAMAQREVGLAIGEPPATKG 279

Query: 282 YPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRS 341
           Y  SVF++LP+L+ER G SE   G+ITA  +VLVDGD+ N+PIAD+VR ILDGHIVL+RS
Sbjct: 280 YTPSVFAKLPKLMERSGTSED--GSITAFYTVLVDGDDFNEPIADAVRGILDGHIVLSRS 337

Query: 342 LAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDL 401
           LA +  YP +D L SVSRL +     +  +  S    L+  ++E+ D+  IG Y  G + 
Sbjct: 338 LAHKNHYPAIDILNSVSRLMNSIAPPEHIQAASIARDLLATYKESEDLINIGAYVKGSNK 397

Query: 402 ILDKAVHQVPIIYDFLKQSPSDLSSEDVFQE 432
            +D A+     I +FL+Q+ ++ S+   F+E
Sbjct: 398 KIDLAISYHDKIEEFLRQTVNEKSN---FEE 425


>gi|294141005|ref|YP_003556983.1| ATPase [Shewanella violacea DSS12]
 gi|293327474|dbj|BAJ02205.1| ATPase, FliI/YscN family [Shewanella violacea DSS12]
          Length = 441

 Score =  273 bits (699), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 164/377 (43%), Positives = 228/377 (60%), Gaps = 12/377 (3%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDG---D 116
           +VI +  D V + P  +   +  G LV   G   ++   +   GRV++ LG  +DG   D
Sbjct: 65  EVIAVKGDEVLLSPFDVTSWLQTGALVEPMGHGHQVLLGSELLGRVVDGLGDVMDGYPLD 124

Query: 117 DSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKST 176
               + +         P  ++R  ++     GIR ID       GQRIG+FA +G GKST
Sbjct: 125 ACECRPNYG-----AAPNPLSRSLIDTVMPMGIRAIDSALACGVGQRIGIFAAAGGGKST 179

Query: 177 LLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLK-KSVVVVATSDESPILRKMAP 235
           LL M A     D ++++LVGERGREVREFIE  L    + ++V+VVATSD  P+ R  A 
Sbjct: 180 LLGMIASHCEADVIVLALVGERGREVREFIEYNLTPEARARTVMVVATSDRPPLERMKAT 239

Query: 236 LTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLE 295
           LTA TIAEYF  +G NVLL++DS+TRFA S REI+  +GE PV+ GYP SVF  L  L+E
Sbjct: 240 LTATTIAEYFRDQGKNVLLMVDSLTRFARSAREISLAAGEAPVSNGYPPSVFVNLSALVE 299

Query: 296 RIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLA 355
           R GP+ K  G+IT V +VLV+GDN N+PIAD VRS+LDGHIVL+R LA  G YP +D  A
Sbjct: 300 RAGPAAK--GSITGVYTVLVEGDNMNEPIADEVRSLLDGHIVLSRKLAGAGHYPAIDINA 357

Query: 356 SVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYD 415
           SVSR+ D+  + ++KK  + +  ++  ++E + +  +G Y  G D   D+AV +   I D
Sbjct: 358 SVSRVMDQIVTQEQKKNAAKMRQMLALYDEVQLLLRVGEYVQGQDKQTDEAVMRYGAIKD 417

Query: 416 FLKQSPSDLSSEDVFQE 432
           FL+QS  + S  +V Q+
Sbjct: 418 FLRQSVDEFSPYEVSQQ 434


>gi|224534379|ref|ZP_03674957.1| flagellar protein export ATPase FliI [Borrelia spielmanii A14S]
 gi|224514481|gb|EEF84797.1| flagellar protein export ATPase FliI [Borrelia spielmanii A14S]
          Length = 436

 Score =  273 bits (699), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 161/406 (39%), Positives = 245/406 (60%), Gaps = 6/406 (1%)

Query: 36  VTCLSQYVCLGDF-VVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-F 93
           V  L     +GD  ++ Q  N     +V+  N   V +        I +G+ V+   +  
Sbjct: 32  VESLGPQCAIGDLCLIDQRNNKKVCAEVLGFNGPYVSLMAYEGFSGIEVGNKVYSLNKGL 91

Query: 94  RISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVID 153
            I+ S    GRVI++LG+PID   S         I  K+ P +NR   E+   TG++V+D
Sbjct: 92  EINLSEELLGRVIDSLGRPIDNKGSFLNNRYKELIFKKINP-INRSIFEEQILTGVKVLD 150

Query: 154 IFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN 213
            F P+  GQR+G+F+G+G+GKSTLL M A++   D  +I+ +GERGRE+ EFIE  LG+ 
Sbjct: 151 GFLPVAKGQRVGIFSGAGVGKSTLLGMIAKNSNADVNVIAFIGERGRELNEFIEFELGEE 210

Query: 214 -LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATN 272
            LKKSV+VV+TSDESPI R      A  IAEYF  +G +V L+ DSITRFA++ RE++ +
Sbjct: 211 RLKKSVLVVSTSDESPISRYKGAYVATMIAEYFREQGKDVALLFDSITRFANAKREMSLS 270

Query: 273 SGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSIL 332
            GE PVA+GYP SVF E+P LLER G +    G++T   +VLV+GD+  +P+AD+++++L
Sbjct: 271 LGEPPVAKGYPPSVFVEIPILLERSGFN-GTGGSVTGFYTVLVEGDDFTEPVADNIKAVL 329

Query: 333 DGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLI 392
           DGHI+L+R L + G YP ++ L+S SR   +  S +++KL+    +L+  +++  D+   
Sbjct: 330 DGHIILDRDLFDRGIYPSINILSSTSRSIHRIMSLEKQKLIMKARNLLSIYKDYEDLVRT 389

Query: 393 GGYRPGVDLILDKAVHQVPIIYDFLKQSPSD-LSSEDVFQEITKKL 437
           G Y  G +  +D A+ + P I DF+ Q  ++    E++  EI K L
Sbjct: 390 GIYLKGSNKDVDFAISKYPRIIDFISQGINETFDFENLEDEIRKIL 435


>gi|168698707|ref|ZP_02730984.1| Flagellar biosynthesis/type III secretory pathway ATPase [Gemmata
           obscuriglobus UQM 2246]
          Length = 430

 Score =  273 bits (699), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 161/407 (39%), Positives = 237/407 (58%), Gaps = 10/407 (2%)

Query: 23  GGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDN-LGQVIRINLDIVYICPVGIGEEI 81
           GG + S+T     +TC +    +GD      ++ +  L +VI    D+ Y+ P    E +
Sbjct: 14  GGRLKSVTG---RMTC-AIPAAVGDHCAILPRDGEPVLAEVIGFENDLAYLVPFDAAENL 69

Query: 82  SLGDLVFHWGRFRISPSA-CWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQR 140
             G  V   G+  + P+     GRVI+ LG+P+DG   L    L   +    PPAM RQR
Sbjct: 70  QPGMPVLRKGKGLMVPTGKNLLGRVIDGLGRPLDGKGPLADCPLK-PVNRPAPPAMERQR 128

Query: 141 VEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGR 200
           + + F TGIR ID       GQR+G+FAGSG+GKSTLL   A+    D  +I+L+GERGR
Sbjct: 129 IREPFVTGIRAIDSVLTCGGGQRVGIFAGSGVGKSTLLGEVAKGSQADVNVIALIGERGR 188

Query: 201 EVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSI 259
           EV  F+ED LG + + +SVV+VAT +++ ++R  A  +A+ IA+YF S+  NVL ++DS+
Sbjct: 189 EVAPFLEDVLGPEGMARSVVIVATCEQTALMRVRAAQSAIAIADYFRSESQNVLFVIDSL 248

Query: 260 TRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDN 319
           TR A + RE+    GE P +RGY  SVF  L   +ER+G      G ITA+++VLVDG +
Sbjct: 249 TRLAMAQRELGLLLGEPPSSRGYTPSVFQTLANTVERLG--NAAVGGITALLTVLVDGGD 306

Query: 320 HNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHL 379
            ++PIAD VR ++DGHIVL+R +AE G YP +D   S+SR+A      +  K    L  +
Sbjct: 307 MDEPIADYVRGLVDGHIVLDRKIAERGFYPAIDVSRSISRVATDVVDRESAKAARKLRAI 366

Query: 380 IHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
           +    + +D+  IG Y  G+D  +DKA+  +P +  FL+Q   + SS
Sbjct: 367 MATHADIQDMLRIGAYTRGMDPQVDKALELMPKVEKFLRQDVGERSS 413


>gi|52841984|ref|YP_095783.1| flagellum-specific ATP synthase FliI [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52629095|gb|AAU27836.1| nucleotide binding protein FliI [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 450

 Score =  273 bits (699), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 153/370 (41%), Positives = 228/370 (61%), Gaps = 3/370 (0%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRF-RISPSACWCGRVINALGKPIDGDDSL 119
           +V+  + + VY+  +G  + I+ G  +   GR  ++S      GR++N  G  ID D   
Sbjct: 64  EVVGFSNESVYLMSIGDIQGIAPGMKIIPTGRIAQVSVGHQLLGRILNGSGMFID-DGPP 122

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
           G+   +  ++ +V   + R  +E     GIR I+    +  GQRIG+FAGSG+GKS LL 
Sbjct: 123 GEMVETYPLIGQVINPLKRAPIEVPLDVGIRAINGLLTVGRGQRIGLFAGSGVGKSVLLG 182

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTA 238
           M  R    D V++ L+GERGREV+EFIE  LG + L+++VVV A +DESP++R      A
Sbjct: 183 MMTRFTEADVVVVGLIGERGREVKEFIECNLGLEGLRRAVVVAAPADESPLMRLHGAKVA 242

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
            +IAEYF  +G +VLL++DS+TRFA + REIA + GE P  +GYP SVF++LP+L+ER G
Sbjct: 243 TSIAEYFRDQGKHVLLLIDSLTRFAQAQREIALSIGEAPATKGYPPSVFAKLPKLVERAG 302

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
                 G+ITA  +VL +GD+  DPIAD+ R+ILDGH+VL+R+LAE+G+YP +D  AS+S
Sbjct: 303 NGTSGGGSITAFYTVLTEGDDLQDPIADAARAILDGHVVLSRALAEQGQYPAIDLEASIS 362

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+     S    K +      +  +E+ +D+ L+G Y  G D ++DKA+  V  + D+L 
Sbjct: 363 RVMQGVVSEQHMKDMLLFKKYLSVYEKNKDLILLGAYAKGSDPLVDKAILAVNKLKDYLA 422

Query: 419 QSPSDLSSED 428
           Q   +  S D
Sbjct: 423 QGMDEQVSYD 432


>gi|148359301|ref|YP_001250508.1| flagellum-specific ATP synthase FliI [Legionella pneumophila str.
           Corby]
 gi|296107348|ref|YP_003619048.1| flagellum-specific ATP synthase [Legionella pneumophila 2300/99
           Alcoy]
 gi|1938361|gb|AAB52239.1| nucleotide binding protein FliI [Legionella pneumophila]
 gi|148281074|gb|ABQ55162.1| flagellum-specific ATP synthase FliI [Legionella pneumophila str.
           Corby]
 gi|295649249|gb|ADG25096.1| flagellum-specific ATP synthase [Legionella pneumophila 2300/99
           Alcoy]
 gi|307610456|emb|CBX00027.1| flagellum-specific ATP synthase FliI [Legionella pneumophila 130b]
          Length = 449

 Score =  273 bits (698), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 153/370 (41%), Positives = 228/370 (61%), Gaps = 3/370 (0%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRF-RISPSACWCGRVINALGKPIDGDDSL 119
           +V+  + + VY+  +G  + I+ G  +   GR  ++S      GR++N  G  ID D   
Sbjct: 63  EVVGFSNESVYLMSIGDIQGIAPGMKIIPTGRIAQVSVGHQLLGRILNGSGMFID-DGPP 121

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
           G+   +  ++ +V   + R  +E     GIR I+    +  GQRIG+FAGSG+GKS LL 
Sbjct: 122 GEMVETYPLIGQVINPLKRAPIEVPLDVGIRAINGLLTVGRGQRIGLFAGSGVGKSVLLG 181

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTA 238
           M  R    D V++ L+GERGREV+EFIE  LG + L+++VVV A +DESP++R      A
Sbjct: 182 MMTRFTEADVVVVGLIGERGREVKEFIECNLGLEGLRRAVVVAAPADESPLMRLHGAKVA 241

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
            +IAEYF  +G +VLL++DS+TRFA + REIA + GE P  +GYP SVF++LP+L+ER G
Sbjct: 242 TSIAEYFRDQGKHVLLLIDSLTRFAQAQREIALSIGEAPATKGYPPSVFAKLPKLVERAG 301

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
                 G+ITA  +VL +GD+  DPIAD+ R+ILDGH+VL+R+LAE+G+YP +D  AS+S
Sbjct: 302 NGTSGGGSITAFYTVLTEGDDLQDPIADAARAILDGHVVLSRALAEQGQYPAIDLEASIS 361

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+     S    K +      +  +E+ +D+ L+G Y  G D ++DKA+  V  + D+L 
Sbjct: 362 RVMQGVVSEQHMKDMLLFKKYLSVYEKNKDLILLGAYAKGSDPLVDKAILAVNKLKDYLA 421

Query: 419 QSPSDLSSED 428
           Q   +  S D
Sbjct: 422 QGMDEQVSYD 431


>gi|109899349|ref|YP_662604.1| flagellum-specific ATP synthase [Pseudoalteromonas atlantica T6c]
 gi|109701630|gb|ABG41550.1| flagellar protein export ATPase FliI [Pseudoalteromonas atlantica
           T6c]
          Length = 444

 Score =  273 bits (698), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 170/441 (38%), Positives = 247/441 (56%), Gaps = 17/441 (3%)

Query: 5   LETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIR 64
           L  +  L +   +  VV  G +  +  +  T+  +   + +G   + Q  + +   +V+ 
Sbjct: 6   LGNIKALQQQVPQAPVVAAGKL--VRGIGLTLEAVGCQMPVGSQCLIQTVDGEIEAEVVG 63

Query: 65  INLDIVYICPVGIGEEISLGDLVFHWGRFRISP-SACWCGRVINALGKPIDGDDSLGKGD 123
               I Y+ P    + I  G  V    R +  P      GRV++  G+P+DG   LG   
Sbjct: 64  FAEHITYLMPTQAVKGIVPGSRVQPLNREQGLPVGMSLLGRVVDGNGQPLDG---LG--- 117

Query: 124 LSMEIMSKVP---PAMN---RQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
            +++   +VP   P MN   R+ + +    G+R I+    +  GQR+G+FAGSG+GKS L
Sbjct: 118 -AIKAEKRVPLTRPPMNPLSRKPIREPLDVGVRAINSMITVGSGQRMGLFAGSGVGKSVL 176

Query: 178 LSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPL 236
           L M  R    D V++ LVGERGREV+EFI+D LGD   +KSVVV A +D SP++R     
Sbjct: 177 LGMMTRGTSADVVVVGLVGERGREVKEFIQDILGDEERQKSVVVAAPADTSPLMRLKGCE 236

Query: 237 TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLER 296
           TAVTIAEYF  KG NVLL++DS+TR+A + REIA   GE P  +GYP SVF+ LP L+ER
Sbjct: 237 TAVTIAEYFRDKGMNVLLLVDSLTRYAMAQREIALAVGEPPATKGYPPSVFARLPALVER 296

Query: 297 IGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLAS 356
            G   + +G+ITA  +VL +GD+  DPIADS R+ILDGHIVL+R LA+ G YP +D  AS
Sbjct: 297 AGNGGEHQGSITAFYTVLTEGDDLQDPIADSARAILDGHIVLSRQLADSGHYPAIDIEAS 356

Query: 357 VSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDF 416
           +SR+     S +  ++   +  +   +++ RD+  IG Y  G D  +D ++   P I  F
Sbjct: 357 ISRVMPMVVSPEHVQVARRIRQVYSTYQQNRDLISIGAYTRGNDPRIDLSIKAEPAINAF 416

Query: 417 LKQSPSDLSSEDVFQEITKKL 437
           L+Q    +   D   E   KL
Sbjct: 417 LQQGMQQILPFDESVETMVKL 437


>gi|66046683|ref|YP_236524.1| flagellum-specific ATP synthase [Pseudomonas syringae pv. syringae
           B728a]
 gi|63257390|gb|AAY38486.1| ATPase FliI/YscN [Pseudomonas syringae pv. syringae B728a]
          Length = 452

 Score =  273 bits (698), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 149/353 (42%), Positives = 212/353 (60%), Gaps = 3/353 (0%)

Query: 70  VYICPVGIGEEISLGDLVFHWG-RFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEI 128
           V++ PVG    I+ G  V       R+       GRV++  G+P+DG   +   D     
Sbjct: 77  VFLMPVGSVAGIAPGARVVPLADTGRLPMGMSMLGRVLDGAGRPLDGRSPIKAEDWVPMD 136

Query: 129 MSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFD 188
              + P + R  + +    GIR I+    +  GQR+G+FAG+G+GKS LL M  R    D
Sbjct: 137 GPTINP-LKRDPISQPLDVGIRCINGLLTVGRGQRLGLFAGTGVGKSVLLGMMTRFTEAD 195

Query: 189 KVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSS 247
            +++ L+GERGREV+EFIE  LG+  LK+SVVV + +D++P++R  A +    IAEYF  
Sbjct: 196 IIVVGLIGERGREVKEFIEHILGEEGLKRSVVVASPADDAPLMRLRAAMYCTRIAEYFRD 255

Query: 248 KGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNI 307
           KG NVLL++DS+TRFA + REIA   GE P  +GYP SVF+ LP+L+ER G +EK  G+I
Sbjct: 256 KGKNVLLLMDSLTRFAQAQREIALAIGEPPATKGYPPSVFARLPKLVERAGNAEKGGGSI 315

Query: 308 TAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSA 367
           TA  +VL +GD+  DPIADS R +LDGHIVL+R LAEEG YP +D  AS+SR+     S 
Sbjct: 316 TAFYTVLSEGDDQQDPIADSARGVLDGHIVLSRRLAEEGHYPAIDIEASISRVMPAVVSP 375

Query: 368 DEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQS 420
           +          L  R+++TRD+  +G Y  G D   D A+   P++  + +Q+
Sbjct: 376 EHMARAQHFKQLWSRYQQTRDLISVGAYVAGGDRETDMAIALHPVLVRYQRQA 428


>gi|240145503|ref|ZP_04744104.1| flagellar protein export ATPase FliI [Roseburia intestinalis L1-82]
 gi|257202318|gb|EEV00603.1| flagellar protein export ATPase FliI [Roseburia intestinalis L1-82]
          Length = 435

 Score =  273 bits (698), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 152/374 (40%), Positives = 235/374 (62%), Gaps = 6/374 (1%)

Query: 48  FVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVI 106
            ++ + +N   + +V+      + + P    E I +G +V + G    +       G  +
Sbjct: 45  IIIDREQNISTMAEVVGFRDKHLLLMPFESVEGIGVGCIVENTGHPLTVKVGEELLGHTL 104

Query: 107 NALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGV 166
           + +G+P D ++ L   D  +E +   P  M R+ +++    G++ +D    +  GQRIG+
Sbjct: 105 DGIGRPTDVEELLLPYDYPVEALP--PDPMARKIIDEVLPLGVKAVDGLITVGKGQRIGI 162

Query: 167 FAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSD 225
           FAGSG+GKSTLL MFAR+   D  +I+L+GERGREVREF+E  LG+  +K+SVV+VATSD
Sbjct: 163 FAGSGVGKSTLLGMFARNTKADINVIALIGERGREVREFVERDLGEEGMKRSVVIVATSD 222

Query: 226 ESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTS 285
           +  ++R  A  TA  IAEYF  +G +VLL++DS+TRF+ + REI   SGE PV RGYP S
Sbjct: 223 KPALIRNKAAKTATAIAEYFRDQGKDVLLMMDSLTRFSMAQREIGLASGEPPVTRGYPPS 282

Query: 286 VFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEE 345
           V+SE+P+LLER G S  +KG+IT + +VLVDGD+ N+PI D+ RSILDGHI+L+R L ++
Sbjct: 283 VYSEMPKLLERAGTS--DKGSITGLYTVLVDGDDMNEPITDTARSILDGHIMLSRKLGQK 340

Query: 346 GRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDK 405
             YP +D L S+SR+     +++ K+L   L +++  + E  D+  IG Y+ G +  +D 
Sbjct: 341 NHYPAIDVLQSISRVMSSIATSEHKELAGKLRNVMATYNEAEDLINIGAYKNGTNREIDY 400

Query: 406 AVHQVPIIYDFLKQ 419
           A+ +   + +FL Q
Sbjct: 401 AIQKNQAVNEFLMQ 414


>gi|115353163|ref|YP_775002.1| flagellar protein export ATPase FliI [Burkholderia ambifaria AMMD]
 gi|115283151|gb|ABI88668.1| flagellar protein export ATPase FliI [Burkholderia ambifaria AMMD]
          Length = 513

 Score =  273 bits (697), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 146/319 (45%), Positives = 201/319 (63%), Gaps = 4/319 (1%)

Query: 103 GRVINALGKPIDGDDSLG-KGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHG 161
           GRV++A G+P+DG   L  K D S+   S  P  ++R+ +      G+R I+    +  G
Sbjct: 173 GRVVDASGRPLDGLGPLASKVDASLSAPSINP--LDREPIHSVLDVGVRAINALLTVGRG 230

Query: 162 QRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVV 220
           QR+G+FAGSG+GKS LL   AR    + ++I L+GERGREV+EFIE  LG D L +SVVV
Sbjct: 231 QRMGLFAGSGVGKSVLLGTMARYTSAEVIVIGLIGERGREVKEFIEQILGEDGLARSVVV 290

Query: 221 VATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVAR 280
            A +D SP+LR      A ++AEYF  +G +VLL++DS+TR+A + REIA   GE P  +
Sbjct: 291 AAPADVSPLLRMQGAAYATSLAEYFRDQGKHVLLLMDSLTRYAMAQREIALAIGEPPATK 350

Query: 281 GYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNR 340
           GYP SVF++LP L+ER G   +  G+ITA  +VL +GD+  DPIADS R+ILDGHIVL+R
Sbjct: 351 GYPPSVFAKLPALVERTGNGPEGGGSITAFYTVLTEGDDQQDPIADSARAILDGHIVLSR 410

Query: 341 SLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVD 400
           +LAE G YP +D  AS+SR             V     ++ R++  RD+  +G Y PG D
Sbjct: 411 ALAEAGHYPAIDIEASISRAMTALIDETHLDRVRQFKQMLSRYQRNRDLIAVGAYAPGRD 470

Query: 401 LILDKAVHQVPIIYDFLKQ 419
             LD+A+   P I  FL+Q
Sbjct: 471 AQLDRAIALYPRIESFLQQ 489


>gi|172062018|ref|YP_001809670.1| flagellar protein export ATPase FliI [Burkholderia ambifaria
           MC40-6]
 gi|171994535|gb|ACB65454.1| flagellar protein export ATPase FliI [Burkholderia ambifaria
           MC40-6]
          Length = 513

 Score =  273 bits (697), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 146/319 (45%), Positives = 201/319 (63%), Gaps = 4/319 (1%)

Query: 103 GRVINALGKPIDGDDSLG-KGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHG 161
           GRV++A G+P+DG   L  K D S+   S  P  ++R+ +      G+R I+    +  G
Sbjct: 173 GRVVDASGRPLDGLGPLASKVDASLSAPSINP--LDREPIHHVLDVGVRAINALLTVGRG 230

Query: 162 QRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVV 220
           QR+G+FAGSG+GKS LL   AR    + ++I L+GERGREV+EFIE  LG D L +SVVV
Sbjct: 231 QRMGLFAGSGVGKSVLLGTMARYTSAEVIVIGLIGERGREVKEFIEQILGEDGLARSVVV 290

Query: 221 VATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVAR 280
            A +D SP+LR      A ++AEYF  +G +VLL++DS+TR+A + REIA   GE P  +
Sbjct: 291 AAPADVSPLLRMQGAAYATSLAEYFRDQGKHVLLLMDSLTRYAMAQREIALAIGEPPATK 350

Query: 281 GYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNR 340
           GYP SVF++LP L+ER G   +  G+ITA  +VL +GD+  DPIADS R+ILDGHIVL+R
Sbjct: 351 GYPPSVFAKLPALVERTGNGPEGGGSITAFYTVLTEGDDQQDPIADSARAILDGHIVLSR 410

