RPSBLAST alignment for GI: 254780684 and conserved domain: PRK09281

>gnl|CDD|181753 PRK09281, PRK09281, F0F1 ATP synthase subunit alpha; Validated. Length = 502
 Score = 93.2 bits (233), Expect = 1e-19
 Identities = 86/315 (27%), Positives = 136/315 (43%), Gaps = 78/315 (24%)

Query: 103 GRVINALGKPIDGDDSLG--KGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCH 160
           GRV+N LG+PIDG    G  +   +  +  K P  ++R+ V +  +TGI+ ID   P+  
Sbjct: 105 GRVVNPLGQPIDG---KGPIEATETRPVERKAPGVIDRKSVHEPLQTGIKAIDAMIPIGR 161

Query: 161 GQR---IGVFAGSGIGKSTLLSMFARSDCFDKVIIS-----------LVGERG---REVR 203
           GQR   IG       GK+ +          D  II+            +G++     +V 
Sbjct: 162 GQRELIIG---DRQTGKTAI--------AID-TIINQKGKDVICIYVAIGQKASTVAQVV 209

Query: 204 EFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFA 263
             +E++    ++ ++VV AT+ +   L+ +AP     + EYF   G + L++ D +++ A
Sbjct: 210 RKLEEH--GAMEYTIVVAATASDPAPLQYLAPYAGCAMGEYFMDNGKDALIVYDDLSKQA 267

Query: 264 HSIREIATNSGEL----PVAR-GYPTSVF---SELPRLLERIGPSEKEKGN--ITAVISV 313
            + R+++     L    P  R  YP  VF   S   RLLER      E G   +TA+   
Sbjct: 268 VAYRQLS-----LLLRRPPGREAYPGDVFYLHS---RLLERAAKLSDELGGGSLTAL--- 316

Query: 314 LVDGDNHNDPIADS------------VRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLA 361
                    PI ++            V SI DG I L   L   G  P ++   SVSR+ 
Sbjct: 317 ---------PIIETQAGDVSAYIPTNVISITDGQIFLESDLFNAGIRPAINVGISVSRVG 367

Query: 362 DKAWSADEKKLVSSL 376
             A     KK+  +L
Sbjct: 368 GAAQIKAMKKVAGTL 382