RPSBLAST alignment for GI: 254780684 and conserved domain: PRK05688

>gnl|CDD|168181 PRK05688, fliI, flagellum-specific ATP synthase; Validated. Length = 451
 Score =  310 bits (795), Expect = 6e-85
 Identities = 156/370 (42%), Positives = 223/370 (60%), Gaps = 19/370 (5%)

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVF---HWGRFRISPSACWCGRVINALGKPIDGDD 117
           +V+  + D V++ PVG    I+ G  V      GR  +  S    GRV++  G+ +DG  
Sbjct: 68  EVMGFSGDKVFLMPVGSVAGIAPGARVVPLADTGRLPMGMSML--GRVLDGAGRALDG-- 123

Query: 118 SLGKGDLSMEIMSKVP---PAMN---RQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSG 171
              KG +  E    VP   P +N   R  + +    GIR I+    +  GQR+G+FAG+G
Sbjct: 124 ---KGPMKAE--DWVPMDGPTINPLNRHPISEPLDVGIRSINGLLTVGRGQRLGLFAGTG 178

Query: 172 IGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGD-NLKKSVVVVATSDESPIL 230
           +GKS LL M  R    D +++ L+GERGREV+EFIE  LG+  LK+SVVV + +D++P++
Sbjct: 179 VGKSVLLGMMTRFTEADIIVVGLIGERGREVKEFIEHILGEEGLKRSVVVASPADDAPLM 238

Query: 231 RKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSEL 290
           R  A +    IAEYF  KG NVLL++DS+TRFA + REIA   GE P  +GYP SVF++L
Sbjct: 239 RLRAAMYCTRIAEYFRDKGKNVLLLMDSLTRFAQAQREIALAIGEPPATKGYPPSVFAKL 298

Query: 291 PRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPP 350
           P+L+ER G +E   G+ITA  +VL +GD+  DPIADS R +LDGHIVL+R LAEEG YP 
Sbjct: 299 PKLVERAGNAEPGGGSITAFYTVLSEGDDQQDPIADSARGVLDGHIVLSRRLAEEGHYPA 358

Query: 351 VDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQV 410
           +D  AS+SR+  +    +  +       L  R++++RD+  +G Y  G D   D A+ + 
Sbjct: 359 IDIEASISRVMPQVVDPEHLRRAQRFKQLWSRYQQSRDLISVGAYVAGGDPETDLAIARF 418

Query: 411 PIIYDFLKQS 420
           P +  FL+Q 
Sbjct: 419 PHLVQFLRQG 428