Query: 341 SLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVD 400
           +LAE G YP +D  AS+SR             V     ++ R++  RD+  +G Y PG D
Sbjct: 411 ALAEAGHYPAIDIEASISRAMTALIDETHLDRVRQFKQMLSRYQRNRDLIAVGAYAPGRD 470

Query: 401 LILDKAVHQVPIIYDFLKQ 419
             LD+A+   P I  FL+Q
Sbjct: 471 AQLDRAIALYPRIESFLQQ 489


>gi|226313066|ref|YP_002772960.1| flagellum-specific ATP synthase [Brevibacillus brevis NBRC 100599]
 gi|226096014|dbj|BAH44456.1| flagellum-specific ATP synthase [Brevibacillus brevis NBRC 100599]
          Length = 439

 Score =  273 bits (697), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 159/381 (41%), Positives = 229/381 (60%), Gaps = 11/381 (2%)

Query: 59  LGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR---FRISPSACWCGRVINALGKPIDG 115
           + +V+    + V + P+G   EI  G  V   GR    ++ P     G +++ LG+P  G
Sbjct: 58  IAEVVGFRENKVLLMPLGELTEIGPGCDVVATGRSLDVKVGPE--ILGSILDGLGRPYQG 115

Query: 116 DDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKS 175
             SL  G  S    +  P  + R R+++    G+R ID    +  GQR+G+FAGSG+GKS
Sbjct: 116 --SLPFGLTSYPTNNMPPNPILRPRIQEPLSVGVRAIDGLLTIGKGQRVGIFAGSGVGKS 173

Query: 176 TLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATSDESPILRKMA 234
           TL+ M AR+   D  +I L+GERGREV EFIE  LG+  LK+SVVVVATSD+  ++R   
Sbjct: 174 TLMGMIARNTTADINVIGLIGERGREVMEFIERDLGEEGLKRSVVVVATSDQPAMIRIKG 233

Query: 235 PLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLL 294
            + A +IAEYF  +G NV+L++DS+TRFA + RE+    GE P  RGY  SVF+ LP+L+
Sbjct: 234 AMIATSIAEYFRDRGMNVMLMMDSVTRFAMAQREVGLAIGEPPATRGYTPSVFAMLPKLM 293

Query: 295 ERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPL 354
           ER G ++K  G+ITA  +VLVD D+ NDPIAD+VR ILDGHIVL+R +A +G +P +D +
Sbjct: 294 ERAGTADK--GSITAFYTVLVDSDDMNDPIADAVRGILDGHIVLDRKIAHKGHFPAIDVM 351

Query: 355 ASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIY 414
           ASVSR+ ++   ++       L   +  F E  D+  IG Y+PG +  +D A+    II 
Sbjct: 352 ASVSRVMNEIVDSNHLDAARQLKKHLATFREAEDLINIGAYKPGSNREIDAAIRYRDIIS 411

Query: 415 DFLKQSPSDLSS-EDVFQEIT 434
            F  Q   + S+ +   Q +T
Sbjct: 412 GFTAQGTHEPSTLQGAIQALT 432


>gi|218892348|ref|YP_002441215.1| type III secretion system ATPase [Pseudomonas aeruginosa LESB58]
 gi|218772574|emb|CAW28357.1| ATP synthase in type III secretion system [Pseudomonas aeruginosa
           LESB58]
          Length = 440

 Score =  273 bits (697), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 148/336 (44%), Positives = 209/336 (62%), Gaps = 4/336 (1%)

Query: 91  GRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIR 150
           G  R++      GRV++ LG+P DG     +      +    PP M+R+ +E+    G+R
Sbjct: 94  GMHRVAVGEHLLGRVLDGLGRPFDGSPP-AEPAAWYPVYRDAPPPMSRRLIERPLSLGVR 152

Query: 151 VIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYL 210
            ID       GQR+G+FA +G GKSTLL+   R+   D  I++LVGERGREVREFIE  L
Sbjct: 153 AIDGLLTCGEGQRMGIFAAAGGGKSTLLASLVRNAEVDVTILALVGERGREVREFIESDL 212

Query: 211 GDN-LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREI 269
           G+  L++SV+VVATSD   + R  A   A +IAEYF  +G  VLL++DS+TRFA + REI
Sbjct: 213 GEQGLRRSVLVVATSDRPAMERAKAGFVATSIAEYFRDQGRRVLLLMDSLTRFARAQREI 272

Query: 270 ATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVR 329
              +GE P  RGYP SVF+ LPRL+ER G SE+  G+ITA+ +VLV+GD+ ++P+AD  R
Sbjct: 273 GLAAGEPPTRRGYPPSVFAALPRLMERAGQSER--GSITALYTVLVEGDDMSEPVADETR 330

Query: 330 SILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDI 389
           SILDGHIVL+R LA    YP +D L SVSR+ ++    D++     L   + ++EE   +
Sbjct: 331 SILDGHIVLSRKLAAANHYPAIDVLHSVSRVMNQIVDDDQRHAAGRLREWLAKYEEVELL 390

Query: 390 RLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLS 425
             IG Y+ G D   D+A+ ++  I  +L+Q   + S
Sbjct: 391 LKIGEYQKGQDSEADQAIEKIGAIRQWLRQGTHETS 426


>gi|37527629|ref|NP_930973.1| type III secretion system ATPase [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36787064|emb|CAE16139.1| Type III secretion component protein SctN [Photorhabdus luminescens
           subsp. laumondii TTO1]
          Length = 440

 Score =  273 bits (697), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 162/406 (39%), Positives = 236/406 (58%), Gaps = 27/406 (6%)

Query: 35  TVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFR 94
           T++ L++ +    F  HQ   +  LG++  I+ +   + P G   ++ +GD +       
Sbjct: 57  TLSLLAEVI---GFQQHQALLTP-LGEMFGISSN-TEVSPTGAMHQVGVGDYLL------ 105

Query: 95  ISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDI 154
                   G+V++ LG P  G   L +      +    P  M+R+R+E     G+R ID 
Sbjct: 106 --------GQVLDGLGNPFSGGQ-LPEPQAWYPVYRDAPAPMSRKRIEHPLSLGVRAIDG 156

Query: 155 FTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN- 213
                 GQR+G+FA +G GKSTLLS   RS   D  +++L+GERGREVREFIE  LG+  
Sbjct: 157 LLTCGEGQRMGIFAAAGGGKSTLLSTLIRSAEVDVTVLALIGERGREVREFIESDLGEEG 216

Query: 214 LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNS 273
           LK+SV+VVATSD   + R  A   A +IAEYF  +G  VLL++DS+TRFA + REI   +
Sbjct: 217 LKRSVLVVATSDRPAMERAKAGFVATSIAEYFRDQGKRVLLLMDSVTRFARAQREIGLAA 276

Query: 274 GELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILD 333
           GE P  RGYP SVF+ LPRL+ER G S  +KG+ITA+ +VLV+GD+  +P+AD  RSILD
Sbjct: 277 GEPPTRRGYPPSVFAALPRLMERAGQS--DKGSITALYTVLVEGDDMTEPVADETRSILD 334

Query: 334 GHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIG 393
           GHI+L+R LA    YP +D L S SR+ ++  + + +     L   + ++EE   +  IG
Sbjct: 335 GHIILSRKLAAANHYPAIDVLRSASRVMNQIITPEHQAQAGLLRKWLAKYEEVELLLQIG 394

Query: 394 GYRPGVDLILDKAVHQVPIIYDFLKQ---SPSDL-SSEDVFQEITK 435
            Y+ G D + D A+  +  I ++L+Q    PSDL  +    Q+ITK
Sbjct: 395 EYQKGQDPVADNAIAHIEAIRNWLRQGTHEPSDLPQTLAQLQQITK 440


>gi|330961223|gb|EGH61483.1| flagellum-specific ATP synthase [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 452

 Score =  273 bits (697), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 149/353 (42%), Positives = 212/353 (60%), Gaps = 3/353 (0%)

Query: 70  VYICPVGIGEEISLGDLVFHWG-RFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEI 128
           V++ PVG    I+ G  V       R+       GRV++  G+P+DG   +   D     
Sbjct: 77  VFLMPVGSVAGIAPGARVVPLADTGRLPMGMSMLGRVLDGAGRPLDGRSPIKAEDWVPMD 136

Query: 129 MSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFD 188
              + P + R  + +    GIR I+    +  GQR+G+FAG+G+GKS LL M  R    D
Sbjct: 137 GPTINP-LKRDPISQPLDVGIRCINGLLTVGRGQRLGLFAGTGVGKSVLLGMMTRFTEAD 195

Query: 189 KVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSS 247
            +++ L+GERGREV+EFIE  LG+  LK+SVVV + +D++P++R  A +    IAEYF  
Sbjct: 196 IIVVGLIGERGREVKEFIEHILGEEGLKRSVVVASPADDAPLMRLRAAMYCTRIAEYFRD 255

Query: 248 KGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNI 307
           KG NVLL++DS+TRFA + REIA   GE P  +GYP SVF+ LP+L+ER G +EK  G+I
Sbjct: 256 KGKNVLLLMDSLTRFAQAQREIALAIGEPPATKGYPPSVFARLPKLVERAGNAEKGGGSI 315

Query: 308 TAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSA 367
           TA  +VL +GD+  DPIADS R +LDGHIVL+R LAEEG YP +D  AS+SR+     S 
Sbjct: 316 TAFYTVLSEGDDQQDPIADSARGVLDGHIVLSRRLAEEGHYPAIDIEASISRVMPAVVSP 375

Query: 368 DEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQS 420
           +          L  R+++TRD+  +G Y  G D   D A+   P++  + +Q+
Sbjct: 376 EHMARAQHFKQLWSRYQQTRDLISVGAYVAGGDRETDMAIALHPVLVRYQRQA 428


>gi|225552414|ref|ZP_03773354.1| flagellar protein export ATPase FliI [Borrelia sp. SV1]
 gi|225371412|gb|EEH00842.1| flagellar protein export ATPase FliI [Borrelia sp. SV1]
          Length = 436

 Score =  273 bits (697), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 156/387 (40%), Positives = 235/387 (60%), Gaps = 5/387 (1%)

Query: 36  VTCLSQYVCLGDFVVHQGKNSDNL-GQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-F 93
           V  L     +GD  +   +N   +  +V+  N   V +        I +G+ V+   +  
Sbjct: 32  VESLGPQCAIGDLCLIDQRNGKKVCAEVLGFNGPYVSLMAYEGFSGIEVGNKVYSLNKGL 91

Query: 94  RISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVID 153
            I+ S    GRVI++LG+PID   S         I  K+ P +NR   E    TG++V+D
Sbjct: 92  EINLSDELLGRVIDSLGRPIDNKGSFLNNSYKELIFEKINP-INRSIFEDQILTGVKVLD 150

Query: 154 IFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN 213
            F P+  GQR+G+F+GSG+GKSTLL M A++   D  +I+ +GERGRE+ EFIE  LG+ 
Sbjct: 151 GFLPVAKGQRVGIFSGSGVGKSTLLGMIAKNSNADVNVIAFIGERGRELNEFIEHELGEE 210

Query: 214 -LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATN 272
            LKKSV+VV+TSDESPI R      A  IAEYF  +G +V L+ DSITRFA++ RE++ +
Sbjct: 211 RLKKSVLVVSTSDESPISRYKGAYVATMIAEYFREQGKDVALLFDSITRFANAKREMSLS 270

Query: 273 SGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSIL 332
            GE PVA+GYP SVF E+P LLER G +    G++T   +VLV+GD+  +P+AD+++++L
Sbjct: 271 LGEPPVAKGYPPSVFVEIPILLERSGFN-GNGGSVTGFYTVLVEGDDFTEPVADNIKAVL 329

Query: 333 DGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLI 392
           DGHI+L+R L + G YP ++ L+S SR   +  S +++KL+    +L+  +++  D+   
Sbjct: 330 DGHIILDRDLFDRGIYPSINVLSSTSRSIHRIMSLEKQKLIMKARNLLSIYKDYEDLIRT 389

Query: 393 GGYRPGVDLILDKAVHQVPIIYDFLKQ 419
           G Y  G +  +D A+ + P I DF+ Q
Sbjct: 390 GIYLKGSNKDVDFAISKYPKIIDFISQ 416


>gi|283955375|ref|ZP_06372874.1| flagellum-specific ATP synthase FliI [Campylobacter jejuni subsp.
           jejuni 414]
 gi|283793135|gb|EFC31905.1| flagellum-specific ATP synthase FliI [Campylobacter jejuni subsp.
           jejuni 414]
          Length = 459

 Score =  273 bits (697), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 165/425 (38%), Positives = 238/425 (56%), Gaps = 12/425 (2%)

Query: 4   NLETL-AQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGD---FVVHQGKNSDNL 59
           NLE L ++L ++   NL    G I+ I++    +  L   V  GD    V ++ +N + L
Sbjct: 2   NLEKLRSKLGKE---NLSAIFGEITKISATSIEIRGLKTGV--GDIVKLVSNENENLNTL 56

Query: 60  GQVIRINLDIVYICPVGIGEEISLGDLVF-HWGRFRISPSACWCGRVINALGKPIDGDDS 118
             V+ I     Y+ P    E   +GD  F      +I  S    GRV++   +P DG  S
Sbjct: 57  AMVVEIKEQFSYLSPFSFIEGFKIGDRAFISDAGMQIGVSDELLGRVVDPFMRPKDGKGS 116

Query: 119 LGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLL 178
           +      M IM     AM R  +E+ F  G++ ID       GQ++G+FAGSG+GKSTL+
Sbjct: 117 IEVSKY-MPIMRAPIDAMKRGLIEEVFPVGVKTIDALLTCGVGQKLGIFAGSGVGKSTLM 175

Query: 179 SMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTA 238
            M  ++      +++L+GERGRE+ EFI+  LG     +V++VATSD+S ++RK     A
Sbjct: 176 GMIVKNSKAPIKVVALIGERGREIPEFIQKNLGGKFDDTVLIVATSDDSALMRKYGAFCA 235

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
           +++AEYF  +G +VL I+DS+TRFA + REI    GE P  +GYP SV S LP+L+ER G
Sbjct: 236 MSVAEYFKEQGKDVLFIMDSVTRFAMAQREIGLALGEPPTTKGYPPSVLSLLPQLMERAG 295

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
             E+ KG ITA  +VLVDGD+ +DPIAD  RSILDGHIVL+R L + G YPP++   S S
Sbjct: 296 -KEEGKGTITAFFTVLVDGDDMSDPIADQSRSILDGHIVLSRELTDFGIYPPINIQNSAS 354

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+     S + K        L    +E   +  IG Y+ G D  LD+A+ +   +  FL 
Sbjct: 355 RVMSDIISPEHKLWARKFKRLNSLLKENEVLLRIGAYQKGSDKELDEAISKKEFMQKFLG 414

Query: 419 QSPSD 423
           Q+P +
Sbjct: 415 QNPEE 419


>gi|323975941|gb|EGB71035.1| flagellar protein export ATPase FliI [Escherichia coli TW10509]
 gi|327254539|gb|EGE66155.1| flagellum-specific ATP synthase [Escherichia coli STEC_7v]
          Length = 445

 Score =  273 bits (697), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 152/376 (40%), Positives = 222/376 (59%), Gaps = 10/376 (2%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFR-ISPSACWCGRVINALGKPIDGDDSL 119
           Q +  N DI Y+ P      +  G  VF   +   I     W GRV+N LG+P+DG   L
Sbjct: 60  QAVGFNRDITYLMPFKQPVGLMAGARVFPEEKAHDILIGESWLGRVVNGLGEPLDGKGRL 119

Query: 120 GKGDLSMEIMSKVPPAMN---RQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKST 176
              DL    +  +PP++N   R+ V++    G++ I+    +  GQR+G+ AGSG+GKS 
Sbjct: 120 NGNDL----LPPLPPSVNPLTRRSVDEPLDVGVKAINGLLTIGKGQRVGLMAGSGVGKSV 175

Query: 177 LLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAP 235
           LL M  R    D V++ L+GERGREV+EFI+  LG D L KS+VVVA +DESP++R  A 
Sbjct: 176 LLGMITRQTKADIVVVGLIGERGREVKEFIDHSLGADGLAKSIVVVAPADESPLMRLKAT 235

Query: 236 LTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLE 295
               +IA +F  +G +VLL++DS+TR+A + REIA + GE P  +GYP S F  +P+L+E
Sbjct: 236 ELCHSIAAWFRDRGHHVLLLVDSLTRYAMAQREIALSLGEPPATKGYPPSAFGMIPKLVE 295

Query: 296 RIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLA 355
             G SE   G++TA+ +VL +GD+  DPI D  R++LDGHIVL R LAE G YP +D   
Sbjct: 296 SAGNSES-AGSMTAIYTVLAEGDDQQDPIVDCARAVLDGHIVLTRKLAEAGHYPAIDIGQ 354

Query: 356 SVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYD 415
           S+SR  ++    + ++   +L      + E + +  +GGY  G D  +DKAV   P I  
Sbjct: 355 SISRCMNQVTRPEHQQSARALKQNYAAYMEIKPLIPLGGYVAGADASVDKAVKMFPAIER 414

Query: 416 FLKQSPSDLSSEDVFQ 431
           FL+Q   + +S ++ Q
Sbjct: 415 FLRQEMREPASLELVQ 430


>gi|28869165|ref|NP_791784.1| flagellum-specific ATP synthase FliI [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213967558|ref|ZP_03395706.1| flagellum-specific ATP synthase FliI [Pseudomonas syringae pv.
           tomato T1]
 gi|302059426|ref|ZP_07250967.1| flagellum-specific ATP synthase [Pseudomonas syringae pv. tomato
           K40]
 gi|302134809|ref|ZP_07260799.1| flagellum-specific ATP synthase [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|28852405|gb|AAO55479.1| flagellum-specific ATP synthase FliI [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213927859|gb|EEB61406.1| flagellum-specific ATP synthase FliI [Pseudomonas syringae pv.
           tomato T1]
 gi|331017001|gb|EGH97057.1| flagellum-specific ATP synthase [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 452

 Score =  273 bits (697), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 149/353 (42%), Positives = 212/353 (60%), Gaps = 3/353 (0%)

Query: 70  VYICPVGIGEEISLGDLVFHWG-RFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEI 128
           V++ PVG    I+ G  V       R+       GRV++  G+P+DG   +   D     
Sbjct: 77  VFLMPVGSVAGIAPGARVVPLADTGRLPMGMSMLGRVLDGAGRPLDGRSPIKAEDWVPMD 136

Query: 129 MSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFD 188
              + P + R  + +    GIR I+    +  GQR+G+FAG+G+GKS LL M  R    D
Sbjct: 137 GPTINP-LKRDPISQPLDVGIRCINGLLTVGRGQRLGLFAGTGVGKSVLLGMMTRFTEAD 195

Query: 189 KVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSS 247
            +++ L+GERGREV+EFIE  LG+  LK+SVVV + +D++P++R  A +    IAEYF  
Sbjct: 196 IIVVGLIGERGREVKEFIEHILGEEGLKRSVVVASPADDAPLMRLRAAMYCTRIAEYFRD 255

Query: 248 KGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNI 307
           KG NVLL++DS+TRFA + REIA   GE P  +GYP SVF+ LP+L+ER G +EK  G+I
Sbjct: 256 KGKNVLLLMDSLTRFAQAQREIALAIGEPPATKGYPPSVFARLPKLVERAGNAEKGGGSI 315

Query: 308 TAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSA 367
           TA  +VL +GD+  DPIADS R +LDGHIVL+R LAEEG YP +D  AS+SR+     S 
Sbjct: 316 TAFYTVLSEGDDQQDPIADSARGVLDGHIVLSRRLAEEGHYPAIDIEASISRVMPAVVSP 375

Query: 368 DEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQS 420
           +          L  R+++TRD+  +G Y  G D   D A+   P++  + +Q+
Sbjct: 376 EHMARAQHFKQLWSRYQQTRDLISVGAYVAGGDRETDMAIALHPVLVRYQRQA 428


>gi|170700808|ref|ZP_02891799.1| flagellar protein export ATPase FliI [Burkholderia ambifaria
           IOP40-10]
 gi|170134295|gb|EDT02632.1| flagellar protein export ATPase FliI [Burkholderia ambifaria
           IOP40-10]
          Length = 513

 Score =  273 bits (697), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 146/319 (45%), Positives = 201/319 (63%), Gaps = 4/319 (1%)

Query: 103 GRVINALGKPIDGDDSLG-KGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHG 161
           GRV++A G+P+DG   L  K D S+   S  P  ++R+ +      G+R I+    +  G
Sbjct: 173 GRVVDASGRPLDGLGPLASKVDASLSAPSINP--LDREPIHHVLDVGVRAINALLTVGRG 230

Query: 162 QRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVV 220
           QR+G+FAGSG+GKS LL   AR    + ++I L+GERGREV+EFIE  LG D L +SVVV
Sbjct: 231 QRMGLFAGSGVGKSVLLGTMARYTSAEVIVIGLIGERGREVKEFIEQILGEDGLARSVVV 290

Query: 221 VATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVAR 280
            A +D SP+LR      A ++AEYF  +G +VLL++DS+TR+A + REIA   GE P  +
Sbjct: 291 AAPADVSPLLRMQGAAYATSLAEYFRDQGKHVLLLMDSLTRYAMAQREIALAIGEPPATK 350

Query: 281 GYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNR 340
           GYP SVF++LP L+ER G   +  G+ITA  +VL +GD+  DPIADS R+ILDGHIVL+R
Sbjct: 351 GYPPSVFAKLPALVERTGNGPEGGGSITAFYTVLTEGDDQQDPIADSARAILDGHIVLSR 410

Query: 341 SLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVD 400
           +LAE G YP +D  AS+SR             V     ++ R++  RD+  +G Y PG D
Sbjct: 411 ALAEAGHYPAIDIEASISRAMTALIDETHLDRVRQFKQMLSRYQRNRDLIAVGAYAPGRD 470

Query: 401 LILDKAVHQVPIIYDFLKQ 419
             LD+A+   P I  FL+Q
Sbjct: 471 AQLDRAIALYPRIESFLQQ 489


>gi|283782095|ref|YP_003372850.1| ATPase, FliI/YscN family [Pirellula staleyi DSM 6068]
 gi|283440548|gb|ADB18990.1| ATPase, FliI/YscN family [Pirellula staleyi DSM 6068]
          Length = 455

 Score =  273 bits (697), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 148/321 (46%), Positives = 203/321 (63%), Gaps = 4/321 (1%)

Query: 101 WCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCH 160
             GRVI+A G+ ID   +    D  + +  K P A +R R++  F TG+R ID       
Sbjct: 96  LLGRVIDARGRVIDNKPAPVLAD-RVPLDRKPPAATSRPRIDTTFSTGVRAIDGLLTCGV 154

Query: 161 GQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVV 219
           GQRIGVFAGSG+GKS  L M A+    D ++I L+GERGREV EF+E  LG   L +SV 
Sbjct: 155 GQRIGVFAGSGVGKSVTLGMMAKYSSADVIVIGLIGERGREVNEFLERDLGPTGLARSVC 214

Query: 220 VVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVA 279
           VVATSDE  I+R  A  TA  +AEYF  +G NVLL++DS+TRFA + REI   +GE P  
Sbjct: 215 VVATSDEPAIMRVQAASTATAVAEYFRDQGKNVLLMMDSLTRFALAQREIGLAAGEPPTT 274

Query: 280 RGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLN 339
           RGYP SVF+ LPRL+ER G     +G+ITA+ SVLV+GD+ N+P++D+VR +LDGH++L+
Sbjct: 275 RGYPPSVFALLPRLVERAG--RTPQGSITAIYSVLVEGDDVNEPVSDTVRGLLDGHVILS 332

Query: 340 RSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGV 399
           R LA +  YP ++ L S+SRL  +  +  ++   + +  L+  + E  D+  IG YR G 
Sbjct: 333 RKLAAQSHYPAIEVLGSISRLFTEITTPQQRSAAAIVRELLSAYREHEDLISIGAYRTGA 392

