RPSBLAST alignment for GI: 254780684 and conserved domain: PRK06936

>gnl|CDD|180762 PRK06936, PRK06936, type III secretion system ATPase; Provisional. Length = 439
 Score =  320 bits (822), Expect = 5e-88
 Identities = 150/337 (44%), Positives = 209/337 (62%), Gaps = 7/337 (2%)

Query: 103 GRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQ 162
           GRV++ LG+P DG     +      + +  P  M+R+ +E     G+RVID       GQ
Sbjct: 105 GRVLDGLGQPFDGGHPP-EPAAWYPVYADAPAPMSRRLIETPLSLGVRVIDGLLTCGEGQ 163

Query: 163 RIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVV 221
           R+G+FA +G GKSTLL+   RS   D  +++L+GERGREVREFIE  LG + L+K+V+VV
Sbjct: 164 RMGIFAAAGGGKSTLLASLIRSAEVDVTVLALIGERGREVREFIESDLGEEGLRKAVLVV 223

Query: 222 ATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARG 281
           ATSD   + R  A   A +IAEYF  +G  VLL++DS+TRFA + REI   +GE P  RG
Sbjct: 224 ATSDRPSMERAKAGFVATSIAEYFRDQGKRVLLLMDSVTRFARAQREIGLAAGEPPTRRG 283

Query: 282 YPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRS 341
           YP SVF+ LPRL+ER G S  +KG+ITA+ +VLV+GD+  +P+AD  RSILDGHI+L+R 
Sbjct: 284 YPPSVFAALPRLMERAGQS--DKGSITALYTVLVEGDDMTEPVADETRSILDGHIILSRK 341

Query: 342 LAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDL 401
           LA    YP +D L S SR+ ++  S + K     L  L+ ++EE   +  IG Y+ G D 
Sbjct: 342 LAAANHYPAIDVLRSASRVMNQIVSKEHKTWAGRLRELLAKYEEVELLLQIGEYQKGQDK 401

Query: 402 ILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ 438
             D+A+ ++  I  FL+Q   +LS    F E    L+
Sbjct: 402 EADQAIERIGAIRGFLRQGTHELSH---FNETLNLLE 435