Query: 400 DLILDKAVHQVPIIYDFLKQS 420
           +  +D A+     I  FLKQS
Sbjct: 393 NPTVDTAIAMRGEILQFLKQS 413


>gi|330876013|gb|EGH10162.1| flagellum-specific ATP synthase [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330967114|gb|EGH67374.1| flagellum-specific ATP synthase [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 452

 Score =  272 bits (696), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 149/353 (42%), Positives = 212/353 (60%), Gaps = 3/353 (0%)

Query: 70  VYICPVGIGEEISLGDLVFHWG-RFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEI 128
           V++ PVG    I+ G  V       R+       GRV++  G+P+DG   +   D     
Sbjct: 77  VFLMPVGSVAGIAPGARVVPLADTGRLPMGMSMLGRVLDGAGRPLDGRSPIKAEDWVPMD 136

Query: 129 MSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFD 188
              + P + R  + +    GIR I+    +  GQR+G+FAG+G+GKS LL M  R    D
Sbjct: 137 GPTINP-LKRDPISQPLDVGIRCINGLLTVGRGQRLGLFAGTGVGKSVLLGMMTRFTEAD 195

Query: 189 KVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSS 247
            +++ L+GERGREV+EFIE  LG+  LK+SVVV + +D++P++R  A +    IAEYF  
Sbjct: 196 IIVVGLIGERGREVKEFIEHILGEEGLKRSVVVASPADDAPLMRLRAAMYCTRIAEYFRD 255

Query: 248 KGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNI 307
           KG NVLL++DS+TRFA + REIA   GE P  +GYP SVF+ LP+L+ER G +EK  G+I
Sbjct: 256 KGKNVLLLMDSLTRFAQAQREIALAIGEPPATKGYPPSVFARLPKLVERAGNAEKGGGSI 315

Query: 308 TAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSA 367
           TA  +VL +GD+  DPIADS R +LDGHIVL+R LAEEG YP +D  AS+SR+     S 
Sbjct: 316 TAFYTVLSEGDDQQDPIADSARGVLDGHIVLSRRLAEEGHYPAIDIEASISRVMPAVVSP 375

Query: 368 DEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQS 420
           +          L  R+++TRD+  +G Y  G D   D A+   P++  + +Q+
Sbjct: 376 EHMARAQHFKQLWSRYQQTRDLISVGAYVAGGDRETDMAIALHPVLVRYQRQA 428


>gi|237799238|ref|ZP_04587699.1| flagellum-specific ATP synthase [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331022093|gb|EGI02150.1| flagellum-specific ATP synthase [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 394

 Score =  272 bits (696), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 149/353 (42%), Positives = 212/353 (60%), Gaps = 3/353 (0%)

Query: 70  VYICPVGIGEEISLGDLVFHWG-RFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEI 128
           V++ PVG    I+ G  V       R+       GRV++  G+P+DG   +   D     
Sbjct: 19  VFLMPVGSVAGIAPGARVVPLADTGRLPMGMSMLGRVLDGAGRPLDGRSPIKAEDWVPMD 78

Query: 129 MSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFD 188
              + P + R  + +    GIR I+    +  GQR+G+FAG+G+GKS LL M  R    D
Sbjct: 79  GPTINP-LKRDPISQPLDVGIRCINGLLTVGRGQRLGLFAGTGVGKSVLLGMMTRFTEAD 137

Query: 189 KVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSS 247
            +++ L+GERGREV+EFIE  LG+  LK+SVVV + +D++P++R  A +    IAEYF  
Sbjct: 138 IIVVGLIGERGREVKEFIEHILGEEGLKRSVVVASPADDAPLMRLRAAMYCTRIAEYFRD 197

Query: 248 KGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNI 307
           KG NVLL++DS+TRFA + REIA   GE P  +GYP SVF+ LP+L+ER G +EK  G+I
Sbjct: 198 KGKNVLLLMDSLTRFAQAQREIALAIGEPPATKGYPPSVFARLPKLVERAGNAEKGGGSI 257

Query: 308 TAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSA 367
           TA  +VL +GD+  DPIADS R +LDGHIVL+R LAEEG YP +D  AS+SR+     S 
Sbjct: 258 TAFYTVLSEGDDQQDPIADSARGVLDGHIVLSRRLAEEGHYPAIDIEASISRVMPAVVSP 317

Query: 368 DEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQS 420
           +          L  R+++TRD+  +G Y  G D   D A+   P++  + +Q+
Sbjct: 318 EHMAQAQHFKQLWSRYQQTRDLISVGAYVAGGDRETDMAIALHPVLVRYQRQA 370


>gi|121533760|ref|ZP_01665587.1| flagellar protein export ATPase FliI [Thermosinus carboxydivorans
           Nor1]
 gi|121307751|gb|EAX48666.1| flagellar protein export ATPase FliI [Thermosinus carboxydivorans
           Nor1]
          Length = 439

 Score =  272 bits (696), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 163/366 (44%), Positives = 225/366 (61%), Gaps = 15/366 (4%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSL 119
           +V+    + V + P+G  E I  G  V    R  ++       GRV++ LG PIDG   +
Sbjct: 60  EVVGFRPNHVLLMPIGELEGIGPGCSVIAANRTLKVGVGPDLLGRVLDGLGNPIDGKGPV 119

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
                   + +  PP ++R+R+ +    G+R ID F  L  GQR+G+ AGSG+GKSTLL 
Sbjct: 120 ATA-AEYPLHALPPPPLSRRRITEPLSVGVRAIDGFLTLGRGQRVGIMAGSGVGKSTLLG 178

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTA 238
           M AR+   D  +I+L+GERGREVREFIE  LG D LK+SVVVVATSD+  ++R    +TA
Sbjct: 179 MIARNTEADISVIALIGERGREVREFIERDLGEDGLKRSVVVVATSDQPALVRIKGAMTA 238

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
             IAE+F  +G +V L++DS+TRFA + RE+    GE P  RGY  SVF+ LP+LLER G
Sbjct: 239 TAIAEFFRDQGKDVTLMMDSVTRFAMAQREVGLTVGEPPATRGYTPSVFAMLPKLLERSG 298

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
               +KG+IT + +VL DGD+ N+PIAD+VRSILDGHIVL+R LA +  YP +D LASVS
Sbjct: 299 TG--DKGSITGIYTVLADGDDMNEPIADAVRSILDGHIVLSRDLAAQNHYPAIDVLASVS 356

Query: 359 R----LADKA-WSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPII 413
           R    + DK  W A +K     L  ++  + E  D+  IG Y  G +  +D+AV  +  +
Sbjct: 357 RVMLDIVDKEHWQAAQK-----LRSVLATYHEAEDLINIGAYAAGSNPRIDQAVRLIDGV 411

Query: 414 YDFLKQ 419
             FL+Q
Sbjct: 412 RRFLRQ 417


>gi|304312790|ref|YP_003812388.1| Flagellum-specific atp synthase [gamma proteobacterium HdN1]
 gi|301798523|emb|CBL46753.1| Flagellum-specific atp synthase [gamma proteobacterium HdN1]
          Length = 454

 Score =  272 bits (696), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 149/376 (39%), Positives = 223/376 (59%), Gaps = 3/376 (0%)

Query: 46  GDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRF-RISPSACWCGR 104
           G  ++      D   +V+  + D +++ PV     +  GD V  +    R+       GR
Sbjct: 60  GHCIIRNQDIGDVEAEVVGFSGDKLFLMPVEASLGLKPGDRVIPFREVSRVPVGMQLLGR 119

Query: 105 VINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRI 164
           V++  GKP+DG  +L   +        + P + R  +      G+R I+    +  GQR+
Sbjct: 120 VLDGRGKPLDGKGALDMHNAESLQREAINP-LQRTPISMPLDVGVRAINGLLAVGRGQRM 178

Query: 165 GVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVVVAT 223
           G+FAGSG+GKS LL M  +    D  ++ L+GERGREV+EFIE  LG+  LK+SVVV + 
Sbjct: 179 GLFAGSGVGKSVLLGMMTKFTTADITVVGLIGERGREVKEFIEQILGEEGLKRSVVVASP 238

Query: 224 SDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYP 283
           +DESP++R  A +    IAE+F  +G NVLL++DS+TR+A + REIA + GE P  +GYP
Sbjct: 239 ADESPLMRLRAAVLCTAIAEHFRDQGKNVLLLMDSLTRYAQAQREIALSVGEPPATKGYP 298

Query: 284 TSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLA 343
            SVF++LP L+ER G   +  G+ITA  +VL +GD+  DP+ADS R+ILDGHIVL+R+LA
Sbjct: 299 PSVFAKLPALVERAGNGREGGGSITAFYTVLTEGDDVQDPVADSARAILDGHIVLSRALA 358

Query: 344 EEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLIL 403
           EEG+YP +D  AS+SR   +  SA+  K       L  R++++RD+  +G Y  G D   
Sbjct: 359 EEGQYPAIDIEASISRAMPQIVSAEHLKKAQGFKRLYARYQQSRDLISVGAYVKGSDRET 418

Query: 404 DKAVHQVPIIYDFLKQ 419
           D A+ ++  +  +L Q
Sbjct: 419 DLAISKIAHLKGYLSQ 434


>gi|119899009|ref|YP_934222.1| ATP synthase [Azoarcus sp. BH72]
 gi|119671422|emb|CAL95335.1| ATP synthase [Azoarcus sp. BH72]
          Length = 468

 Score =  272 bits (696), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 145/321 (45%), Positives = 197/321 (61%), Gaps = 2/321 (0%)

Query: 100 CWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLC 159
              GRV++  G+P+DG   L   +        V P +NR  + +    GIR I+    + 
Sbjct: 125 AMLGRVVDGAGRPLDGLGPLNTVETRSLQGRPVNP-LNRAPIAQPLDVGIRAINSLLTVG 183

Query: 160 HGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSV 218
            GQR+G+FAGSG+GKS L+ M AR    D +++ L+GERGREV+EFIE  LG +  K+SV
Sbjct: 184 RGQRLGLFAGSGVGKSVLIGMMARFTSADIIVVGLIGERGREVKEFIEHNLGAEGRKRSV 243

Query: 219 VVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPV 278
           VV A +D SP++R      A TIAEYF  +G  VLLI+DS+TR+A + REIA   GE PV
Sbjct: 244 VVAAPADNSPLMRLQGAAYATTIAEYFRDQGKQVLLIMDSLTRYAMAQREIALAIGEPPV 303

Query: 279 ARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVL 338
            RGYP SVF+ LP L+ER G      G+ITA  +VL +GD+  DPIADS R+ILDGH VL
Sbjct: 304 TRGYPPSVFARLPALVERAGNGPDGGGSITAFYTVLAEGDDQQDPIADSARAILDGHFVL 363

Query: 339 NRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPG 398
           +R+LA++G YP +D   S+SR            LV     L  R++ +RD+  +G Y+PG
Sbjct: 364 SRNLADQGHYPAIDIEQSISRAMHTLVDNAHFDLVRRFKQLFSRYQRSRDLIAVGAYQPG 423

Query: 399 VDLILDKAVHQVPIIYDFLKQ 419
            + +LD AV   P +  FL+Q
Sbjct: 424 AEPLLDMAVALYPRLEAFLQQ 444


>gi|171321711|ref|ZP_02910628.1| flagellar protein export ATPase FliI [Burkholderia ambifaria MEX-5]
 gi|171093012|gb|EDT38244.1| flagellar protein export ATPase FliI [Burkholderia ambifaria MEX-5]
          Length = 517

 Score =  272 bits (696), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 146/319 (45%), Positives = 201/319 (63%), Gaps = 4/319 (1%)

Query: 103 GRVINALGKPIDGDDSLG-KGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHG 161
           GRV++A G+P+DG   L  K D S+   S  P  ++R+ +      G+R I+    +  G
Sbjct: 177 GRVVDASGRPLDGLGPLASKVDASLSAPSINP--LDREPIHHVLDVGVRAINALLTVGRG 234

Query: 162 QRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVV 220
           QR+G+FAGSG+GKS LL   AR    + ++I L+GERGREV+EFIE  LG D L +SVVV
Sbjct: 235 QRMGLFAGSGVGKSVLLGTMARYTSAEVIVIGLIGERGREVKEFIEQILGEDGLARSVVV 294

Query: 221 VATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVAR 280
            A +D SP+LR      A ++AEYF  +G +VLL++DS+TR+A + REIA   GE P  +
Sbjct: 295 AAPADVSPLLRMQGAAYATSLAEYFRDQGKHVLLLMDSLTRYAMAQREIALAIGEPPATK 354

Query: 281 GYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNR 340
           GYP SVF++LP L+ER G   +  G+ITA  +VL +GD+  DPIADS R+ILDGHIVL+R
Sbjct: 355 GYPPSVFAKLPALVERTGNGPEGGGSITAFYTVLTEGDDQQDPIADSARAILDGHIVLSR 414

Query: 341 SLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVD 400
           +LAE G YP +D  AS+SR             V     ++ R++  RD+  +G Y PG D
Sbjct: 415 ALAEAGHYPAIDIEASISRAMTALIDETHLDRVRQFKQMLSRYQRNRDLIAVGAYAPGRD 474

Query: 401 LILDKAVHQVPIIYDFLKQ 419
             LD+A+   P I  FL+Q
Sbjct: 475 AQLDRAIALYPRIESFLQQ 493


>gi|300871682|ref|YP_003786555.1| flagellar biosynthesis/type III secretory pathway ATPase FliI
           [Brachyspira pilosicoli 95/1000]
 gi|300689383|gb|ADK32054.1| flagellar biosynthesis/type III secretory pathway ATPase, FliI
           [Brachyspira pilosicoli 95/1000]
          Length = 489

 Score =  272 bits (696), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 163/390 (41%), Positives = 236/390 (60%), Gaps = 10/390 (2%)

Query: 42  YVCLGDFVVHQGKNSDNL--GQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPS 98
           +  LGD +    KN D     +VI      V +   G    I+ G++V+ + +   I  S
Sbjct: 55  FAKLGD-ICRIYKNDDTYIDAEVIGFRNQDVLLSTYGSVNGITFGNMVYSFDKPLSIICS 113

Query: 99  ACWCGRVINALGKPIDGD-DSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTP 157
               G V+N +GKP+ G      +  + +   S  P  +NR R++K  +TG+R ID    
Sbjct: 114 EKILGTVLNGMGKPLSGGGHKFYETPIPINHTSVNP--LNRPRIKKNIQTGVRAIDGLLT 171

Query: 158 LCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKK 216
           +  GQR+ + +G+G+GKSTLLSM AR+   D  +I+L+GER REV +FIE  LG+  LK+
Sbjct: 172 VGKGQRMAIMSGTGVGKSTLLSMIARNTNADVNVIALIGERRREVLDFIERDLGEEGLKR 231

Query: 217 SVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGEL 276
           SVVVVATSD++P+LR  A  TA TIAEYF  +G +V+ ++DS+TRFA + REI  + GE 
Sbjct: 232 SVVVVATSDDAPLLRVRAAYTATTIAEYFRDQGKDVMFMVDSVTRFALAQREIGLSRGEP 291

Query: 277 PVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHI 336
           P  RGY  SVFSEL +LLER G S   KG ITA  +VLV+GD+ ++PI D+VR ILDGHI
Sbjct: 292 PTTRGYTPSVFSELAQLLERTGTS--SKGTITAFYNVLVEGDDLDEPITDAVRGILDGHI 349

Query: 337 VLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYR 396
           VL+R LA  G +P +D   S+SR+ ++  S   KK       +   + E +++ +IGGY 
Sbjct: 350 VLSRDLANRGHFPAIDINKSISRIMNEVVSNMHKKAAREFLKMSADYNEVKELIMIGGYA 409

Query: 397 PGVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
            G    +D+A+   P++  +L+Q   +LSS
Sbjct: 410 KGSMPEVDRAIEYKPLMDRYLQQDMYELSS 439


>gi|302878296|ref|YP_003846860.1| flagellar protein export ATPase FliI [Gallionella capsiferriformans
           ES-2]
 gi|302581085|gb|ADL55096.1| flagellar protein export ATPase FliI [Gallionella capsiferriformans
           ES-2]
          Length = 500

 Score =  272 bits (696), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 143/318 (44%), Positives = 199/318 (62%), Gaps = 2/318 (0%)

Query: 103 GRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQ 162
           GRV++  GKP+D    L +   S  + S+    + R  ++     G+R I+    +  GQ
Sbjct: 161 GRVLDGAGKPLDQLGPLLE-TASAPLQSRPFNPLERASIDTPLDVGVRAINALLSVGRGQ 219

Query: 163 RIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVV 221
           R+G+FAGSG+GKS LL M AR    D  ++ L+GERGREV+EFI D LG + + +SVVV 
Sbjct: 220 RMGLFAGSGVGKSVLLGMMARYTSADVTVVGLIGERGREVKEFINDILGPEGMARSVVVA 279

Query: 222 ATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARG 281
             +D SP++R      A TIAEYF  +G NVLLI+DS+TRFA + REIA   GE P  +G
Sbjct: 280 TPADTSPLMRLQGTAYATTIAEYFRDQGKNVLLIMDSLTRFAMAQREIALAVGEPPATKG 339

Query: 282 YPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRS 341
           YP SVF++LP+L+ER G   +  G+ITA  +VL +GD+  DPIADS R+ILDGHIVL+R 
Sbjct: 340 YPPSVFAKLPQLVERAGNGLEGGGSITAFYTVLTEGDDQQDPIADSARAILDGHIVLSRR 399

Query: 342 LAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDL 401
           L E+G YP +D  AS+SR+  +  + +   LV     L   ++  RD+  +G Y  G D 
Sbjct: 400 LVEQGHYPAIDIEASISRVMSRLATPEHAALVQRFKQLYAHYQRNRDLISVGAYINGSDP 459

Query: 402 ILDKAVHQVPIIYDFLKQ 419
           +LD+A+   P +  FLKQ
Sbjct: 460 LLDEAIKLYPKMEQFLKQ 477


>gi|125972989|ref|YP_001036899.1| flagellar protein export ATPase FliI [Clostridium thermocellum ATCC
           27405]
 gi|256004786|ref|ZP_05429761.1| ATPase, FliI/YscN family [Clostridium thermocellum DSM 2360]
 gi|281417200|ref|ZP_06248220.1| flagellar protein export ATPase FliI [Clostridium thermocellum
           JW20]
 gi|125713214|gb|ABN51706.1| type III secretion system ATPase, FliI/YscN [Clostridium
           thermocellum ATCC 27405]
 gi|255991236|gb|EEU01343.1| ATPase, FliI/YscN family [Clostridium thermocellum DSM 2360]
 gi|281408602|gb|EFB38860.1| flagellar protein export ATPase FliI [Clostridium thermocellum
           JW20]
 gi|316940775|gb|ADU74809.1| ATPase, FliI/YscN family [Clostridium thermocellum DSM 1313]
          Length = 437

 Score =  272 bits (696), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 146/325 (44%), Positives = 212/325 (65%), Gaps = 12/325 (3%)

Query: 100 CWCGRVINALGKPIDGDDSLGKGDLSME----IMSKVPPAMNRQRVEKGFKTGIRVIDIF 155
              GRVI+ +G+PIDG     KG++  E    + +K P  + R R+++    G++ ID  
Sbjct: 100 ALIGRVIDGMGRPIDG-----KGEIVTETTYPVENKPPHPLKRNRIKEPLPLGVKTIDGL 154

Query: 156 TPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIE-DYLGDNL 214
             +  GQR+G+FAGSG+GKSTL+ M AR+   D  +I+L+GERGREVREFIE D   + L
Sbjct: 155 LTVGKGQRVGIFAGSGVGKSTLIGMIARNTKADVNVIALIGERGREVREFIEKDLKEEGL 214

Query: 215 KKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSG 274
           K+SVVVVATSD+  ++R    L A  IAEYF  +G +VLL++DS+TRFA + REI  + G
Sbjct: 215 KRSVVVVATSDQPALIRLKGALMATAIAEYFRDQGKDVLLLMDSLTRFAMAQREIGLSIG 274

Query: 275 ELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDG 334
           E PV+RGY  SVFS +P+LLER G S  + G+IT + +VLVDGD+  +P+ D+ R ILDG
Sbjct: 275 EPPVSRGYTPSVFSIMPKLLERAGNS--QSGSITGLYTVLVDGDDLTEPVTDTARGILDG 332

Query: 335 HIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGG 394
           HIVL+R+LA + +YP +D LASVSR+       + +K+ + +   +  + E  D+  +G 
Sbjct: 333 HIVLSRNLANKNQYPAIDVLASVSRVMPDIVDDEHQKIANDIKKTMAIYREAEDLINVGA 392

Query: 395 YRPGVDLILDKAVHQVPIIYDFLKQ 419
           Y  G +  +D A+  +  I +F+KQ
Sbjct: 393 YAKGSNEKIDYAIEVIDKIQEFIKQ 417


>gi|302387793|ref|YP_003823615.1| ATPase, FliI/YscN family [Clostridium saccharolyticum WM1]
 gi|302198421|gb|ADL05992.1| ATPase, FliI/YscN family [Clostridium saccharolyticum WM1]
          Length = 433

 Score =  272 bits (696), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 152/350 (43%), Positives = 223/350 (63%), Gaps = 11/350 (3%)

Query: 92  RFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVP--PAMNRQRVEKGFKTGI 149
           R +I       GR+I+A G+P+DG    G  D S     + P    + R  +    + G+
Sbjct: 88  RLKIPVGDFLRGRIIDAKGEPMDGK---GPFDSSRYYYVENPYINPLTRPPITDRLEFGV 144

Query: 150 RVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDY 209
           + ID    +  GQRIG+FAGSG+GKSTLL M AR+   D  +++LVGERGREVREFIE  
Sbjct: 145 KAIDGMNTIGKGQRIGIFAGSGVGKSTLLGMIARNVKADINVVALVGERGREVREFIEKD 204

Query: 210 LG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIRE 268
           LG + +++SV+VVATSD+  +LR   PL A TIAEYF ++G +VLL++DS+TRFA + RE
Sbjct: 205 LGPEGMERSVLVVATSDQPAMLRMKCPLVATTIAEYFKNQGKDVLLMMDSLTRFAMAQRE 264

Query: 269 IATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSV 328
           I    GE PVARGY  S+++E P+LLER G     +G+IT + +VLV+GD+ N+PIAD+V
Sbjct: 265 IGLAIGEPPVARGYTPSIYAEFPKLLERSG--NFGEGSITGIYTVLVEGDDTNEPIADTV 322

Query: 329 RSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRD 388
           R I+DGHIVL+R LA    +P +D  AS+SRL     S + ++L S +  ++  +E+  D
Sbjct: 323 RGIVDGHIVLSRKLANANHFPAIDVSASISRLMTNIVSEEHRRLASEIRDILSIYEKNED 382

Query: 389 IRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
           +  IG Y+ G +  LD+A+ ++  +  FL Q    +   D +++I  K++
Sbjct: 383 LISIGAYKSGTNPKLDQAIARIDKVNQFLCQG---IQENDSYEDILVKMK 429


>gi|315648135|ref|ZP_07901236.1| flagellar protein export ATPase FliI [Paenibacillus vortex V453]
 gi|315276781|gb|EFU40124.1| flagellar protein export ATPase FliI [Paenibacillus vortex V453]
          Length = 439

 Score =  272 bits (696), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 153/366 (41%), Positives = 230/366 (62%), Gaps = 7/366 (1%)

Query: 70  VYICPVGIGEEISLG-DLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEI 128
           V + P+G    I  G D+V       +   +   G+V++ LG+P+DG  S+    +    
Sbjct: 69  VLLMPLGELHSIGPGCDVVGTGKPLSVQVGSELLGKVLDGLGQPLDG--SIIPARMPHYS 126

Query: 129 MSKVPP-AMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCF 187
              VP   +NR RV++    G+R ID    +  GQR+G+FAGSG+GKSTL+ M AR+   
Sbjct: 127 THNVPQNPLNRPRVQEPISIGVRAIDGLLSIGKGQRVGIFAGSGVGKSTLMGMIARNTSA 186

Query: 188 DKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFS 246
           D  +I+L+GERGREV +FIE  LG + LK+SVV+VATSD+  ++R    L A TIAEYF 
Sbjct: 187 DVNVIALIGERGREVLDFIERDLGPEGLKRSVVIVATSDQPALIRIKGALIATTIAEYFR 246

Query: 247 SKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGN 306
            +G NV+L++DS+TR+A + RE+    GE P  RGY  SVF+ LP+LLER G      G+
Sbjct: 247 DRGLNVMLMMDSVTRYAMAQREVGLAVGEPPAMRGYTPSVFASLPKLLERAGTGPT--GS 304

Query: 307 ITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWS 366
           ITA  +VLVDGD+ N+PIAD+VR ILDGHIVLNR++A +G +P +D LAS+SR+      
Sbjct: 305 ITAFYTVLVDGDDMNEPIADAVRGILDGHIVLNRNIANKGHFPAIDVLASISRVMKDISP 364

Query: 367 ADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
            ++     ++  L+  ++++ D+  IG Y+ G +  +D+++  +  I+DF KQ  ++ ++
Sbjct: 365 EEQIDASENVKRLMAVYKDSEDLINIGAYQEGSNADIDESIEYIGRIWDFTKQKVNEKTT 424

Query: 427 EDVFQE 432
            +  QE
Sbjct: 425 LNEVQE 430


>gi|319944165|ref|ZP_08018441.1| flagellar protein export ATPase FliI [Lautropia mirabilis ATCC
           51599]
 gi|319742460|gb|EFV94871.1| flagellar protein export ATPase FliI [Lautropia mirabilis ATCC
           51599]
          Length = 475

 Score =  272 bits (696), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 145/325 (44%), Positives = 206/325 (63%), Gaps = 2/325 (0%)

Query: 103 GRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQ 162
           GRV++A G+P+D    L +   S  I  +   AM+R+ + +   TG+R I+    +  GQ
Sbjct: 127 GRVVDADGRPMDRFGPL-RNVESRPIHGRAINAMDREPIREALDTGVRAINGLLTIGRGQ 185

Query: 163 RIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVVV 221
           RIG+FAG+G+GKS LL M AR    D +++ LVGERGRE++EF+ED LG+ +  ++V+V 
Sbjct: 186 RIGLFAGAGLGKSVLLGMMARYTNADVIVVGLVGERGREIKEFLEDILGEEDRHRAVIVA 245

Query: 222 ATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARG 281
           A SD  PI R      A  IAEYF  +  NVLL++DS+TR+A + REIA + GE P  +G
Sbjct: 246 APSDLPPIARMQGAHYATAIAEYFRDQDMNVLLLMDSLTRYAMAAREIALSIGESPATKG 305

Query: 282 YPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRS 341
           YP SVF+ LP LLER G   + +G+ITA  +VL +GD+ NDP+ADS RS LDGHIVL+R 
Sbjct: 306 YPPSVFARLPALLERTGMGARGQGSITAFYTVLAEGDDQNDPVADSSRSFLDGHIVLSRE 365

Query: 342 LAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDL 401
           LA+ G YP +D   S+SR+      A++++L   L  L   +  +R++  IG Y  G D 
Sbjct: 366 LADAGHYPAIDIEKSISRVMSAVTPAEQQQLARQLKSLWSAYRRSRELITIGAYTEGSDA 425

Query: 402 ILDKAVHQVPIIYDFLKQSPSDLSS 426
            +D+A+  +P+I  FL Q   D SS
Sbjct: 426 RIDRAIELMPMIEAFLCQEVHDPSS 450


>gi|330502766|ref|YP_004379635.1| flagellum-specific ATP synthase [Pseudomonas mendocina NK-01]
 gi|328917052|gb|AEB57883.1| flagellum-specific ATP synthase [Pseudomonas mendocina NK-01]
          Length = 448

 Score =  272 bits (696), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 148/362 (40%), Positives = 222/362 (61%), Gaps = 5/362 (1%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHW-GRFRISPSACWCGRVINALGKPIDGDDSL 119
           +V+  +   +Y+ PVG    I+ G  V       R+       GRV++  G+ +DG   +
Sbjct: 68  EVMGFSAGKIYLMPVGSLAGIAPGARVVPLPDAGRLPMGMTMLGRVLDGAGRALDGKGGM 127

Query: 120 GKGD-LSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLL 178
              D + M+  S  P  +NR  + +    GIR I+    +  GQR+G+FAG+G+GKS LL
Sbjct: 128 KAEDWVPMDGPSINP--LNRDPISQPLDVGIRSINGLLTVGRGQRLGLFAGTGVGKSVLL 185

Query: 179 SMFARSDCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLT 237
            M  R    + +++ L+GERGREV+EFI++ LG+  LK+SVVV + +D++P++R  A   
Sbjct: 186 GMMTRFTEAEIIVVGLIGERGREVKEFIDEILGEEGLKRSVVVASPADDAPLMRLRAAQY 245

Query: 238 AVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERI 297
              IAEYF  KG NVLL++DS+TR+A + REIA   GE P  +GYP SVF++LP+L+ER 
Sbjct: 246 CTRIAEYFRDKGKNVLLLMDSLTRYAQAQREIALAIGEPPATKGYPPSVFAKLPKLVERA 305

Query: 298 GPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASV 357
           G +E   G+ITA  +VL +GD+  DPIAD+ R +LDGH VL+R LAEEG YP VD  +S+
Sbjct: 306 GNAEAGGGSITAFYTVLSEGDDQQDPIADAARGVLDGHFVLSRRLAEEGHYPAVDIESSI 365

Query: 358 SRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFL 417
           SR+  +    ++ K       L  R++++RD+  +G Y PG D   D A+ + PI+  +L
Sbjct: 366 SRVMPQVVPPEQLKQAQRFKQLWSRYQQSRDLISVGAYVPGGDADTDLAIARQPIMAQYL 425

Query: 418 KQ 419
           +Q
Sbjct: 426 RQ 427


>gi|119775429|ref|YP_928169.1| flagellum-specific ATP synthase [Shewanella amazonensis SB2B]
 gi|119767929|gb|ABM00500.1| Sodium-transporting two-sector ATPase [Shewanella amazonensis SB2B]
          Length = 446

 Score =  272 bits (696), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 161/421 (38%), Positives = 238/421 (56%), Gaps = 5/421 (1%)

Query: 5   LETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIR 64
           L  L QL +    N  V  G +  +  V  T+        +G          + + +V+ 
Sbjct: 9   LNNLRQLRQSLPVNRPVAEGQLVRV--VGLTLEASGCRAPVGSLCAIDTMGGELIAEVVG 66

Query: 65  INLDIVYICPVGIGEEISLGDLVFHWG-RFRISPSACWCGRVINALGKPIDGDDSLGKGD 123
            + D++Y+ P+   + +  G  V   G +  I       GRV++  G+P+DG   LG  D
Sbjct: 67  FDEDLLYLMPIEELKGVLPGARVRPLGEQTGIHVGMSLLGRVLDGGGEPLDGLGPLGTTD 126

Query: 124 LSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFAR 183
           ++      + P + R+ + +    GIR I+    +  GQR+G+FAGSG+GKS LL M  R
Sbjct: 127 IAPRHGPAINP-LARRPIHEPLDVGIRAINAMLTVGKGQRMGLFAGSGVGKSVLLGMMTR 185

Query: 184 SDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIA 242
               D +++ LVGERGREV+EFIE+ LG +   +SVVV A +D SP++R  A  T+  IA
Sbjct: 186 GTTADVIVVGLVGERGREVKEFIEEILGPEGRARSVVVAAPADTSPLMRLRACETSTRIA 245

Query: 243 EYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEK 302
           EYF   G NVLL++DS+TR+A + REIA   GE P  +GYP SVF++LPRL+ER G    
Sbjct: 246 EYFRDLGFNVLLLMDSLTRYAQAQREIALAVGEPPATKGYPPSVFAKLPRLVERAGNGGP 305

Query: 303 EKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLAD 362
            +G+ITA  +VL +GD+  DPIAD+ R+ILDGHIVL+R+LA+ G YP +D  AS+SR+A 
Sbjct: 306 GQGSITAFYTVLTEGDDLQDPIADAARAILDGHIVLSRTLADSGHYPAIDIEASISRVAP 365

Query: 363 KAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPS 422
              S    + +  +      +++ RD+  IG Y  G D  +D A+   P +  FL+Q   
Sbjct: 366 MVISPAHLEAMRRVKQTYSLYQQNRDLISIGAYAAGSDPRIDNAIRLQPAMNAFLRQGMR 425

Query: 423 D 423
           D
Sbjct: 426 D 426


>gi|300854211|ref|YP_003779195.1| flagellum-specific ATP synthase [Clostridium ljungdahlii DSM 13528]
 gi|300434326|gb|ADK14093.1| flagellum-specific ATP synthase [Clostridium ljungdahlii DSM 13528]
          Length = 435

 Score =  272 bits (696), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 163/392 (41%), Positives = 238/392 (60%), Gaps = 7/392 (1%)

Query: 50  VHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLG-DLVFHWGRFRISPSACWCGRVINA 108
           ++  +NS    +V+  N   V + P+G    IS G  +V       +  S    G+V++ 
Sbjct: 48  IYNEENSKISCEVVGFNESNVILMPLGELIGISPGCRVVPERMPLNVRCSDELFGKVLDG 107

Query: 109 LGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFA 168
           LG P+DG  +     +   + ++ P  + R+R+ +   TG+R ID F     GQRIG+FA
Sbjct: 108 LGNPLDG--AYISSGVPYPLDTEPPDPLKRRRITEVIATGVRAIDGFLTCGQGQRIGIFA 165

Query: 169 GSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDES 227
           GSG+GKST L M A+    D  +I+L+GERGREV++FIE  LG+  +KKS++V ATSD+ 
Sbjct: 166 GSGVGKSTTLGMIAKYAEADVNVIALIGERGREVKDFIEKDLGEEGMKKSIIVCATSDKP 225

Query: 228 PILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVF 287
            ++R     TA  IAEYF  KG  V+L++DS+TRFA + REI    GE P  +GY  SVF
Sbjct: 226 ALVRLKGAFTATAIAEYFRDKGKKVILMMDSVTRFAMAQREIGLAIGEPPATKGYTPSVF 285

Query: 288 SELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGR 347
           ++LPRL+ER G S+   G+ITA  +VLVDGD+ N+PIAD+VR ILDGHIVL+R+LA +  
Sbjct: 286 AKLPRLMERAGTSDI--GSITAFYTVLVDGDDLNEPIADAVRGILDGHIVLSRTLANKNH 343

Query: 348 YPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAV 407
           YP +D LAS+SRL  +   +D KK  S    ++  ++ + D+  IG Y  G    +DKAV
Sbjct: 344 YPAIDVLASISRLMSEIAESDHKKNASFARDMLSTYKNSEDLINIGAYVKGSSEKIDKAV 403

Query: 408 HQVPIIYDFLKQSPSDLSS-EDVFQEITKKLQ 438
                I  +L+Q  ++ SS E+  +++ K  Q
Sbjct: 404 ACYDKIIAYLRQDVNENSSFEESVEDLKKIFQ 435


>gi|50954407|ref|YP_061695.1| flagellum-like ATP synthase [Leifsonia xyli subsp. xyli str.
           CTCB07]
 gi|50950889|gb|AAT88590.1| flagellum-like ATP synthase [Leifsonia xyli subsp. xyli str.
           CTCB07]
          Length = 441

 Score =  272 bits (696), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 168/418 (40%), Positives = 242/418 (57%), Gaps = 20/418 (4%)

Query: 12  AEDYSKNLVVQG----GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINL 67
           A+ Y+  L V      G ++S   +  TV  L   V  GD V      S    Q++ +  
Sbjct: 8   ADRYAAALRVAAPERVGAVTSAVGLSLTVAGLRGAV--GDLVEIGEPGSVTHAQIVAVGP 65

Query: 68  DIVYICPVGIGEEISLGDLVFHWGRFRISPSAC-----WCGRVINALGKPIDGDDSLGKG 122
           ++  + P+      S G       RF + P          GRVIN LG PIDG   L   
Sbjct: 66  EMTCM-PMTPAAGHSTG----AGARFALRPPTVPTGRGLLGRVINGLGHPIDGKGPL-DA 119

Query: 123 DLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFA 182
              + + + VP  ++R R++     G+R +D   P+  GQR+G+FAGSG+GKS+LLSM A
Sbjct: 120 TSCLPLDNAVPNPLDRARIDTPLPLGVRALDTLIPVGRGQRLGLFAGSGVGKSSLLSMIA 179

Query: 183 RSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTI 241
           R    D  +++L+GERGREVREF+ED LG D L +SVVVVATSDE  ++R+ A   A  I
Sbjct: 180 RGTDADVFVLALIGERGREVREFLEDDLGADGLARSVVVVATSDEPALMRRRAAFAATRI 239

Query: 242 AEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSE 301
           AE F   G + +L++DS+TR A + REI  ++GE P  RGYP+S FS L  LLER G ++
Sbjct: 240 AESFRDNGADAMLMMDSLTRVAMAQREIGLSAGEPPATRGYPSSTFSTLASLLERAGTAK 299

Query: 302 KEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLA 361
              G+IT + +VLVDGD+HN+PIAD+ RSILDGH++L+R LA  G +P +D L S+SRLA
Sbjct: 300 T--GSITGLYTVLVDGDDHNEPIADAARSILDGHVLLDRKLAINGHFPSIDVLGSISRLA 357

Query: 362 DKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
            K  +  ++   ++L  ++      +D+  +G Y+PG + ++D  V     I  FL+Q
Sbjct: 358 GKICTPGQQAAATALRKVMAARRAAQDLLDVGAYKPGANPLVDAGVEHEDRIAAFLQQ 415


>gi|331645405|ref|ZP_08346509.1| flagellar protein export ATPase FliI [Escherichia coli M605]
 gi|331045567|gb|EGI17693.1| flagellar protein export ATPase FliI [Escherichia coli M605]
          Length = 446

 Score =  272 bits (695), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 152/376 (40%), Positives = 222/376 (59%), Gaps = 10/376 (2%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFR-ISPSACWCGRVINALGKPIDGDDSL 119
           Q +  N DI Y+ P      +  G  VF   +   I     W GRV+N LG+P+DG   L
Sbjct: 60  QAVGFNRDITYLMPFKQPVGLMAGARVFPEEKAHDILIGESWLGRVVNGLGEPLDGKGRL 119

Query: 120 GKGDLSMEIMSKVPPAMN---RQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKST 176
              DL    +  +PP++N   R+ V++    G++ I+    +  GQR+G+ AGSG+GKS 
Sbjct: 120 NGNDL----LPPLPPSVNPLTRRSVDEPLDVGVKAINGLLTIGKGQRVGLMAGSGVGKSV 175

Query: 177 LLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAP 235
           LL M  R    D V++ L+GERGREV+EFI+  LG D L KS+VVVA +DESP++R  A 
Sbjct: 176 LLGMITRQAKADIVVVGLIGERGREVKEFIDHSLGADGLAKSIVVVAPADESPLMRLKAT 235

Query: 236 LTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLE 295
               +IA +F  +G +VLL++DS+TR+A + REIA + GE P  +GYP S F  +P+L+E
Sbjct: 236 ELCHSIAAWFRDRGHHVLLLVDSLTRYAMAQREIALSLGEPPATKGYPPSAFGMIPKLVE 295

Query: 296 RIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLA 355
             G SE   G++TA+ +VL +GD+  DPI D  R++LDGHIVL R LAE G YP +D   
Sbjct: 296 SAGNSES-AGSMTAIYTVLAEGDDQQDPIVDCARAVLDGHIVLTRKLAEAGHYPAIDIGQ 354

Query: 356 SVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYD 415
           S+SR  ++    + ++   +L      + E + +  +GGY  G D  +DKAV   P I  
Sbjct: 355 SISRCMNQVTRLEHQQSARALKQNYAAYMEIKPLIPLGGYVAGADASVDKAVKMFPAIER 414

Query: 416 FLKQSPSDLSSEDVFQ 431
           FL+Q   + +S ++ Q
Sbjct: 415 FLRQEMREPASLELVQ 430


>gi|219684590|ref|ZP_03539533.1| flagellar protein export ATPase FliI [Borrelia garinii PBr]
 gi|219671952|gb|EED29006.1| flagellar protein export ATPase FliI [Borrelia garinii PBr]
          Length = 436

 Score =  272 bits (695), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 159/405 (39%), Positives = 245/405 (60%), Gaps = 9/405 (2%)

Query: 36  VTCLSQYVCLGDF-VVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-F 93
           V  L     +GD  ++ Q  N     +V+  N   V +        I +G+ V+   +  
Sbjct: 32  VESLGPQCAVGDLCLIDQRNNKRVCAEVLGFNGPYVSLMAYEGFSGIEVGNKVYSLNKGL 91

Query: 94  RISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVID 153
            I+ S    GRVI++LG+PID   S  K         K+ P +NR   E+   TG++V+D
Sbjct: 92  EINLSDELLGRVIDSLGRPIDNKGSFLKNRYKELTFEKINP-INRSIFEEQILTGVKVLD 150

Query: 154 IFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN 213
            F P+  GQR+G+F+G+G+GKSTLL M A++   D  +I+ +GERGRE+ EFIE  LG+ 
Sbjct: 151 GFLPVAKGQRVGIFSGAGVGKSTLLGMIAKNSNADVNVIAFIGERGRELNEFIEHELGEE 210

Query: 214 -LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATN 272
            LKKSV+VV+TSDESPI R      A  IAEYF  +G +V L+ DSITRFA++ RE++ +
Sbjct: 211 RLKKSVLVVSTSDESPISRYKGAYVATMIAEYFRDQGKDVALLFDSITRFANAKREMSLS 270

Query: 273 SGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSIL 332
            GE PV++GYP SVF E+P LLER G +    G++T   +VLV+GD+  +P+AD+++++L
Sbjct: 271 LGEPPVSKGYPPSVFVEIPILLERSGFN-GNGGSVTGFYTVLVEGDDFTEPVADNIKAVL 329

Query: 333 DGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLI 392
           DGHI+L+R L + G YP ++ L+S SR  ++  S +++KL+    +L+  ++   D+   
Sbjct: 330 DGHIILDRDLFDRGIYPSINILSSTSRSINRIMSLEKQKLIMKARNLLSIYKNYEDLIRT 389

Query: 393 GGYRPGVDLILDKAVHQVPIIYDFLKQSPSDL----SSEDVFQEI 433
           G Y  G +  +D A+ + P I DF+ Q  +++    + ED  +EI
Sbjct: 390 GIYIKGSNKDVDFAISKYPKIIDFISQGINEIYDFENLEDEIREI 434


>gi|33593244|ref|NP_880888.1| type III secretion system ATPase [Bordetella pertussis Tohama I]
 gi|29603230|emb|CAC79575.1| bscN [Bordetella pertussis Tohama I]
 gi|33563619|emb|CAE42520.1| putative ATP synthase in type III secretion system [Bordetella
           pertussis Tohama I]
 gi|332382653|gb|AEE67500.1| type III secretion system ATPase [Bordetella pertussis CS]
          Length = 444

 Score =  272 bits (695), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 157/410 (38%), Positives = 236/410 (57%), Gaps = 16/410 (3%)

Query: 18  NLVVQGGYISSITSVYYTVTCLSQY--VCLGDFVVHQGKNSDNLGQVIRINLDIVYICPV 75
            L ++G  +  + ++   V  + +   VCL   + + G++ +  G+V+    D   + P+
Sbjct: 20  TLRIKGRVVQVVGTIIKAVVPMVKIGEVCL---LRNPGEDFEMHGEVVGFVRDAALLTPI 76

Query: 76  GIGEEISLGDLVFHWGRFRISP-SACWCGRVINALGKPIDGDDSLGKGDLSME----IMS 130
           G    IS    V   GR  + P      GRV++ LG+P+D  +S   G L       + +
Sbjct: 77  GDMYGISSATEVIPTGRTHMVPVGPGLLGRVLDGLGRPLDAAES---GPLHAHKFYPVFA 133

Query: 131 KVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKV 190
             P  + R+ +    + G+RV+D       GQR+G+FA +G GKSTLL M  +    D  
Sbjct: 134 DAPDPLTRRIIHAPLELGVRVLDGLLTCGEGQRLGIFAAAGGGKSTLLGMLVKGAAVDVT 193

Query: 191 IISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKG 249
           +++L+GERGREVREF+E  LG +  +KSV+V ATSD+S + R  A   A  IAEYF  +G
Sbjct: 194 VVALIGERGREVREFLEHELGPEGRRKSVIVCATSDKSSMERAKAAYVATAIAEYFRDQG 253

Query: 250 DNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITA 309
             VL ++DS+TRFA + REI   +GE P  RGYP SVF+ LP+L+ER G ++   G+ITA
Sbjct: 254 QRVLFLMDSVTRFARAQREIGLAAGEPPTRRGYPPSVFATLPKLMERAGMNQT--GSITA 311

Query: 310 VISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADE 369
           + +VLV+GD+ N+P+AD  RSILDGHIVL+R L     YP VD LAS SR+ +   S   
Sbjct: 312 LYTVLVEGDDMNEPVADETRSILDGHIVLSRKLGAANHYPAVDVLASASRVMNAVVSPRH 371

Query: 370 KKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
           K L   +  L+ ++++   +  IG Y+ G D   D+A+ ++  I  FL+Q
Sbjct: 372 KYLAGRMRELMAKYQDVELLVKIGEYKQGADASTDEAIQKIGQINAFLRQ 421


>gi|260866402|ref|YP_003232804.1| putative lateral flagellum-specific ATP synthase [Escherichia coli
           O111:H- str. 11128]
 gi|257762758|dbj|BAI34253.1| predicted lateral flagellum-specific ATP synthase [Escherichia coli
           O111:H- str. 11128]
 gi|323178505|gb|EFZ64083.1| flagellum-specific ATP synthase [Escherichia coli 1180]
          Length = 445

 Score =  272 bits (695), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 152/376 (40%), Positives = 222/376 (59%), Gaps = 10/376 (2%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFR-ISPSACWCGRVINALGKPIDGDDSL 119
           Q +  N DI Y+ P      +  G  VF   +   I     W GRV+N LG+P+DG   L
Sbjct: 60  QAVGFNRDITYLMPFKQPVGLMAGARVFPEEKAHDILIGESWLGRVVNGLGEPLDGKGRL 119

Query: 120 GKGDLSMEIMSKVPPAMN---RQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKST 176
              DL    +  +PP++N   R+ V++    G++ I+    +  GQR+G+ AGSG+GKS 
Sbjct: 120 NGNDL----LPPLPPSVNPLTRRSVDEPLDVGVKAINGLLTIGKGQRVGLMAGSGVGKSV 175

Query: 177 LLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAP 235
           LL M  R    D V++ L+GERGREV+EFI+  LG D L KS+VVVA +DESP++R  A 
Sbjct: 176 LLGMITRQTKADIVVVGLIGERGREVKEFIDHSLGADGLAKSIVVVAPADESPLMRLKAT 235

Query: 236 LTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLE 295
               +IA +F  +G +VLL++D +TR+A + REIA + GE P  +GYP S F  +P+L+E
Sbjct: 236 ELCHSIAAWFRDRGHHVLLLVDFLTRYAMAQREIALSLGEPPATKGYPPSAFGMIPKLVE 295

Query: 296 RIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLA 355
             G SE   G++TA+ +VL +GD+  DPI D  R++LDGHIVL R LAE G YP +D   
Sbjct: 296 SAGNSES-AGSMTAIYTVLAEGDDQQDPIVDCARAVLDGHIVLTRKLAEAGHYPAIDIGQ 354

Query: 356 SVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYD 415
           S+SR  ++  S + ++   +L      + E + +  +GGY  G D  +DKAV   P I  
Sbjct: 355 SISRCMNQVTSLEHQQSARALKQNYAAYMEIKPLIPLGGYVAGADASVDKAVKMFPAIER 414

Query: 416 FLKQSPSDLSSEDVFQ 431
           FL+Q   + +S ++ Q
Sbjct: 415 FLRQEMREPASLELVQ 430


>gi|54294644|ref|YP_127059.1| flagellum-specific ATP synthase FliI [Legionella pneumophila str.
           Lens]
 gi|53754476|emb|CAH15960.1| flagellum-specific ATP synthase FliI [Legionella pneumophila str.
           Lens]
          Length = 449

 Score =  272 bits (695), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 151/362 (41%), Positives = 225/362 (62%), Gaps = 3/362 (0%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRF-RISPSACWCGRVINALGKPIDGDDSL 119
           +V+  + + VY+  +G  + I+ G  +   GR  +++      GR++N  G  ID D   
Sbjct: 63  EVVGFSNESVYLMSIGDIQGIAPGMKIIPTGRIAQVNVGHQLLGRILNGSGMFID-DGPP 121

Query: 120 GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLS 179
           G+   +  ++ +V   + R  +E     GIR I+    +  GQRIG+FAGSG+GKS LL 
Sbjct: 122 GEMVETYPLIGQVINPLKRAPIEVPLDVGIRAINGLLTVGRGQRIGLFAGSGVGKSVLLG 181

Query: 180 MFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTA 238
           M  R    D V++ L+GERGREV+EFIE  LG + LK++VVV A +DESP++R      A
Sbjct: 182 MMTRFTEADVVVVGLIGERGREVKEFIECNLGLEGLKRAVVVAAPADESPLMRLHGAKVA 241

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
            +IAEYF  +G +VLL++DS+TRFA + REIA + GE P  +GYP SVF++LP+L+ER G
Sbjct: 242 TSIAEYFRDQGKHVLLLIDSLTRFAQAQREIALSIGEAPATKGYPPSVFAKLPKLVERAG 301

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
                 G+ITA  +VL +GD+  DPIAD+ R+ILDGH+VL+R+LAE+G+YP +D  AS+S
Sbjct: 302 NGTAGGGSITAFYTVLTEGDDLQDPIADAARAILDGHVVLSRALAEQGQYPAIDLEASIS 361

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+     S    K +      +  +E+ +D+ L+G Y  G D ++DKA+  V  + D+L 
Sbjct: 362 RVMQGVVSEQHMKDMLLFKKYLSVYEKNKDLILLGAYAKGSDPLVDKAILAVNKLKDYLA 421

Query: 419 QS 420
           Q 
Sbjct: 422 QG 423


>gi|209522226|ref|ZP_03270862.1| flagellar protein export ATPase FliI [Burkholderia sp. H160]
 gi|209497340|gb|EDZ97559.1| flagellar protein export ATPase FliI [Burkholderia sp. H160]
          Length = 546

 Score =  272 bits (695), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 142/318 (44%), Positives = 201/318 (63%), Gaps = 2/318 (0%)

Query: 103 GRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQ 162
           GRV++A G+P+DG   LG   +   + + V   +NR+ + K    G+R I+    +  GQ
Sbjct: 210 GRVLDASGRPLDGLGPLGT-QIDAPLSAPVINPLNREPIHKVLDVGVRAINSLLTVGRGQ 268

Query: 163 RIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVV 221
           R+G+FAGSG+GKS LL   AR    + ++I L+GERGREV+EFIE  LG D L +SVV+ 
Sbjct: 269 RMGLFAGSGVGKSVLLGTMARYTSAEVIVIGLIGERGREVKEFIEQILGEDGLARSVVIA 328

Query: 222 ATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARG 281
           A +D SP+LR  A   + ++AEYF  +G +VLL++DS+TR+A + REIA   GE P  +G
Sbjct: 329 APADVSPLLRMQAAAYSTSLAEYFRDQGKHVLLLMDSLTRYAMAQREIALAIGEPPATKG 388

Query: 282 YPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRS 341
           YP SVF++LP L+ER G      G+ITA  +VL +GD+  DPIADS R+ILDGHIVL+RS
Sbjct: 389 YPPSVFAKLPALVERTGNGPAGGGSITAFYTVLTEGDDQQDPIADSARAILDGHIVLSRS 448

Query: 342 LAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDL 401
           LAE G YP +D  AS+SR        +          ++ R++  RD+  +G Y  G D 
Sbjct: 449 LAEAGHYPAIDIEASISRAMTALIDDNHLNKTRMFKQMLSRYQRNRDLINVGAYSSGRDA 508

Query: 402 ILDKAVHQVPIIYDFLKQ 419
           +LD+A+   P +  FL+Q
Sbjct: 509 VLDRAIALYPRMEAFLQQ 526


>gi|325918314|ref|ZP_08180451.1| ATPase FliI/YscN family [Xanthomonas vesicatoria ATCC 35937]
 gi|325535454|gb|EGD07313.1| ATPase FliI/YscN family [Xanthomonas vesicatoria ATCC 35937]
          Length = 458

 Score =  272 bits (695), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 145/323 (44%), Positives = 207/323 (64%), Gaps = 12/323 (3%)

Query: 103 GRVINALGKPIDGDDSL-GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHG 161
           GRVI++ G P+DG   + G+G +SM  MS  P  + R+ +      G+R I+   P+  G
Sbjct: 119 GRVIDSDGTPLDGKGPIRGEGSVSMAGMSINP--LAREPITTSLDVGVRAINAMLPIGRG 176

Query: 162 QRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVV 220
           QR+G+FAGSG+GKSTLL M  R    D +++ L+GERGREVR+F+E  LG+  L+++VVV
Sbjct: 177 QRVGLFAGSGVGKSTLLGMMTRFTSADVIVVGLIGERGREVRDFVETTLGEEGLRRAVVV 236

Query: 221 VATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVAR 280
            A +D  P+ R      A  IAE+F  +G NVLL++DS+TRFA + REI  + GE P  R
Sbjct: 237 AAPADRPPLARLHGAYRATAIAEWFRDQGLNVLLLMDSLTRFAQAQREIGLSVGEPPTTR 296

Query: 281 GYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNR 340
           GYP SVF++LP L+ER G   K +G+ITA  +VL +GD+  DPIAD+ R+ILDGHI+L+R
Sbjct: 297 GYPPSVFAKLPALVERAGNGAKGRGSITAFYTVLTEGDDPQDPIADAARAILDGHILLSR 356

Query: 341 SLAEEGRYPPVDPLASVSR----LADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYR 396
            +A+ G YP +D  +SVSR    +AD+ W    +  +  L  L+  +   RD+  IG Y+
Sbjct: 357 RVADSGLYPAIDLESSVSRVVQDIADEPW----RLRIRKLKRLLSAYTANRDLIAIGAYQ 412

Query: 397 PGVDLILDKAVHQVPIIYDFLKQ 419
            G D   D+A+ + P I +FL Q
Sbjct: 413 RGSDPATDEALARWPEIVEFLGQ 435


>gi|313683644|ref|YP_004061382.1| ATPase, flii/yscn family [Sulfuricurvum kujiense DSM 16994]
 gi|313156504|gb|ADR35182.1| ATPase, FliI/YscN family [Sulfuricurvum kujiense DSM 16994]
          Length = 434

 Score =  272 bits (695), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 163/421 (38%), Positives = 238/421 (56%), Gaps = 18/421 (4%)

Query: 29  ITSVYYTVTCLSQ--------YVCLGDFV--VHQGKNSDNLGQVIRINLDIVYICPVGIG 78
           +T+V+ TV+ +S         +V +GD V  V +   ++ LG V  +  +  +I P    
Sbjct: 15  LTTVFGTVSKISPTVIVAEGLHVSIGDTVLMVSETSGAEALGMVSEVERNRFFITPFRFV 74

Query: 79  EEISLGDLVF-HWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVP-PAM 136
           E    GD V+ +     I       GRV++    PIDG   +       E + K P  AM
Sbjct: 75  EGFRAGDKVYPNQSGMMIEVGEALLGRVVDPFMNPIDGKGPIAGSHF--ESIIKAPIAAM 132

Query: 137 NRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVG 196
            R  +++ F  G++ ID       GQ++G+FAGSG+GKSTL+ M  R       +++L+G
Sbjct: 133 KRGMIDEPFSVGVKTIDGLLTCGKGQKLGIFAGSGVGKSTLMGMIVRGADAPIKVVALIG 192

Query: 197 ERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLIL 256
           ERGREV EFIE  LG NL+ +V+VVATSD+SP++RK    +A+++AEYF  KG +VL ++
Sbjct: 193 ERGREVPEFIEKSLGGNLENTVLVVATSDDSPLMRKYGAFSAMSVAEYFKGKGQDVLFMM 252

Query: 257 DSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVD 316
           DS+TRFA + REI    GE P ++GYP S  + LP+L+ER G  E+  G+ITA  +VLV+
Sbjct: 253 DSVTRFAMAQREIGLALGEPPTSKGYPPSSLTLLPQLMERAG-KEEGSGSITAFFTVLVE 311

Query: 317 GDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSL 376
           GD+ +DPIAD  RSILDGHIVL+R L + G YPP+  L S SR+ +   + +    V   
Sbjct: 312 GDDMSDPIADQSRSILDGHIVLSRELTDFGIYPPIHILNSASRVMNDIITPEHLAAVRRF 371

Query: 377 THLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKK 436
             L    +E   +  IG Y  G D  LD+A+ +   +  FL Q    +S    +QE   +
Sbjct: 372 RRLYTLLKENEMLIRIGAYVRGTDRELDEAISKKEKMEAFLSQEAMSISG---YQESIDQ 428

Query: 437 L 437
           L
Sbjct: 429 L 429


>gi|107101129|ref|ZP_01365047.1| hypothetical protein PaerPA_01002161 [Pseudomonas aeruginosa PACS2]
          Length = 429

 Score =  272 bits (695), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 146/336 (43%), Positives = 209/336 (62%), Gaps = 4/336 (1%)

Query: 91  GRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIR 150
           G  R++      G+V++ LG+P DG     +      +    PP M+R+ +E+    G+R
Sbjct: 83  GMHRVAVGEHLLGQVLDGLGRPFDGSPP-AEPAAWYPVYRDAPPPMSRRLIERPLSLGVR 141

Query: 151 VIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYL 210
            ID       GQR+G+FA +G GKSTLL+   R+   D  +++LVGERGREVREFIE  L
Sbjct: 142 AIDGLLTCGEGQRMGIFAAAGGGKSTLLASLVRNAEVDVTVLALVGERGREVREFIESDL 201

Query: 211 GDN-LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREI 269
           G+  L++SV+VVATSD   + R  A   A +IAEYF  +G  VLL++DS+TRFA + REI
Sbjct: 202 GEQGLRRSVLVVATSDRPAMERAKAGFVATSIAEYFRDQGRRVLLLMDSLTRFARAQREI 261

Query: 270 ATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVR 329
              +GE P  RGYP SVF+ LPRL+ER G SE+  G+ITA+ +VLV+GD+ ++P+AD  R
Sbjct: 262 GLAAGEPPTRRGYPPSVFAALPRLMERAGQSER--GSITALYTVLVEGDDMSEPVADETR 319

Query: 330 SILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDI 389
           SILDGHIVL+R LA    YP +D L SVSR+ ++    D++     L   + ++EE   +
Sbjct: 320 SILDGHIVLSRKLAAANHYPAIDVLHSVSRVMNQIVDDDQRHAAGRLREWLAKYEEVELL 379

Query: 390 RLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLS 425
             IG Y+ G D   D+A+ ++  I  +L+Q   + S
Sbjct: 380 LKIGEYQKGQDSEADRAIEKIAAIRQWLRQGTHETS 415


>gi|323703172|ref|ZP_08114825.1| flagellar protein export ATPase FliI [Desulfotomaculum nigrificans
           DSM 574]
 gi|323531831|gb|EGB21717.1| flagellar protein export ATPase FliI [Desulfotomaculum nigrificans
           DSM 574]
          Length = 443

 Score =  272 bits (695), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 153/357 (42%), Positives = 216/357 (60%), Gaps = 5/357 (1%)

Query: 72  ICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMS 130
           + P+G    I  G  V   GR   +       G+V++ LG+P++GD   G+ +    + +
Sbjct: 74  LMPLGELRGIYPGSAVVPSGRTLTVKVGEHLRGKVLDGLGRPLEGDIHNGQAE-DFPVDN 132

Query: 131 KVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKV 190
           + P  + R+R++    TG+R +D       GQRIG+FAGSG+GKSTLL M AR    D  
Sbjct: 133 RPPNPLKRKRIDTVLPTGVRAVDALLTCGKGQRIGIFAGSGVGKSTLLGMIARHGGADVN 192

Query: 191 IISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKG 249
           +I L+GERGREV EF+E+ LG + + KS+VV ATSD+  ++R      A  IAEYF  +G
Sbjct: 193 VIGLIGERGREVLEFLEEDLGPEGMAKSIVVAATSDQPALVRLKGAFVATAIAEYFRDRG 252

Query: 250 DNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITA 309
            +V+L++DS+TRFA + RE+    GE P  +GY  SVF+ LP+LLER G  +   G+ITA
Sbjct: 253 LDVMLMMDSVTRFAMAQREVGLAVGEPPATKGYTPSVFALLPKLLERSGMGQN--GSITA 310

Query: 310 VISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADE 369
             +VLVDGD+ N+PIAD+VR ILDGHIVLNRSLA    YP +D L SVSRL     S + 
Sbjct: 311 FYTVLVDGDDLNEPIADAVRGILDGHIVLNRSLASRNHYPAIDVLQSVSRLMPDIVSEEH 370

Query: 370 KKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSS 426
           K     +  L+  + +  D+  IG Y  G +  +D A+ +   I +FL+Q P + SS
Sbjct: 371 KAQAGMVKDLLAAYLQAEDLINIGAYVKGSNPKIDAAIAKYDGIINFLRQQPGEFSS 427


>gi|254457549|ref|ZP_05070977.1| flagellum-specific ATP synthase [Campylobacterales bacterium GD 1]
 gi|207086341|gb|EDZ63625.1| flagellum-specific ATP synthase [Campylobacterales bacterium GD 1]
          Length = 438

 Score =  272 bits (695), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 161/424 (37%), Positives = 238/424 (56%), Gaps = 10/424 (2%)

Query: 16  SKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFV--VHQGKNSDNLGQVIRINLDIVYIC 73
           SKN  V  G +  I +   T   LS  V + D V  +      + +G V  I+    +I 
Sbjct: 12  SKNYSVAFGEVIKINATIITAKGLS--VSISDMVKIISNSTAQETMGMVTEIDGATFFIT 69

Query: 74  PVGIGEEISLGDLVF-HWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKV 132
           P    E    GD VF       I       GRV++   +PID   ++    + M  + K 
Sbjct: 70  PFSFVEGFCSGDRVFLDQTGMNIPVGQALLGRVVDPFMRPIDEKGTISS--IKMSPIIKA 127

Query: 133 P-PAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVI 191
           P  AM R  +++ F  G++ ID       GQ++G+FAGSG+GKSTL+ M  +       +
Sbjct: 128 PIAAMKRGMIDEIFSVGVKSIDGLLTCGKGQKLGIFAGSGVGKSTLMGMIVKGSTAPIKV 187

Query: 192 ISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDN 251
           ++L+GERGREV EFIE  LG +L+ +V++VATSD+SP++RK     A+++AEYF  +G +
Sbjct: 188 VALIGERGREVPEFIEKNLGGDLENTVIIVATSDDSPLMRKYGAFAAMSVAEYFKDQGLD 247

Query: 252 VLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVI 311
           VL I+DS+TRFA + REI    GE P ++GYP S  + LP+L+ER G  E  KG+ITA  
Sbjct: 248 VLFIMDSVTRFAMAQREIGLALGEPPTSKGYPPSSLTLLPQLMERAG-KEDGKGSITAFF 306

Query: 312 SVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKK 371
           +VL++GD+ +DPIAD  RSILDGHIVL+R L + G YPP+  L S SR+ +   S +  +
Sbjct: 307 TVLIEGDDMSDPIADQSRSILDGHIVLSRELTDFGIYPPIHILNSASRVMNDIISKEHLQ 366

Query: 372 LVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPS-DLSSEDVF 430
           +V     L    +E   +  IG Y  G D  LD+A+++   +  F+ Q  +   + +D  
Sbjct: 367 MVMKFRRLYTLLKENEMLIRIGAYVKGTDSELDEAMNKKEGMEKFMSQDANMQTNYQDTL 426

Query: 431 QEIT 434
            E+T
Sbjct: 427 DELT 430


>gi|219685772|ref|ZP_03540583.1| flagellar protein export ATPase FliI [Borrelia garinii Far04]
 gi|219672711|gb|EED29739.1| flagellar protein export ATPase FliI [Borrelia garinii Far04]
          Length = 436

 Score =  272 bits (695), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 159/405 (39%), Positives = 245/405 (60%), Gaps = 9/405 (2%)

Query: 36  VTCLSQYVCLGDF-VVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-F 93
           V  L     +GD  ++ Q  N     +V+  N   V +        I +G+ V+   +  
Sbjct: 32  VESLGPQCAVGDLCLIDQRNNKRVCAEVLGFNGPYVSLMAYEGFSGIEVGNKVYSLNKGL 91

Query: 94  RISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVID 153
            I+ S    GRVI++LG+PID   S  K         K+ P +NR   E+   TG++V+D
Sbjct: 92  EINLSDELLGRVIDSLGRPIDNKGSFLKNRYKELTFEKINP-INRSIFEEQILTGVKVLD 150

Query: 154 IFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN 213
            F P+  GQR+G+F+G+G+GKSTLL M A++   D  +I+ +GERGRE+ EFIE  LG+ 
Sbjct: 151 GFLPVAKGQRVGIFSGAGVGKSTLLGMIAKNSNADVNVIAFIGERGRELNEFIEHELGEE 210

Query: 214 -LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATN 272
            LKKSV+VV+TSDESPI R      A  IAEYF  +G +V L+ DSITRFA++ RE++ +
Sbjct: 211 RLKKSVLVVSTSDESPISRYKGAYVATMIAEYFRDQGKDVALLFDSITRFANAKREMSLS 270

Query: 273 SGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSIL 332
            GE PV++GYP SVF E+P LLER G +    G++T   +VLV+GD+  +P+AD+++++L
Sbjct: 271 LGEPPVSKGYPPSVFVEIPILLERSGFN-GNGGSVTGFYTVLVEGDDFTEPVADNIKAVL 329

Query: 333 DGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLI 392
           DGHI+L+R L + G YP ++ L+S SR  ++  S +++KL+    +L+  ++   D+   
Sbjct: 330 DGHIILDRDLFDRGIYPSINILSSTSRSINRIMSLEKQKLIMKARNLLSIYKNYEDLIRA 389

Query: 393 GGYRPGVDLILDKAVHQVPIIYDFLKQSPSDL----SSEDVFQEI 433
           G Y  G +  +D A+ + P I DF+ Q  +++    + ED  +EI
Sbjct: 390 GIYIKGSNKDVDFAISKYPKIIDFISQGINEIFDFENLEDEIREI 434


>gi|224531735|ref|ZP_03672367.1| flagellar protein export ATPase FliI [Borrelia valaisiana VS116]
 gi|224511200|gb|EEF81606.1| flagellar protein export ATPase FliI [Borrelia valaisiana VS116]
          Length = 436

 Score =  272 bits (695), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 154/387 (39%), Positives = 236/387 (60%), Gaps = 5/387 (1%)

Query: 36  VTCLSQYVCLGDF-VVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-F 93
           V  L     +GD  ++ Q  N     +V+  N   V +        I +G+ V+   +  
Sbjct: 32  VESLGPQCAVGDLCLIDQRNNKKVCAEVLGFNGPYVSLMAYEGFSGIEVGNKVYSLNKGL 91

Query: 94  RISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVID 153
            I+ S    GRVI++LG+PID   +         I  K+ P +NR   E+   TG++V+D
Sbjct: 92  EINLSDELLGRVIDSLGRPIDNKGAFLNNRYKELIFEKINP-INRSIFEEQILTGVKVLD 150

Query: 154 IFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN 213
            F P+  GQR+G+F+G+G+GKSTLL+M A++   D  +I+ +GERGRE+ EFIE  LG+ 
Sbjct: 151 GFLPVAKGQRVGIFSGAGVGKSTLLAMIAKNSNADVNVIAFIGERGRELNEFIEHELGEE 210

Query: 214 -LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATN 272
            LKKSV+VV+TSDESPI R      A  IAEYF  +G +V L+ DSITRFA++ RE++ +
Sbjct: 211 RLKKSVLVVSTSDESPISRYKGAYVATMIAEYFREQGKDVALLFDSITRFANAKREMSLS 270

Query: 273 SGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSIL 332
            GE PVA+GYP SVF E+P LLER G +    G++T   +VLV+GD+  +P+ D+++++L
Sbjct: 271 LGEPPVAKGYPPSVFFEIPILLERSGFN-GNGGSVTGFYTVLVEGDDFTEPVVDNIKAVL 329

Query: 333 DGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLI 392
           DGHI+L+R L + G YP ++ L+S SR   +  S +++KL+    +L+  +++  D+   
Sbjct: 330 DGHIILDRDLFDRGIYPSINVLSSTSRSVHRIMSLEKQKLIMKARNLLSVYKDYEDLVRT 389

Query: 393 GGYRPGVDLILDKAVHQVPIIYDFLKQ 419
           G Y  G +  +D A+ + P I DF+ Q
Sbjct: 390 GIYLKGSNKDVDFAISKYPKIIDFISQ 416


>gi|302874592|ref|YP_003843225.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Clostridium cellulovorans 743B]
 gi|307690797|ref|ZP_07633243.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Clostridium cellulovorans 743B]
 gi|302577449|gb|ADL51461.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Clostridium cellulovorans 743B]
          Length = 435

 Score =  271 bits (694), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 161/399 (40%), Positives = 241/399 (60%), Gaps = 11/399 (2%)

Query: 43  VCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWG-RFRISPSACW 101
           VCL    ++  +  +   +V+    D + + P+G    I+ G  V   G    ++ S   
Sbjct: 45  VCL----IYNTQGKEIHCEVVGFKSDDIILMPLGELVGIAPGCRVVATGIPLSVNCSYDL 100

Query: 102 CGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHG 161
            G++I+ LG+P+D   S+ +G++   + +  P  + R+R+++   TG+R ID F     G
Sbjct: 101 LGKIIDGLGRPLD-KSSIPQGEM-YPLDTNPPDPLKRRRIKEILPTGVRAIDGFLTCGEG 158

Query: 162 QRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVV 220
           QR+G+FAGSG+GKSTLL M AR    D  +I+L+GERGREV +FIE  LG+  +K+S+VV
Sbjct: 159 QRVGIFAGSGVGKSTLLGMIAREAQADINVIALIGERGREVLDFIEKDLGEEGMKRSIVV 218

Query: 221 VATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVAR 280
            ATSD+  ++R     TA  IAEYF  +G  V+L++DS+TRFA + RE+    GE P  +
Sbjct: 219 CATSDQPALVRLKGAFTATAIAEYFRDQGKKVILMMDSVTRFAMAQREVGLAVGEPPATK 278

Query: 281 GYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNR 340
           GY  SVF+ LP+L+ER G SEK  G+ITA  +VLVDGD+ N+PIAD+VR ILDGHIVL+R
Sbjct: 279 GYTPSVFAMLPKLMERSGMSEK--GSITAFYTVLVDGDDFNEPIADAVRGILDGHIVLSR 336

Query: 341 SLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVD 400
           +LA +  +P +D L+S+SRL  +    + KK  S    L+  ++ + D+  IG Y  G +
Sbjct: 337 ALAAQNHFPAIDVLSSISRLMSEIAEEEHKKSASLARDLLATYKNSEDLINIGAYVSGSN 396

Query: 401 LILDKAVHQVPIIYDFLKQSPSDLSS-EDVFQEITKKLQ 438
             +D A+     I  FLKQ   + S+ ED    + K  +
Sbjct: 397 KKIDMAIFHNEKINLFLKQQVKEKSAFEDSIDNLKKMFK 435


>gi|28898442|ref|NP_798047.1| type III secretion system ATPase [Vibrio parahaemolyticus RIMD
           2210633]
 gi|260365114|ref|ZP_05777685.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Vibrio parahaemolyticus K5030]
 gi|260876603|ref|ZP_05888958.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Vibrio parahaemolyticus AN-5034]
 gi|260895036|ref|ZP_05903532.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Vibrio parahaemolyticus Peru-466]
 gi|28806659|dbj|BAC59931.1| ATP synthase in type III secretion system [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|308085935|gb|EFO35630.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Vibrio parahaemolyticus Peru-466]
 gi|308093577|gb|EFO43272.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Vibrio parahaemolyticus AN-5034]
 gi|308111730|gb|EFO49270.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Vibrio parahaemolyticus K5030]
          Length = 440

 Score =  271 bits (694), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 152/357 (42%), Positives = 213/357 (59%), Gaps = 21/357 (5%)

Query: 72  ICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSK 131
           + P+G   E+ +GD +               G++++ LG+P DG  S  +      +   
Sbjct: 88  VSPMGKMHEVGVGDHLL--------------GKILDGLGRPFDGAQSQ-EPSAWYPVYRD 132

Query: 132 VPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVI 191
            PP M R+ +EK    G+R ID       GQR+G+FA +G GKSTLL+   RS   D  +
Sbjct: 133 APPPMQRKLIEKPISLGVRSIDGLLTCGEGQRMGIFAAAGGGKSTLLAKLIRSADVDVTV 192

Query: 192 ISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGD 250
           ++L+GERGREVREFIE  LG D + +SV+VVATSD   + R  A   A +IAEYF  +G 
Sbjct: 193 LALIGERGREVREFIEHDLGEDGMARSVLVVATSDRPAMERAKAAFVATSIAEYFRDQGK 252

Query: 251 NVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAV 310
            VLL++DS+TRFA + REI   +GE P  RGYP SVF+ LP+L+ER G S+K  G+ITA+
Sbjct: 253 RVLLLMDSVTRFARAQREIGLAAGEPPTRRGYPPSVFAALPKLMERAGQSDK--GSITAL 310

Query: 311 ISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEK 370
            +VLV+GD+  +P+AD  RSILDGHI+L+R LA    YP +D L S SR+ ++    D +
Sbjct: 311 YTVLVEGDDMTEPVADETRSILDGHIILSRKLAAMNHYPAIDVLRSASRVMNQIVEPDHQ 370

Query: 371 KLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ---SPSDL 424
              + L  ++ ++EE   +  IG Y+ G D   D A+ Q   I  FL+Q    PSDL
Sbjct: 371 AYAAHLREMLAKYEEVELLIKIGEYQHGADPRADLAIAQSDDIRAFLRQGTHEPSDL 427


>gi|194292003|ref|YP_002007910.1| sctn: non flagellar t3S system conserved protein. atpase alpha/beta
           chains family [Cupriavidus taiwanensis LMG 19424]
 gi|193225907|emb|CAQ71854.1| SctN: non flagellar T3S system conserved protein. ATPase alpha/beta
           chains family [Cupriavidus taiwanensis LMG 19424]
          Length = 460

 Score =  271 bits (694), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 172/416 (41%), Positives = 241/416 (57%), Gaps = 16/416 (3%)

Query: 24  GYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEIS- 82
           G + + T +   V  L Q V  G+  +        L +V+        + P+G    +S 
Sbjct: 42  GMLINATGIQAHVGELCQLVTPGEPPL--------LAEVVGFVQQTALLTPLGRTTGVSA 93

Query: 83  LGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVE 142
           L +++      +    A   GRV++ALG+PIDG  +L  G   + + ++ P  + R+ + 
Sbjct: 94  LTEVIPSAHGHQCPAGAALLGRVLDALGEPIDGKGAL-DGVARVPVDNEPPDPLTRRLIR 152

Query: 143 KGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREV 202
           +   TG+R ID    L  GQR+G+FA  G+GKSTLL M AR    D  +++LVGERGREV
Sbjct: 153 EPLATGVRAIDGLLTLGEGQRVGIFAPPGVGKSTLLGMLARGASSDVNVVALVGERGREV 212

Query: 203 REFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITR 261
           REFIE  LG D + ++V+VV+TSD SP+ R     TA  IAE+F  +G  VLL++DS+TR
Sbjct: 213 REFIEYNLGSDGMARTVLVVSTSDRSPMERVRCAYTATAIAEHFRDQGRRVLLLVDSLTR 272

Query: 262 FAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHN 321
            A + REI   SGE P  R YP SVFS LP+LLER G     +G+ITA  +VL +G++ +
Sbjct: 273 LARAQREIGLASGEPPTRRSYPPSVFSMLPQLLERAG--TGVQGSITAAYTVLTEGEDDS 330

Query: 322 DPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIH 381
           DPIA+ VRSILDGHIVL+R LA  G+YPPVD L SVSR+  +  +    +  + L  L+ 
Sbjct: 331 DPIAEEVRSILDGHIVLSRKLASAGQYPPVDVLQSVSRVMPQVVAGAHARDAARLRQLLA 390

Query: 382 RFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKL 437
           R++E   +  IG YRPG D + D AV  +P I  +L Q  + L   D F     KL
Sbjct: 391 RYQELELLLQIGEYRPGADPVADAAVAAMPDIRAYLAQPAARL---DTFAGAVDKL 443


>gi|254176456|ref|ZP_04883114.1| type III secretion cytoplasmic ATPase SctN [Burkholderia mallei
           ATCC 10399]
 gi|160697498|gb|EDP87468.1| type III secretion cytoplasmic ATPase SctN [Burkholderia mallei
           ATCC 10399]
          Length = 442

 Score =  271 bits (694), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 168/431 (38%), Positives = 245/431 (56%), Gaps = 10/431 (2%)

Query: 5   LETLAQLAEDYSKNLVVQG--GYISSITSVYYT-VTCLSQYVCLGDFVVHQGKNSDNL-- 59
           L  L+++A+  +  L ++   G    +  V  T V  +     LG+    +G +   +  
Sbjct: 4   LADLSRVADAMAARLAIEPAVGMTGKVLEVIGTLVRVVGLEATLGELCELRGASGALIQH 63

Query: 60  GQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDS 118
            +V+    ++  + P G   EI+ G  V    R   +       GRVI++ G+PIDG   
Sbjct: 64  AEVVGFTRNVALLSPFGTLGEINRGTRVIGLRRPLSVKVGNGILGRVIDSFGEPIDGRGE 123

Query: 119 LGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLL 178
           L   D    +++  P  M+R+ V+    TG+R++D    L  GQR+G+FA +G+GKSTLL
Sbjct: 124 LDY-DALRPVIAAPPNPMSRRMVDASLATGVRIVDGLITLGEGQRMGIFAPAGVGKSTLL 182

Query: 179 SMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLT 237
            MFAR    D  +I+L+GERGREVREF+E  +G D + +SVVV ATSD S I R  A   
Sbjct: 183 GMFARGASCDVNVIALIGERGREVREFVELIMGEDGMARSVVVCATSDRSSIERAKAAYA 242

Query: 238 AVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERI 297
           A  IAEYF  +G  VLL++DS+TRFAH+ REI   +GE P  RG+P SVF+ELPRLLER 
Sbjct: 243 ATAIAEYFRDQGKRVLLMMDSLTRFAHAGREIGLAAGEPPARRGFPPSVFAELPRLLERT 302

Query: 298 GPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASV 357
           G    E G+ITA+ +VL + D+ +DPIA+ VR ILDGHI+L+R +A   +YP +D L S+
Sbjct: 303 GMG--EHGSITALYTVLAEDDSGSDPIAEEVRGILDGHIILSREIAARNQYPAIDVLGSL 360

Query: 358 SRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFL 417
           SR+  +  + +       L  L+ +  E   +  +G Y+ G D   D+AV ++  I  FL
Sbjct: 361 SRIMPQVATREHVGAAGRLRQLLAKHREIETLLQLGEYQAGSDPAADEAVAKIDRIRAFL 420

Query: 418 KQSPSDLSSED 428
            Q   + S  D
Sbjct: 421 NQRTDEYSPPD 431


>gi|255021376|ref|ZP_05293424.1| Flagellum-specific ATP synthase FliI [Acidithiobacillus caldus ATCC
           51756]
 gi|254969239|gb|EET26753.1| Flagellum-specific ATP synthase FliI [Acidithiobacillus caldus ATCC
           51756]
          Length = 460

 Score =  271 bits (694), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 148/330 (44%), Positives = 209/330 (63%), Gaps = 2/330 (0%)

Query: 91  GRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIR 150
           G  + S S    GRVI+ LG+P+DG D++      + +M      MNR  +      G+R
Sbjct: 101 GEAQGSASPALLGRVIDGLGQPLDGGDAV-PNRTPIPLMGTPLNPMNRMPIRHPLDVGVR 159

Query: 151 VIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYL 210
            I+    +  G R+G+FAGSG+GKS LL M AR+   D +++ L+GERGREV+EFIED L
Sbjct: 160 SINALFTVGRGARMGLFAGSGVGKSVLLGMMARNTEADVIVVGLIGERGREVKEFIEDIL 219

Query: 211 GD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREI 269
           G+  L+++VVV A +D   + R      A  +AEYF  +G +VLL++DS+TR+A + REI
Sbjct: 220 GEAGLRRAVVVAAPADAPALTRIRGAHLATALAEYFRDRGQHVLLLMDSLTRYAMAQREI 279

Query: 270 ATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVR 329
           A   GE P  RGYP SVF+ LP L+ER G   ++ G+ITA  +VL++GD+  DPIADS R
Sbjct: 280 ALAVGEPPAVRGYPPSVFARLPALVERAGNGGRDGGSITAFYTVLMEGDDQQDPIADSAR 339

Query: 330 SILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDI 389
           +ILDGH+VL+RSLAE+G YP +D  AS+SR+      A + + +  L  L  R+ E RD+
Sbjct: 340 AILDGHLVLSRSLAEQGHYPAIDLEASISRVMPNIVPAAQLQALHRLKRLYGRYREQRDL 399

Query: 390 RLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
             +G Y  G+D +LD+AV   P I  FL+Q
Sbjct: 400 IAVGAYSAGLDPVLDQAVQAYPAIEAFLQQ 429


>gi|255507276|ref|ZP_05382915.1| type III secretion system ATPase [Chlamydia trachomatis D(s)2923]
          Length = 442

 Score =  271 bits (694), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 156/383 (40%), Positives = 231/383 (60%), Gaps = 10/383 (2%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDS- 118
           +V+    + V++ P+G    +S    V   G    I       GRV+N LG PID +   
Sbjct: 61  EVVGFTQNFVFLSPLGELTGVSPSSEVMATGLPLHIRAGEGLLGRVLNGLGNPIDTETKG 120

Query: 119 -LGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
            L   D    I    P  ++R ++     TG+R ID    +  GQRIG+FAG+G+GKS+L
Sbjct: 121 PLENVDAIYPIFKAPPDPLHRAKLRTILSTGVRCIDGMLTVAEGQRIGIFAGAGVGKSSL 180

Query: 178 LSMFAR-SDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAP 235
           L M AR ++  D  +I+L+GERGREVREFIE+ LG+  +K+SV+VV+TSD+S  LR  A 
Sbjct: 181 LGMIARNAEEADINVIALIGERGREVREFIENDLGEEGMKRSVIVVSTSDQSSQLRLNAA 240

Query: 236 LTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLE 295
                IAEYF  +G  V+L++DS+TRFA ++RE+   +GE P   GY  SVFS LP+LLE
Sbjct: 241 YVGTAIAEYFRDQGKTVVLMMDSVTRFARALREVGLAAGEPPARAGYTPSVFSTLPKLLE 300

Query: 296 RIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLA 355
           R G S  +KG ITA  +VLV GD+ N+P+AD V+SILDGHIVL+ +LA+   YP +D LA
Sbjct: 301 RAGAS--DKGTITAFYTVLVAGDDMNEPVADEVKSILDGHIVLSNALAQAYHYPAIDVLA 358

Query: 356 SVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYD 415
           S+SRL       ++++++     ++ +++    +  IG YR G D  +D A+  +  +  
Sbjct: 359 SISRLLTAIVPEEQRRIIGRAREVLAKYKANEMLIRIGEYRRGSDREVDFAIDHIDKLNR 418

Query: 416 FLKQSPSDLSSEDVFQEITKKLQ 438
           FLKQ   D+  +  ++E  ++L+
Sbjct: 419 FLKQ---DIHEKTNYEEAAQQLR 438


>gi|74055037|gb|AAZ95842.1| FliI [Aeromonas hydrophila]
          Length = 443

 Score =  271 bits (694), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 140/320 (43%), Positives = 202/320 (63%), Gaps = 2/320 (0%)

Query: 101 WCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCH 160
             GRVI+ +G+P+DG   +           ++ P ++R+ + +    G+R I+    +  
Sbjct: 101 LLGRVIDGIGQPLDGLGPILSSQTVQFAQHRINP-LSRRPIHQPMDVGVRAINAVLTVGQ 159

Query: 161 GQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLK-KSVV 219
           GQR+G+FAGSG+GKS LL M  R    D V++ L+GERGREV+EFIED LG+  + +SVV
Sbjct: 160 GQRMGLFAGSGVGKSVLLGMMTRGSVADVVVVGLIGERGREVKEFIEDILGEEGRARSVV 219

Query: 220 VVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVA 279
           V A +D SP++R     TA+ IAEYF  +G NVLL++DS+TR+A + REIA   GE P  
Sbjct: 220 VAAPADASPLMRLKGCETALAIAEYFRDQGLNVLLLMDSLTRYAQAQREIALAVGEPPAT 279

Query: 280 RGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLN 339
           +GYP SVF++LP L+ER G     +G+ITA  +VL +GD+  DPIAD+ R+ILDGHIVL+
Sbjct: 280 KGYPPSVFAKLPALVERAGNGSDGQGSITAFFTVLTEGDDLQDPIADAARAILDGHIVLS 339

Query: 340 RSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGV 399
           R LA+ G YP +D   S+SR+     S    +L  +L      +++ RD+  IG Y  G 
Sbjct: 340 RELADAGHYPAIDIEKSISRVMPMVTSPQHMELARTLKQFYSLYQQNRDLITIGAYSQGS 399

Query: 400 DLILDKAVHQVPIIYDFLKQ 419
           D  +D+A+ Q P +  FL+Q
Sbjct: 400 DPRIDRAIVQKPYLDQFLQQ 419


>gi|206890201|ref|YP_002248118.1| flagellar protein export ATPase FliI [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206742139|gb|ACI21196.1| flagellar protein export ATPase FliI [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 437

 Score =  271 bits (694), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 154/336 (45%), Positives = 206/336 (61%), Gaps = 6/336 (1%)

Query: 102 CGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHG 161
            GR+I+  G PIDG  SL KG     I  +V   + R+ +++    GIR I+       G
Sbjct: 102 LGRIIDGTGNPIDGGVSL-KGK-PFPIYKEVINPLEREIIKEPLDLGIRAINALITCGKG 159

Query: 162 QRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVV 221
           Q+IG+ AGSG+GKS LL M AR    D  +I+L+GERGREVREFIE+ L D LKKSVVVV
Sbjct: 160 QKIGIMAGSGVGKSVLLGMIARYTSADINVIALIGERGREVREFIENDLADGLKKSVVVV 219

Query: 222 ATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARG 281
           +TSD   + R      A  IAEYF  +G +VLL++DS+TRFA + REI   +GE P  +G
Sbjct: 220 STSDAPALARIRGAFLATAIAEYFREQGKHVLLLMDSLTRFAMAQREIGLAAGEPPTMKG 279

Query: 282 YPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRS 341
           YP SVF+ +P+LLER+G   K  G+IT + +VLV+GD+  DP+AD+ R+ILDGHIVL+R 
Sbjct: 280 YPPSVFNLMPKLLERVGVI-KNGGSITGIYTVLVEGDDLTDPVADASRAILDGHIVLSRE 338

Query: 342 LAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDL 401
           LA    YP +DPL S+SRL          K    L  +I  +    DI  IG Y+ G + 
Sbjct: 339 LANRNHYPAIDPLKSISRLMKDIVDDKHLKYAGRLLDIIATYARYEDIINIGAYKEGTNA 398

Query: 402 ILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKL 437
            +D A+  +  I  FLKQ   D+S +  F+E  +KL
Sbjct: 399 QVDFAIKMMDKINSFLKQ---DISEKADFKESLQKL 431


>gi|51598548|ref|YP_072736.1| flagellum-specific ATP synthase [Borrelia garinii PBi]
 gi|51573119|gb|AAU07144.1| flagellum-specific ATP synthase [Borrelia garinii PBi]
          Length = 436

 Score =  271 bits (694), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 158/405 (39%), Positives = 245/405 (60%), Gaps = 9/405 (2%)

Query: 36  VTCLSQYVCLGDF-VVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-F 93
           V  L      GD  ++ Q  N     +V+  N   V +        I +G+ V+   +  
Sbjct: 32  VESLGPQCAFGDLCLIDQRNNKKVFAEVLGFNGPYVSLMAYEGFSGIEVGNKVYSLNKGL 91

Query: 94  RISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVID 153
            I+ S    GRVI++LG+PID   S  K         K+ P +NR   E+   TG++V+D
Sbjct: 92  EINLSDELLGRVIDSLGRPIDNKGSFLKNRYKELTFEKINP-INRSIFEEQILTGVKVLD 150

Query: 154 IFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN 213
            F P+  GQR+G+F+G+G+GKSTLL M A++   D  +I+ +GERGRE+ EFIE  LG+ 
Sbjct: 151 GFLPVEKGQRVGIFSGAGVGKSTLLGMIAKNSNADVNVIAFIGERGRELNEFIEHELGEE 210

Query: 214 -LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATN 272
            LKKSV+VV+TSDESPI R      A  IAEYF  +G +V L+ DSITRFA++ RE++ +
Sbjct: 211 RLKKSVLVVSTSDESPISRYKGAYVATMIAEYFRDQGKDVALLFDSITRFANAKREMSLS 270

Query: 273 SGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSIL 332
            GE PV++GYP SVF E+P LLER G +    G++T   +VLV+GD+  +P+AD+++++L
Sbjct: 271 LGEPPVSKGYPPSVFVEIPILLERSGFN-GNGGSVTGFYTVLVEGDDFTEPVADNIKAVL 329

Query: 333 DGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLI 392
           DGHI+L+R L + G YP ++ L+S SR  ++  + +++KL+    +L+  +++  D+   
Sbjct: 330 DGHIILDRDLFDRGIYPSINILSSTSRSINRIMNLEKQKLIMKARNLLSIYKDYEDLIRT 389

Query: 393 GGYRPGVDLILDKAVHQVPIIYDFLKQSPSDL----SSEDVFQEI 433
           G Y  G +  +D A+ + P I DF+ Q  +++    + ED  +EI
Sbjct: 390 GIYIKGSNKDVDFAISKYPKIIDFISQGINEIFDFENLEDEIREI 434


>gi|218249447|ref|YP_002374811.1| flagellar protein export ATPase FliI [Borrelia burgdorferi ZS7]
 gi|226321606|ref|ZP_03797132.1| flagellar protein export ATPase FliI [Borrelia burgdorferi Bol26]
 gi|218164635|gb|ACK74696.1| flagellar protein export ATPase FliI [Borrelia burgdorferi ZS7]
 gi|226232795|gb|EEH31548.1| flagellar protein export ATPase FliI [Borrelia burgdorferi Bol26]
          Length = 436

 Score =  271 bits (694), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 155/387 (40%), Positives = 235/387 (60%), Gaps = 5/387 (1%)

Query: 36  VTCLSQYVCLGDFVVHQGKNSDNL-GQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-F 93
           V  L     +GD  +   +N   +  +V+  N   V +        I +G+ V+   +  
Sbjct: 32  VESLGPQCAIGDLCLIDQRNGKKVCAEVLGFNGPYVSLMAYEGFNGIEVGNKVYSLNKGL 91

Query: 94  RISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVID 153
            I+ S    GRVI++LG+PID   S         I  K+ P +NR   E    TG++V+D
Sbjct: 92  EINLSDELLGRVIDSLGRPIDNKGSFLNNSYKELIFEKINP-INRSIFEDQILTGVKVLD 150

Query: 154 IFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN 213
            F P+  GQR+G+F+GSG+GKSTLL M A++   D  +I+ +GERGRE+ EFIE  LG+ 
Sbjct: 151 GFLPVAKGQRVGIFSGSGVGKSTLLGMIAKNSNADVNVIAFIGERGRELNEFIEHELGEE 210

Query: 214 -LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATN 272
            LKKSV+VV+TSDESPI R      A  IAEYF  +G +V L+ DSITRFA++ RE++ +
Sbjct: 211 RLKKSVLVVSTSDESPISRYKGAYVATMIAEYFREQGKDVALLFDSITRFANAKREMSLS 270

Query: 273 SGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSIL 332
            GE PVA+GYP SVF E+P LLER G +    G++T   +VLV+GD+  +P+AD+++++L
Sbjct: 271 LGEPPVAKGYPPSVFVEIPILLERSGFN-GNGGSVTGFYTVLVEGDDFTEPVADNIKAVL 329

Query: 333 DGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLI 392
           DGHI+L+R L + G YP ++ L+S SR   +  S +++KL+    +L+  +++  D+   
Sbjct: 330 DGHIILDRDLFDRGIYPSINVLSSTSRSIHRIMSLEKQKLIMKARNLLSIYKDYEDLIRT 389

Query: 393 GGYRPGVDLILDKAVHQVPIIYDFLKQ 419
           G Y  G +  +D A+ + P I +F+ Q
Sbjct: 390 GIYLKGSNKDVDFAISKYPKIINFISQ 416


>gi|77457766|ref|YP_347271.1| flagellum-specific ATP synthase [Pseudomonas fluorescens Pf0-1]
 gi|77381769|gb|ABA73282.1| flagellum-specific ATP synthase [Pseudomonas fluorescens Pf0-1]
          Length = 452

 Score =  271 bits (694), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 149/356 (41%), Positives = 215/356 (60%), Gaps = 3/356 (0%)

Query: 70  VYICPVGIGEEISLGDLVFHWG-RFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEI 128
           V++ PVG    I+ G  V       R+       GRV++  G+ +DG   +   D     
Sbjct: 77  VFLMPVGSVAGIAPGARVVPLADTGRLPMGMSMLGRVLDGAGRALDGKGGMKAEDWVPMD 136

Query: 129 MSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFD 188
              + P +NR  +      GIR I+    +  GQR+G+FAG+G+GKS LL M  R    D
Sbjct: 137 GPTINP-LNRDPISVPLDVGIRSINGLLTVGRGQRLGLFAGTGVGKSVLLGMMTRFTEAD 195

Query: 189 KVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSS 247
            +++ L+GERGREV+EFIE  LG+  LK+SVVV + +D++P++R  A +    IAEYF  
Sbjct: 196 IIVVGLIGERGREVKEFIEHILGEEGLKRSVVVASPADDAPLMRLRAAMYCTRIAEYFRD 255

Query: 248 KGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNI 307
           KG NVLL++DS+TRFA + REIA   GE P  +GYP SVF++LP+L+ER G +EK  G+I
Sbjct: 256 KGKNVLLLMDSLTRFAQAQREIALAIGEPPATKGYPPSVFAKLPKLVERAGNAEKGGGSI 315

Query: 308 TAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSA 367
           TA  +VL +GD+  DPIADS R +LDGHIVL+R LAEEG YP +D  AS+SR+     + 
Sbjct: 316 TAFYTVLSEGDDQQDPIADSARGVLDGHIVLSRRLAEEGHYPAIDIEASISRVMPAVVAP 375

Query: 368 DEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSD 423
           +  +       L  R++++RD+  +G Y  G D   D A++  P +  +L+Q  +D
Sbjct: 376 EHMQRAQYFKQLWSRYQQSRDLISVGAYVAGGDRETDLAINLQPQLVRYLRQGLND 431


>gi|15605402|ref|NP_220188.1| type III secretion system ATPase [Chlamydia trachomatis D/UW-3/CX]
 gi|166154886|ref|YP_001653141.1| type III secretion system ATPase [Chlamydia trachomatis
           L2b/UCH-1/proctitis]
 gi|255311495|ref|ZP_05354065.1| type III secretion system ATPase [Chlamydia trachomatis 6276]
 gi|255317797|ref|ZP_05359043.1| type III secretion system ATPase [Chlamydia trachomatis 6276s]
 gi|255349058|ref|ZP_05381065.1| type III secretion system ATPase [Chlamydia trachomatis 70]
 gi|255503596|ref|ZP_05381986.1| type III secretion system ATPase [Chlamydia trachomatis 70s]
 gi|3329120|gb|AAC68264.1| Yops secretion ATPase [Chlamydia trachomatis D/UW-3/CX]
 gi|165930874|emb|CAP06436.1| ATP synthase (predicted TTSS protein) [Chlamydia trachomatis
           L2b/UCH-1/proctitis]
 gi|289525713|emb|CBJ15194.1| ATP synthase (predicted TTSS protein) [Chlamydia trachomatis
           Sweden2]
 gi|296435283|gb|ADH17461.1| type III secretion system ATPase [Chlamydia trachomatis E/150]
 gi|296436210|gb|ADH18384.1| type III secretion system ATPase [Chlamydia trachomatis G/9768]
 gi|296437138|gb|ADH19308.1| type III secretion system ATPase [Chlamydia trachomatis G/11222]
 gi|296438070|gb|ADH20231.1| type III secretion system ATPase [Chlamydia trachomatis G/11074]
 gi|296439001|gb|ADH21154.1| type III secretion system ATPase [Chlamydia trachomatis E/11023]
 gi|297140571|gb|ADH97329.1| type III secretion system ATPase [Chlamydia trachomatis G/9301]
 gi|297748800|gb|ADI51346.1| SctN [Chlamydia trachomatis D-EC]
 gi|297749680|gb|ADI52358.1| SctN [Chlamydia trachomatis D-LC]
          Length = 442

 Score =  271 bits (694), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 156/383 (40%), Positives = 231/383 (60%), Gaps = 10/383 (2%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDS- 118
           +V+    + V++ P+G    +S    V   G    I       GRV+N LG PID +   
Sbjct: 61  EVVGFTQNFVFLSPLGELTGVSPSSEVMATGLPLHIRAGEGLLGRVLNGLGNPIDTETKG 120

Query: 119 -LGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
            L   D    I    P  ++R ++     TG+R ID    +  GQRIG+FAG+G+GKS+L
Sbjct: 121 PLENVDAIYPIFKAPPDPLHRAKLRTILSTGVRCIDGMLTVAKGQRIGIFAGAGVGKSSL 180

Query: 178 LSMFAR-SDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAP 235
           L M AR ++  D  +I+L+GERGREVREFIE+ LG+  +K+SV+VV+TSD+S  LR  A 
Sbjct: 181 LGMIARNAEEADINVIALIGERGREVREFIENDLGEEGMKRSVIVVSTSDQSSQLRLNAA 240

Query: 236 LTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLE 295
                IAEYF  +G  V+L++DS+TRFA ++RE+   +GE P   GY  SVFS LP+LLE
Sbjct: 241 YVGTAIAEYFRDQGKTVVLMMDSVTRFARALREVGLAAGEPPARAGYTPSVFSTLPKLLE 300

Query: 296 RIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLA 355
           R G S  +KG ITA  +VLV GD+ N+P+AD V+SILDGHIVL+ +LA+   YP +D LA
Sbjct: 301 RAGAS--DKGTITAFYTVLVAGDDMNEPVADEVKSILDGHIVLSNALAQAYHYPAIDVLA 358

Query: 356 SVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYD 415
           S+SRL       ++++++     ++ +++    +  IG YR G D  +D A+  +  +  
Sbjct: 359 SISRLLTAIVPEEQRRIIGRAREVLAKYKANEMLIRIGEYRRGSDREVDFAIDHIDKLNR 418

Query: 416 FLKQSPSDLSSEDVFQEITKKLQ 438
           FLKQ   D+  +  ++E  ++L+
Sbjct: 419 FLKQ---DIHEKTNYEEAAQQLR 438


>gi|90021830|ref|YP_527657.1| flagellum-specific ATP synthase [Saccharophagus degradans 2-40]
 gi|89951430|gb|ABD81445.1| ATPase FliI/YscN [Saccharophagus degradans 2-40]
          Length = 458

 Score =  271 bits (693), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 152/380 (40%), Positives = 227/380 (59%), Gaps = 7/380 (1%)

Query: 49  VVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFR-ISPSACWCGRVIN 107
           V+   KN D   +V+  N D  Y+ PV   E +  G  V      + ++      GR+IN
Sbjct: 58  VLPHNKNID--AEVVGFNGDKTYLMPVQKVEGLQPGARVVPLDAHQHMAIGEHLRGRIIN 115

Query: 108 ALGKPIDGDDSL-GKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGV 166
            +G+P+DG   L GK ++ M   +  P  ++R  ++     G+R I+    +  GQRIG+
Sbjct: 116 GIGQPLDGKGPLPGKSNVDMAPSAINP--LSRHPIDAPLDVGVRAINGLLTVGRGQRIGL 173

Query: 167 FAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATSD 225
           FAGSG+GKS LL M  R    D V++ L+GERGREV+EFI+  LGD  + ++VV+ + +D
Sbjct: 174 FAGSGVGKSVLLGMMTRFTTADIVVVGLIGERGREVKEFIDQILGDAGMSRAVVIASPAD 233

Query: 226 ESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTS 285
           ++P++R  A      +AE+F  +G N LL++DS+TR+A + REI+   GE P  +GYP S
Sbjct: 234 DAPLMRLRAAELCTRVAEFFRDQGLNCLLLMDSLTRYAQAQREISLAIGEPPATKGYPPS 293

Query: 286 VFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEE 345
           VFS++P L+ER G ++K  G+ITA  +VL +GD+  DPIADS R+ILDGHIVL+R LAEE
Sbjct: 294 VFSKIPELVERAGNADKGGGSITAFYTVLTEGDDLQDPIADSARAILDGHIVLSRDLAEE 353

Query: 346 GRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDK 405
           G YP +D  ASVSR+     + D  +       L+ R+   +D+  IG Y PG D  +D 
Sbjct: 354 GIYPAIDISASVSRVMPSIVTPDHLQKAQKFKALLSRYRANKDLISIGAYTPGTDPNIDG 413

Query: 406 AVHQVPIIYDFLKQSPSDLS 425
           A+ + P +  ++ Q   + S
Sbjct: 414 AIERYPHLNKYICQGMKEAS 433


>gi|237750216|ref|ZP_04580696.1| flagellum-specific ATP synthase [Helicobacter bilis ATCC 43879]
 gi|229374110|gb|EEO24501.1| flagellum-specific ATP synthase [Helicobacter bilis ATCC 43879]
          Length = 455

 Score =  271 bits (693), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 171/440 (38%), Positives = 250/440 (56%), Gaps = 16/440 (3%)

Query: 3   KNLETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFV-VHQGKNSDNLGQ 61
           +NL+    L  + S N     G I S+ +       LS  V  GD V + +G ++   G 
Sbjct: 20  ENLKQKLSLTTNLSPNF----GEIISVETNIIKAVGLSPSV--GDVVWLIRGNDTRTEGI 73

Query: 62  VIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSLG 120
           VI  + ++  I P    E    GD V        I       GRVIN LG P+D   SLG
Sbjct: 74  VIATHKEVFSISPFSFTEGFKSGDRVMIAKEGLNIPVGDELLGRVINPLGVPLD---SLG 130

Query: 121 K--GDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLL 178
                    I++    A+ R  +++ F  G++ ID       GQ++G+FAGSG+GKSTL+
Sbjct: 131 ALYASACTPIINAPISALKRGLIDEVFSVGVKSIDSLLTCGKGQKMGIFAGSGVGKSTLM 190

Query: 179 SMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTA 238
            M  +       +++L+GERGREV EFIE  LG NL+ +V+VVATSD+SP++RK    +A
Sbjct: 191 GMIVKGSAAQIKVVALIGERGREVPEFIEKNLGGNLENTVLVVATSDDSPLMRKYGAFSA 250

Query: 239 VTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIG 298
           + IAE+F  KG +VL I+DS+TRFA + REI    GE P ++GYP SV + LP+L+ER G
Sbjct: 251 MAIAEFFKDKGHDVLFIMDSVTRFAMAQREIGLALGEPPTSKGYPPSVLTLLPQLMERAG 310

Query: 299 PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358
             E+ KG+ITA  +VL++GD+ NDPIAD  RSILDGHI+L+R+L + G YPP++ L S S
Sbjct: 311 -KEEGKGSITAFFTVLMEGDDLNDPIADQSRSILDGHIMLDRNLTDFGIYPPINILNSSS 369

Query: 359 RLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLK 418
           R+     S + K        +    +E   +  IG Y  G D+ LD+A+ +  ++ +FL 
Sbjct: 370 RVMHDIISQEHKNAARKFRRMQALLKENEVLIRIGSYHKGNDVELDEAIDKKALMEEFLG 429

Query: 419 QSPSDLSSEDVFQEITKKLQ 438
           Q  +  SS +  + IT+ ++
Sbjct: 430 QDENIQSSYE--ESITQMIE 447


>gi|260779314|ref|ZP_05888206.1| flagellum-specific ATP synthase FliI [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260605478|gb|EEX31773.1| flagellum-specific ATP synthase FliI [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 448

 Score =  271 bits (693), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 152/382 (39%), Positives = 226/382 (59%), Gaps = 7/382 (1%)

Query: 60  GQVIRINLDIVYICPVG-IGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDS 118
            QV+  +  I Y+ P+  +G   +   ++   G   +  S  W GRV+N LG+ +D    
Sbjct: 66  AQVVGFDHTIAYLMPIRRLGGLFAGAKVIPLDGDSTVQLSENWMGRVVNGLGEALDDGPV 125

Query: 119 LGKGD-LSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
           L  GD +S+E     P  + R+ V+     G+R I+    +  GQRIG+ AGSG+GKS L
Sbjct: 126 LQGGDRVSLEPKPINP--LKRRPVDSPLNVGVRAINGLLTVGKGQRIGLMAGSGVGKSVL 183

Query: 178 LSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLK-KSVVVVATSDESPILRKMAPL 236
           + M  ++   D +++ L+GERGREVREFIE  L    + K++++ A +DESP++R  A L
Sbjct: 184 MGMITQNTEADVIVVGLIGERGREVREFIESNLTPEARDKAIIIAAPADESPLMRLRAML 243

Query: 237 TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLER 296
               +AEYF  KG +VLL++DS+TR+A + REIA + GE P  RGYP SVF+ LP+LLER
Sbjct: 244 LCHRVAEYFRDKGKDVLLMVDSLTRYAMAQREIALSLGEPPATRGYPPSVFNALPQLLER 303

Query: 297 IGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLAS 356
            G SE   G++TA+ ++L  GD+  DP+ DS R+ILDGH+VL+R LAE+G YP +D  AS
Sbjct: 304 AGNSENPNGSLTAIYTILAAGDDQQDPVVDSARAILDGHVVLSRKLAEQGHYPAIDVNAS 363

Query: 357 VSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDF 416
           VSR            L +        + + +D+  +GGY+PG D  LD++V   P +  +
Sbjct: 364 VSRCMTACSQPAHLTLANEFRKTYSNYLQVKDLLPLGGYQPGQDPELDRSVALYPQLTAY 423

Query: 417 LKQSPSDLSSEDVFQEITKKLQ 438
           L+Q+     S D  Q +T+  Q
Sbjct: 424 LQQAAD--CSVDFPQSLTELAQ 443


>gi|312884802|ref|ZP_07744494.1| flagellum-specific ATP synthase FliI [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309367454|gb|EFP95014.1| flagellum-specific ATP synthase FliI [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 447

 Score =  271 bits (693), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 149/363 (41%), Positives = 222/363 (61%), Gaps = 5/363 (1%)

Query: 60  GQVIRINLDIVYICPVG-IGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDS 118
            QV+  + +I Y+ P+  +G   +   ++   G   +  S  W GRV++ LG P+D D  
Sbjct: 66  AQVVGFDHNIAYLMPIRRLGGLFAGAKVIPLDGDSTVQLSDKWLGRVLDGLGHPLDDDGK 125

Query: 119 LGKGD-LSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
           +  G+ +S+E     P  + R+ V+     GI+ I+    +  GQRIG+ AGSG+GKS L
Sbjct: 126 IIGGERVSLEPRRINP--LKRRPVDTPLNVGIKAINGLITVGKGQRIGLMAGSGVGKSIL 183

Query: 178 LSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLK-KSVVVVATSDESPILRKMAPL 236
           L M  ++   D +++ L+GERGREVREFIE  L    + K+V++ A +DESP++R  A L
Sbjct: 184 LGMMCKNTEADVIVVGLIGERGREVREFIEKNLTPEARAKAVIIAAPADESPLMRLKATL 243

Query: 237 TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLER 296
               +AEYF  KG +VLL++DS+TR+A + REIA + GE P  RGYP SVF+ LP+LLER
Sbjct: 244 LCHRVAEYFRDKGKDVLLMMDSLTRYAMAQREIALSLGEPPATRGYPPSVFNILPQLLER 303

Query: 297 IGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLAS 356
            G +E  +G++TA+ ++L   D+  DP+ DS R+ILDGHIVL+R LAE+G YP +D  AS
Sbjct: 304 AGNAENPQGSLTAIYTILAVSDDQQDPVVDSARAILDGHIVLSRHLAEQGHYPAIDINAS 363

Query: 357 VSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDF 416
           +SR            L S        + + +D+  +GGY+PG D  LD++V   PI+ ++
Sbjct: 364 ISRCMGTCVETAHLTLASEFRRHYSAYLQVKDLIPLGGYQPGQDPELDRSVGLYPILSEY 423

Query: 417 LKQ 419
           LKQ
Sbjct: 424 LKQ 426


>gi|76789409|ref|YP_328495.1| type III secretion system ATPase [Chlamydia trachomatis A/HAR-13]
 gi|237803099|ref|YP_002888293.1| type III secretion system ATPase [Chlamydia trachomatis
           B/Jali20/OT]
 gi|237805020|ref|YP_002889174.1| type III secretion system ATPase [Chlamydia trachomatis
           B/TZ1A828/OT]
 gi|76167939|gb|AAX50947.1| SctN [Chlamydia trachomatis A/HAR-13]
 gi|231273320|emb|CAX10235.1| ATP synthase (predicted TTSS protein) [Chlamydia trachomatis
           B/TZ1A828/OT]
 gi|231274333|emb|CAX11128.1| ATP synthase (predicted TTSS protein) [Chlamydia trachomatis
           B/Jali20/OT]
          Length = 442

 Score =  271 bits (693), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 156/383 (40%), Positives = 231/383 (60%), Gaps = 10/383 (2%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDS- 118
           +V+    + V++ P+G    +S    V   G    I       GRV+N LG PID +   
Sbjct: 61  EVVGFTQNFVFLSPLGELTGVSPSSEVMATGLPLHIRAGEGLLGRVLNGLGNPIDTETKG 120

Query: 119 -LGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
            L   D    I    P  ++R ++     TG+R ID    +  GQRIG+FAG+G+GKS+L
Sbjct: 121 PLESVDAIYPIFKAPPDPLHRAKLRTILSTGVRCIDGMLTVAKGQRIGIFAGAGVGKSSL 180

Query: 178 LSMFAR-SDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAP 235
           L M AR ++  D  +I+L+GERGREVREFIE+ LG+  +K+SV+VV+TSD+S  LR  A 
Sbjct: 181 LGMIARNAEEADINVIALIGERGREVREFIENDLGEEGMKRSVIVVSTSDQSSQLRLNAA 240

Query: 236 LTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLE 295
                IAEYF  +G  V+L++DS+TRFA ++RE+   +GE P   GY  SVFS LP+LLE
Sbjct: 241 YVGTAIAEYFRDQGKTVVLMMDSVTRFARALREVGLAAGEPPARAGYTPSVFSTLPKLLE 300

Query: 296 RIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLA 355
           R G S  +KG ITA  +VLV GD+ N+P+AD V+SILDGHIVL+ +LA+   YP +D LA
Sbjct: 301 RAGAS--DKGTITAFYTVLVAGDDMNEPVADEVKSILDGHIVLSNALAQAYHYPAIDVLA 358

Query: 356 SVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYD 415
           S+SRL       ++++++     ++ +++    +  IG YR G D  +D A+  +  +  
Sbjct: 359 SISRLLTAIVPEEQRRIIGRAREVLAKYKANEMLIRIGEYRRGSDREVDFAIDHIDKLNR 418

Query: 416 FLKQSPSDLSSEDVFQEITKKLQ 438
           FLKQ   D+  +  ++E  ++L+
Sbjct: 419 FLKQ---DIHEKTNYEEAAQQLR 438


>gi|15594633|ref|NP_212422.1| flagellum-specific ATP synthase (fliI) [Borrelia burgdorferi B31]
 gi|221217707|ref|ZP_03589175.1| flagellar protein export ATPase FliI [Borrelia burgdorferi 72a]
 gi|223888865|ref|ZP_03623456.1| flagellar protein export ATPase FliI [Borrelia burgdorferi 64b]
 gi|224533156|ref|ZP_03673756.1| flagellar protein export ATPase FliI [Borrelia burgdorferi WI91-23]
 gi|224533724|ref|ZP_03674312.1| flagellar protein export ATPase FliI [Borrelia burgdorferi
           CA-11.2a]
 gi|225549175|ref|ZP_03770150.1| flagellar protein export ATPase FliI [Borrelia burgdorferi 94a]
 gi|225550200|ref|ZP_03771160.1| flagellar protein export ATPase FliI [Borrelia burgdorferi 118a]
 gi|226320589|ref|ZP_03796149.1| flagellar protein export ATPase FliI [Borrelia burgdorferi 29805]
 gi|1706850|sp|P52607|FLII_BORBU RecName: Full=Flagellum-specific ATP synthase
 gi|1165272|gb|AAA85611.1| FliI [Borrelia burgdorferi]
 gi|2688178|gb|AAC66660.1| flagellum-specific ATP synthase (fliI) [Borrelia burgdorferi B31]
 gi|221192384|gb|EEE18603.1| flagellar protein export ATPase FliI [Borrelia burgdorferi 72a]
 gi|223885681|gb|EEF56780.1| flagellar protein export ATPase FliI [Borrelia burgdorferi 64b]
 gi|224511883|gb|EEF82284.1| flagellar protein export ATPase FliI [Borrelia burgdorferi WI91-23]
 gi|224513017|gb|EEF83380.1| flagellar protein export ATPase FliI [Borrelia burgdorferi
           CA-11.2a]
 gi|225369312|gb|EEG98765.1| flagellar protein export ATPase FliI [Borrelia burgdorferi 118a]
 gi|225370401|gb|EEG99839.1| flagellar protein export ATPase FliI [Borrelia burgdorferi 94a]
 gi|226234008|gb|EEH32729.1| flagellar protein export ATPase FliI [Borrelia burgdorferi 29805]
 gi|312147904|gb|ADQ30563.1| flagellar protein export ATPase FliI [Borrelia burgdorferi JD1]
 gi|312148976|gb|ADQ29047.1| flagellar protein export ATPase FliI [Borrelia burgdorferi N40]
          Length = 436

 Score =  271 bits (693), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 147/341 (43%), Positives = 220/341 (64%), Gaps = 4/341 (1%)

Query: 81  ISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQ 139
           I +G+ V+   +   I+ S    GRVI++LG+PID   S         I  K+ P +NR 
Sbjct: 78  IEVGNKVYSLNKGLEINLSDELLGRVIDSLGRPIDNKGSFLNNSYKELIFEKINP-INRS 136

Query: 140 RVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERG 199
             E    TG++V+D F P+  GQR+G+F+GSG+GKSTLL M A++   D  +I+ +GERG
Sbjct: 137 IFEDQILTGVKVLDGFLPVAKGQRVGIFSGSGVGKSTLLGMIAKNSNADVNVIAFIGERG 196

Query: 200 REVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDS 258
           RE+ EFIE  LG+  LKKSV+VV+TSDESPI R      A  IAEYF  +G +V L+ DS
Sbjct: 197 RELNEFIEHELGEERLKKSVLVVSTSDESPISRYKGAYVATMIAEYFREQGKDVALLFDS 256

Query: 259 ITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGD 318
           ITRFA++ RE++ + GE PVA+GYP SVF E+P LLER G +    G++T   +VLV+GD
Sbjct: 257 ITRFANAKREMSLSLGEPPVAKGYPPSVFVEIPILLERSGFN-GNGGSVTGFYTVLVEGD 315

Query: 319 NHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTH 378
           +  +P+AD+++++LDGHI+L+R L + G YP ++ L+S SR   +  S +++KL+    +
Sbjct: 316 DFTEPVADNIKAVLDGHIILDRDLFDRGIYPSINVLSSTSRSIHRIMSLEKQKLIMKARN 375

Query: 379 LIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
           L+  +++  D+   G Y  G +  +D A+ + P I +F+ Q
Sbjct: 376 LLSIYKDYEDLIRTGIYLKGSNKDVDFAISKYPKIINFISQ 416


>gi|254255070|ref|ZP_04948387.1| Flagellar biosynthesis/type III secretory pathway ATPase
           [Burkholderia dolosa AUO158]
 gi|124899715|gb|EAY71558.1| Flagellar biosynthesis/type III secretory pathway ATPase
           [Burkholderia dolosa AUO158]
          Length = 476

 Score =  271 bits (693), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 148/358 (41%), Positives = 213/358 (59%), Gaps = 17/358 (4%)

Query: 72  ICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSK 131
           + P G G ++++G              A W GR+++ +G+P DG   L  GD  +++   
Sbjct: 124 VMPAGAGRQLTIG--------------AAWRGRIVDGMGEPFDGGGPL-TGDAPLDLRPP 168

Query: 132 VPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVI 191
               M ++ V      G+R I+    +  GQR+G+FAGSG+GKS LL M  R    D V+
Sbjct: 169 RINPMKKRPVAGVLDVGVRAINGMLTIGRGQRVGLFAGSGVGKSVLLGMITRQTAADVVV 228

Query: 192 ISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGD 250
           + L+GERGREVREF+E  LG D ++K++VVVA +DESP++R MA      IA +F  +GD
Sbjct: 229 VGLIGERGREVREFVEHALGPDGMRKAIVVVAPADESPLMRLMATELCHAIAAHFRDRGD 288

Query: 251 NVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAV 310
           NVLL++DS+TR+A + RE+A   GE P  +GYP SVF  LP L+ER G  E   G+++A+
Sbjct: 289 NVLLLVDSLTRYAMAQRELALALGEPPATKGYPPSVFGMLPALVERAGNGEG-SGSMSAI 347

Query: 311 ISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEK 370
            +VL +GD+  DP+ D+ R+ILDGHI+L+R LA +G YP +D   SVSR      S+ + 
Sbjct: 348 YTVLAEGDDEQDPVVDTARAILDGHIMLSRELAAQGHYPAIDVTRSVSRCMSLVASSAQC 407

Query: 371 KLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSED 428
              S L  L+ R  + RD+  +GGY  G D   D+AV   P I  FL Q+  D +  D
Sbjct: 408 AAASELKDLLSRHVQVRDLIPLGGYVAGADPATDRAVELHPRIAAFLSQAQGDAAPYD 465


>gi|115377823|ref|ZP_01465011.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Stigmatella aurantiaca DW4/3-1]
 gi|310820302|ref|YP_003952660.1| ATPase, flII/yscn family [Stigmatella aurantiaca DW4/3-1]
 gi|115365155|gb|EAU64202.1| type III secretion apparatus H+-transporting two-sector ATPase
           [Stigmatella aurantiaca DW4/3-1]
 gi|309393374|gb|ADO70833.1| ATPase, FliI/YscN family [Stigmatella aurantiaca DW4/3-1]
          Length = 436

 Score =  271 bits (693), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 150/336 (44%), Positives = 202/336 (60%), Gaps = 7/336 (2%)

Query: 103 GRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQ 162
           GRV+   G+PIDG   L    +   +    P    R R+E     G+R ID    +  GQ
Sbjct: 101 GRVLGGTGEPIDGK-PLPDDLIDWSVDRDCPDPFTRMRIEHPLPLGVRCIDGLLTVGEGQ 159

Query: 163 RIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVVV 221
           R+G+FAGSG+GKSTL+   AR+   +  +I+L+GERGREVREFIED LG+  L++SV+V 
Sbjct: 160 RVGLFAGSGVGKSTLMGQIARNTKAELNVIALIGERGREVREFIEDALGEEGLRRSVLVC 219

Query: 222 ATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARG 281
           ATSD+  ++R  A   A  IAEYF  +G NV+ +LD++TR A + REI    GE P  +G
Sbjct: 220 ATSDQPSLVRLKAAYVATAIAEYFRERGGNVMFMLDTVTRLARAQREIGLAVGEPPARQG 279

Query: 282 YPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRS 341
           YP SVFS LPR+LER G S K  G  TA+ + LV G +  +PIAD VR ILDGH +LNR+
Sbjct: 280 YPPSVFSMLPRILERTGNSAK--GKCTAIYTCLVAGGDMEEPIADEVRGILDGHFILNRA 337

Query: 342 LAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDL 401
           L E  ++P +D LAS+SR+     S D KK    L   +  +E+ RD+ L+G Y+ G D 
Sbjct: 338 LGERNQWPAMDVLASLSRVMSGIVSKDHKKAAGKLRETLSTYEKQRDLILLGAYQYGTDP 397

Query: 402 ILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKL 437
             D A+ +   I D+LKQ   D  S   F+E    L
Sbjct: 398 RTDYAIDKYDAIIDYLKQ---DTHSNSTFEETVNGL 430


>gi|71906409|ref|YP_283996.1| ATPase FliI/YscN [Dechloromonas aromatica RCB]
 gi|71846030|gb|AAZ45526.1| ATPase FliI/YscN [Dechloromonas aromatica RCB]
          Length = 472

 Score =  271 bits (693), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 140/318 (44%), Positives = 202/318 (63%), Gaps = 2/318 (0%)

Query: 103 GRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQ 162
           GRV++ +G+P+D    L   + +  + S+    M+R  + +    GIR I+    +  GQ
Sbjct: 137 GRVLDGVGRPLDNKGPLIAAE-TRPLQSRPINPMSRAAIHQPLDVGIRAINALLTVGRGQ 195

Query: 163 RIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVVV 221
           R+G+FAGSG+GKS LL M AR    + +++ L+GERGREV+EFIE  LG+  +++SVVV 
Sbjct: 196 RMGLFAGSGVGKSVLLGMMARYTEAEVIVVGLIGERGREVKEFIEQILGEEGMRRSVVVA 255

Query: 222 ATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARG 281
           A +D  P++R      A TIAEYF  +G +VLLI+DS+TR+A + REIA   GE P  RG
Sbjct: 256 APADTGPLMRLQGAAYATTIAEYFRDQGKHVLLIMDSLTRYAMAQREIALAIGEPPATRG 315

Query: 282 YPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRS 341
           YP SVF+ LP+L+ER G  ++  G+ITA  +VL +GD+  DPIADS R+ILDGHIVL+R+
Sbjct: 316 YPPSVFARLPQLVERAGNGQEGGGSITAFYTVLAEGDDQQDPIADSARAILDGHIVLSRT 375

Query: 342 LAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDL 401
           LA+ G YP +D   S+SR       A     +     L  R++ +RD+  +G Y PG D 
Sbjct: 376 LADAGHYPAIDIEQSISRAMVNLIDAPHLDQIRKFKVLFARYQRSRDLISVGAYAPGSDP 435

Query: 402 ILDKAVHQVPIIYDFLKQ 419
           +LD+A+   P +  FL+Q
Sbjct: 436 VLDQAISLYPRMESFLQQ 453


>gi|15618617|ref|NP_224903.1| type III secretion system ATPase [Chlamydophila pneumoniae CWL029]
 gi|15836239|ref|NP_300763.1| type III secretion system ATPase [Chlamydophila pneumoniae J138]
 gi|16752333|ref|NP_444591.1| type III secretion system ATPase [Chlamydophila pneumoniae AR39]
 gi|33242065|ref|NP_877006.1| type III secretion system ATPase [Chlamydophila pneumoniae TW-183]
 gi|4377010|gb|AAD18846.1| Yops secretion ATPase [Chlamydophila pneumoniae CWL029]
 gi|6672040|dbj|BAA88657.1| Yop N [Chlamydophila pneumoniae]
 gi|7188979|gb|AAF37934.1| type III secretion cytoplasmic ATPase SctN [Chlamydophila
           pneumoniae AR39]
 gi|8979079|dbj|BAA98914.1| YopN [Chlamydophila pneumoniae J138]
 gi|33236575|gb|AAP98663.1| YopN [Chlamydophila pneumoniae TW-183]
          Length = 442

 Score =  271 bits (693), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 156/383 (40%), Positives = 231/383 (60%), Gaps = 10/383 (2%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDS- 118
           +V+       ++ P+G    +S    V   G    I       GRV+N LG+PID +   
Sbjct: 61  EVVGFTQSFAFLSPLGELSGVSPSSEVIPTGLPLHIRAGNGLLGRVLNGLGEPIDVETKG 120

Query: 119 -LGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL 177
            L   D +  I    P  ++R ++ +   TG+R ID    +  GQRIG+FAG+G+GKS+L
Sbjct: 121 PLQNVDQTFPIFRAPPDPLHRAKLRQILSTGVRCIDGMLTVARGQRIGIFAGAGVGKSSL 180

Query: 178 LSMFAR-SDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAP 235
           L M AR ++  D  +I+L+GERGREVREFIE  LG+  +K+SV+VV+TSD+S  LR  A 
Sbjct: 181 LGMIARNAEEADVNVIALIGERGREVREFIEGDLGEEGMKRSVIVVSTSDQSSQLRLNAA 240

Query: 236 LTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLE 295
                IAEYF  +G  V+L++DS+TRFA ++RE+   +GE P   GY  SVFS LPRLLE
Sbjct: 241 YVGTAIAEYFRDQGKTVVLMMDSVTRFARALREVGLAAGEPPARAGYTPSVFSTLPRLLE 300

Query: 296 RIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLA 355
           R G S  +KG ITA  +VLV GD+ N+P+AD V+SILDGHIVL+ +LA+   YP +D LA
Sbjct: 301 RSGAS--DKGTITAFYTVLVAGDDMNEPVADEVKSILDGHIVLSNALAQAYHYPAIDVLA 358

Query: 356 SVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYD 415
           S+SRL       ++++++     ++ +++    +  IG YR G D  +D A+  +  +  
Sbjct: 359 SISRLLTAIVPEEQRRIIGKAREVLAKYKANEMLIRIGEYRRGSDREIDFAIDHIDKLNR 418

Query: 416 FLKQSPSDLSSEDVFQEITKKLQ 438
           FLKQ   D+  +  ++E  ++L+
Sbjct: 419 FLKQ---DIHEKTNYEEAAQQLR 438


>gi|295696116|ref|YP_003589354.1| flagellar protein export ATPase FliI [Bacillus tusciae DSM 2912]
 gi|295411718|gb|ADG06210.1| flagellar protein export ATPase FliI [Bacillus tusciae DSM 2912]
          Length = 441

 Score =  271 bits (693), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 148/329 (44%), Positives = 204/329 (62%), Gaps = 4/329 (1%)

Query: 93  FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVI 152
            R+       GRV++ LG+PIDG   +  G+    I    PP M R  V +    G+R I
Sbjct: 92  LRVPTGPGILGRVVDGLGRPIDGLGPVA-GEFQDPIEQPPPPPMARTPVNQPLSVGVRAI 150

Query: 153 DIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD 212
           D    +  GQRIG+FAGSG+GKSTLL M AR    D  +I L+GERGREV++FI   L +
Sbjct: 151 DGLLTVGQGQRIGIFAGSGVGKSTLLGMIARYTEADVTVIGLIGERGREVQDFIARELDE 210

Query: 213 -NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIAT 271
              K++VVV ATSD+ P++R    LTA  +AE F  +G  VLL++DS+TRFA + RE+  
Sbjct: 211 EGRKRAVVVAATSDQPPLMRIKGALTATAMAERFRRQGRRVLLLMDSVTRFAMACREVGL 270

Query: 272 NSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSI 331
            +GE P ARGY  SVF+ LP+LLER G +    G+ITA  +VLV+GD+ N+PIAD+VR I
Sbjct: 271 AAGEPPTARGYTPSVFAALPKLLERTGTART--GSITAFYTVLVEGDDFNEPIADAVRGI 328

Query: 332 LDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRL 391
           LDGHIVL+R +A++G YP +D  AS SRL ++       +  +    L+  +EE  D+  
Sbjct: 329 LDGHIVLSRKIAQQGLYPAIDVTASTSRLMNQVAETAHVRAAARFKALLAAYEEAEDLIQ 388

Query: 392 IGGYRPGVDLILDKAVHQVPIIYDFLKQS 420
           IG YR G  L +D A+   P ++ +L Q+
Sbjct: 389 IGAYREGTRLEVDTALRLRPRMWAYLAQN 417


>gi|119476318|ref|ZP_01616669.1| flagellum-specific ATP synthase [marine gamma proteobacterium
           HTCC2143]
 gi|119450182|gb|EAW31417.1| flagellum-specific ATP synthase [marine gamma proteobacterium
           HTCC2143]
          Length = 474

 Score =  271 bits (693), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 138/320 (43%), Positives = 207/320 (64%), Gaps = 2/320 (0%)

Query: 101 WCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCH 160
             GRVI+  G+P+D    LG  D S+++ +++   + R+ + +    GIR I+    +  
Sbjct: 107 LLGRVIDGAGRPLDSKGPLGCTD-SVDMQAELINPLQRKPISEVLDVGIRAINSVLTVGR 165

Query: 161 GQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVV 219
           GQR+G+FAGSG+GKS LL M  R    D V++ LVGERGREV+EFIE  L +  L ++VV
Sbjct: 166 GQRLGLFAGSGVGKSVLLGMMTRFTEADVVVVGLVGERGREVKEFIEQVLDEEGLSRAVV 225

Query: 220 VVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVA 279
           V + +D++P++R  A + A  IAE F  +G +VLL++DS+TRFA + REIA + GE P  
Sbjct: 226 VASPADDAPLMRMRAAMLATRIAESFRDQGKHVLLLMDSLTRFAQAQREIALSIGEPPAT 285

Query: 280 RGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLN 339
           +GYP SVF+++P+L+ER G      G++TA  +VL +GD+  DP+AD+ R+ILDGHIVL+
Sbjct: 286 KGYPPSVFAKIPQLVERAGNGADGSGSVTAFYTVLTEGDDMQDPVADAARAILDGHIVLS 345

Query: 340 RSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGV 399
           R+LA+EG YP +D  AS+SR      + +       L HL  R++++RD+  +G Y  G 
Sbjct: 346 RALADEGHYPAIDVEASISRAMPNIITGEHLAAARRLRHLYSRYQQSRDLISVGAYVAGS 405

Query: 400 DLILDKAVHQVPIIYDFLKQ 419
           D   D A+ ++P I  FL+Q
Sbjct: 406 DTETDAAIERLPAIRRFLQQ 425


>gi|260222427|emb|CBA31980.1| Flagellum-specific ATP synthase [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 478

 Score =  271 bits (693), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 146/331 (44%), Positives = 204/331 (61%), Gaps = 4/331 (1%)

Query: 91  GRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVP-PAMNRQRVEKGFKTGI 149
           G  R+       GRV+++ G P+D    L   D+S  ++ + P  AM+R  V +   TG+
Sbjct: 125 GMLRLPLGDGLLGRVVDSQGFPMDRMGPLA--DVSARVLDRKPINAMDRAPVREALDTGV 182

Query: 150 RVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDY 209
           R I+    +  GQR+G+FAGSG+GKS LL M AR    D +++ L+GERGREV+EFIED 
Sbjct: 183 RSINALLTVGRGQRLGLFAGSGVGKSVLLGMMARYTQADVIVVGLIGERGREVKEFIEDI 242

Query: 210 LG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIRE 268
           LG D  ++SVVV A +D  P+LR      A  IAEYF  +G +VLL++DS+TR+A + RE
Sbjct: 243 LGVDGRERSVVVAAPADAPPLLRMQGASYATAIAEYFRDQGKHVLLLMDSLTRYAMAQRE 302

Query: 269 IATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSV 328
           IA   GE P  +GYP S F++LP+L+ER G      G+ITA  +VL +GD+  DPIAD+ 
Sbjct: 303 IALAIGEPPATKGYPPSCFAKLPQLVERSGNGLNGVGSITAFYTVLSEGDDQQDPIADAA 362

Query: 329 RSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRD 388
           R+ILDGHIVL+RSLAE G YP +D   S SR+          +       L  ++++ RD
Sbjct: 363 RAILDGHIVLSRSLAESGHYPAIDVEQSASRVMHNVVDRGHFEQARRFRSLYSKYQKGRD 422

Query: 389 IRLIGGYRPGVDLILDKAVHQVPIIYDFLKQ 419
           +  IG Y PG D +LD+A+   P +  FL+Q
Sbjct: 423 LVQIGAYAPGSDPVLDEAIALQPGMIQFLQQ 453


>gi|238023716|ref|YP_002907948.1| type III secretion system ATPase [Burkholderia glumae BGR1]
 gi|237878381|gb|ACR30713.1| Type III secretion system ATPase [Burkholderia glumae BGR1]
          Length = 450

 Score =  271 bits (693), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 161/413 (38%), Positives = 232/413 (56%), Gaps = 9/413 (2%)

Query: 20  VVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNL--GQVIRINLDIVYICPVGI 77
           V + G +  +      V+ L   V LG+    +  +   L   +V+    D+  + P   
Sbjct: 29  VARTGKVMEVVGTVIKVSGLD--VTLGELCELRAPDGTLLQRAEVVGFTRDVALLSPFSR 86

Query: 78  GEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAM 136
            E +S    V   GR   I       GRV++ LG+PIDG   L   D    ++ + P  M
Sbjct: 87  LENVSRATQVIGLGRPLSIQVGDQLLGRVLDGLGEPIDGGPPLDSDDWR-PVIVQPPDPM 145

Query: 137 NRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVG 196
            R+ V+    TG+RV+D    L  GQR+G+FA +G+GKSTL+ MFAR    D  +I+L+G
Sbjct: 146 KRRMVDTPMPTGVRVVDAMMTLGEGQRMGIFAPAGVGKSTLMGMFARGAACDINVIALIG 205

Query: 197 ERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLI 255
           ERGREVREFIE  LG + + +SVVV ATSD S + R  A  TA  IAEYF  +G  VLL+
Sbjct: 206 ERGREVREFIELILGPEGMARSVVVCATSDRSSMERAKAAHTATAIAEYFRDRGLRVLLM 265

Query: 256 LDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLV 315
           +DS+TRFA + REI   +GE P  RG+P SVF+ELPRLLER G      G+ITA+ +VL 
Sbjct: 266 MDSLTRFARAGREIGLAAGEPPARRGFPPSVFAELPRLLERTG--MGATGSITALYTVLA 323

Query: 316 DGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSS 375
           + +   DP+A+ VR ILDGH++L+R +A + +YP +D L S+SR+          +  S 
Sbjct: 324 EDETGGDPVAEEVRGILDGHMILSREIAAKNQYPAIDVLGSLSRVMSLVVPDAHARAASR 383

Query: 376 LTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSED 428
           +  L+ +  E   +  +G Y+PG + + D+A+ +   I  FL Q   D +  D
Sbjct: 384 IRELMAKHREVEVLLQVGEYQPGQNPLADEAIQKADAIRAFLCQRTRDYAPYD 436


>gi|111115113|ref|YP_709731.1| flagellum-specific ATP synthase [Borrelia afzelii PKo]
 gi|216264022|ref|ZP_03436016.1| flagellar protein export ATPase FliI [Borrelia afzelii ACA-1]
 gi|110890387|gb|ABH01555.1| flagellum-specific ATP synthase [Borrelia afzelii PKo]
 gi|215980066|gb|EEC20888.1| flagellar protein export ATPase FliI [Borrelia afzelii ACA-1]
          Length = 436

 Score =  271 bits (693), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 159/406 (39%), Positives = 245/406 (60%), Gaps = 6/406 (1%)

Query: 36  VTCLSQYVCLGDF-VVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-F 93
           V  L     +GD  ++ Q  N     +V+  N   V +        I +G+ V+   +  
Sbjct: 32  VESLGPQCAVGDLCLIDQRNNKKVCAEVLGFNGPYVSLMAYEGFSGIEVGNKVYSLNKGL 91

Query: 94  RISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVID 153
            I+ S    GRVI++LG+PID   S         I  K+ P ++R   E+   TG++V+D
Sbjct: 92  EINLSDELLGRVIDSLGRPIDNKGSFLNNKYKELIFEKINP-ISRSIFEEQILTGVKVLD 150

Query: 154 IFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN 213
            F P+  GQR+G+F+G+G+GKSTLL M A++   D  +I+ +GERGRE+ EFIE  LG+ 
Sbjct: 151 GFLPVAKGQRVGIFSGAGVGKSTLLGMIAKNSNADVNVIAFIGERGRELNEFIEHELGEE 210

Query: 214 -LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATN 272
            LKKSV+VV+TSDESPI R      A  IAEYF  +G +V L+ DSITRFA++ RE++ +
Sbjct: 211 RLKKSVLVVSTSDESPISRYKGAYVATMIAEYFRDQGKDVALLFDSITRFANAKREMSLS 270

Query: 273 SGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSIL 332
            GE PVA+GYP SVF E+P LLER G +    G++T   +VLV+GD+  +P+AD+++++L
Sbjct: 271 LGEPPVAKGYPPSVFVEIPILLERSGFN-GNGGSVTGFYTVLVEGDDFAEPVADNIKAVL 329

Query: 333 DGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLI 392
           DGH++L+R L + G YP ++ L+S SR   +  S +++KL+    +L+  +++  D+   
Sbjct: 330 DGHVILDRDLFDRGIYPSINILSSTSRSIHRIMSLEKQKLIMKARNLLSVYKDYEDLIRT 389

Query: 393 GGYRPGVDLILDKAVHQVPIIYDFLKQSPSD-LSSEDVFQEITKKL 437
           G Y  G +  +D A+ + P I DF+ Q  ++    E++  EI K L
Sbjct: 390 GIYLKGSNKDVDFAISKYPKIIDFISQGINETFDFENLEDEIRKIL 435


>gi|330828802|ref|YP_004391754.1| flagellar protein export ATPase FliI [Aeromonas veronii B565]
 gi|328803938|gb|AEB49137.1| Flagellar protein export ATPase FliI [Aeromonas veronii B565]
          Length = 443

 Score =  271 bits (692), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 140/320 (43%), Positives = 202/320 (63%), Gaps = 2/320 (0%)

Query: 101 WCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCH 160
             GRVI+ +G+P+DG   +           ++ P ++R+ + +    G+R I+    +  
Sbjct: 101 LLGRVIDGIGQPLDGLGPILSSQTVQFAQHRINP-LSRRPIHQPMDVGVRAINAVLTVGQ 159

Query: 161 GQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLK-KSVV 219
           GQR+G+FAGSG+GKS LL M  R    D V++ L+GERGREV+EFIED LG+  + +SVV
Sbjct: 160 GQRMGLFAGSGVGKSVLLGMMTRGSVADVVVVGLIGERGREVKEFIEDILGEEGRARSVV 219

Query: 220 VVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVA 279
           V A +D SP++R     TA+ IAEYF  +G NVLL++DS+TR+A + REIA   GE P  
Sbjct: 220 VAAPADASPLMRLKGCETALAIAEYFRDQGLNVLLLMDSLTRYAQAQREIALAVGEPPAT 279

Query: 280 RGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLN 339
           +GYP SVF++LP L+ER G     +G+ITA  +VL +GD+  DPIAD+ R+ILDGHIVL+
Sbjct: 280 KGYPPSVFAKLPALVERAGNGSDGQGSITAFFTVLTEGDDLQDPIADAARAILDGHIVLS 339

Query: 340 RSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGV 399
           R LA+ G YP +D   S+SR+     S +   L  +L      +++ RD+  IG Y  G 
Sbjct: 340 RELADAGHYPAIDIEKSISRVMPMVTSPEHMDLARTLKQFYSLYQQNRDLITIGAYSQGS 399

Query: 400 DLILDKAVHQVPIIYDFLKQ 419
           D  +D+A+ Q P +  FL+Q
Sbjct: 400 DPRIDRAIIQKPYLDQFLQQ 419


>gi|206558923|ref|YP_002229683.1| flagellum-specific ATP synthase FliI [Burkholderia cenocepacia
           J2315]
 gi|18182541|gb|AAL65163.1|AF453480_5 flagellar ATPase [Burkholderia cepacia]
 gi|198034960|emb|CAR50832.1| flagellum-specific ATP synthase FliI [Burkholderia cenocepacia
           J2315]
          Length = 501

 Score =  271 bits (692), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 145/319 (45%), Positives = 200/319 (62%), Gaps = 4/319 (1%)

Query: 103 GRVINALGKPIDGDDSLG-KGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHG 161
           GRV++A G+P+DG   L  K D  +   S  P  ++R+ +      G+R I+    +  G
Sbjct: 161 GRVVDASGRPLDGLGPLASKVDAPLSAPSINP--LDREPIHHVLDVGVRAINALLTVGRG 218

Query: 162 QRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVV 220
           QR+G+FAGSG+GKS LL   AR    + ++I L+GERGREV+EFIE  LG D L +SVVV
Sbjct: 219 QRMGLFAGSGVGKSVLLGTMARYTSAEVIVIGLIGERGREVKEFIEQILGEDGLARSVVV 278

Query: 221 VATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVAR 280
            A +D SP+LR      A ++AEYF  +G +VLL++DS+TR+A + REIA   GE P  +
Sbjct: 279 AAPADVSPLLRMQGAAYATSLAEYFRDQGKHVLLLMDSLTRYAMAQREIALAIGEPPATK 338

Query: 281 GYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNR 340
           GYP SVF++LP L+ER G   +  G+ITA  +VL +GD+  DPIADS R+ILDGHIVL+R
Sbjct: 339 GYPPSVFAKLPALVERTGNGPEGGGSITAFYTVLTEGDDQQDPIADSARAILDGHIVLSR 398

Query: 341 SLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVD 400
           +LAE G YP +D  AS+SR             V     ++ R++  RD+  +G Y PG D
Sbjct: 399 ALAEAGHYPAIDIEASISRAMTALIDETHLDHVRQFKQMLSRYQRNRDLIAVGAYAPGRD 458

Query: 401 LILDKAVHQVPIIYDFLKQ 419
             LD+A+   P I  FL+Q
Sbjct: 459 AQLDRAIALYPRIEAFLQQ 477


>gi|254240042|ref|ZP_04933364.1| ATP synthase in type III secretion system [Pseudomonas aeruginosa
           2192]
 gi|126193420|gb|EAZ57483.1| ATP synthase in type III secretion system [Pseudomonas aeruginosa
           2192]
          Length = 440

 Score =  271 bits (692), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 146/336 (43%), Positives = 209/336 (62%), Gaps = 4/336 (1%)

Query: 91  GRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIR 150
           G  R++      G+V++ LG+P DG     +      +    PP M+R+ +E+    G+R
Sbjct: 94  GMHRVAVGEHLLGQVLDGLGRPFDGSPP-AEPAAWYPVYRDAPPPMSRRLIERPLSLGVR 152

Query: 151 VIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYL 210
            ID       GQR+G+FA +G GKSTLL+   R+   D  +++LVGERGREVREFIE  L
Sbjct: 153 AIDGLLTCGEGQRMGIFAAAGGGKSTLLASLVRNAEVDVTVLALVGERGREVREFIESDL 212

Query: 211 GDN-LKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREI 269
           G+  L++SV+VVATSD   + R  A   A +IAEYF  +G  VLL++DS+TRFA + REI
Sbjct: 213 GEQGLRRSVLVVATSDRPAMERAKAGFVATSIAEYFRDQGRRVLLLMDSLTRFARAQREI 272

Query: 270 ATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVR 329
              +GE P  RGYP SVF+ LPRL+ER G SE+  G+ITA+ +VLV+GD+ ++P+AD  R
Sbjct: 273 GLAAGEPPTRRGYPPSVFAALPRLMERAGQSER--GSITALYTVLVEGDDMSEPVADETR 330

Query: 330 SILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDI 389
           SILDGHIVL+R LA    YP +D L SVSR+ ++    D++     L   + ++EE   +
Sbjct: 331 SILDGHIVLSRKLAAANHYPAIDVLHSVSRVMNQIVDDDQRHAAGRLREWLAKYEEVELL 390

Query: 390 RLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLS 425
             IG Y+ G D   D+A+ ++  I  +L+Q   + S
Sbjct: 391 LKIGEYQKGQDSEADRAIEKIGAIRQWLRQGTHETS 426


>gi|313895951|ref|ZP_07829505.1| flagellar protein export ATPase FliI [Selenomonas sp. oral taxon
           137 str. F0430]
 gi|312975376|gb|EFR40837.1| flagellar protein export ATPase FliI [Selenomonas sp. oral taxon
           137 str. F0430]
          Length = 458

 Score =  271 bits (692), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 163/373 (43%), Positives = 228/373 (61%), Gaps = 14/373 (3%)

Query: 70  VYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSLGKGDLSME- 127
           V + PVG  + I  G  V   GR  R+       GR