RPSBLAST alignment for GI: 254780684 and conserved domain: COG0055

>gnl|CDD|30404 COG0055, AtpD, F0F1-type ATP synthase, beta subunit [Energy production and conversion]. Length = 468
 Score =  175 bits (445), Expect = 3e-44
 Identities = 99/299 (33%), Positives = 157/299 (52%), Gaps = 9/299 (3%)

Query: 103 GRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKG-FKTGIRVIDIFTPLCHG 161
           GR+ N LG+PID    +   D     + +  P+      +    +TGI+VID+  P   G
Sbjct: 88  GRIFNVLGEPIDEKGPIKAEDFEKWPIHRKAPSFEELSTKTEILETGIKVIDLLAPYAKG 147

Query: 162 QRIGVFAGSGIGKSTLLSMFARSDCFDKVIISL---VGERGREVREFIEDYLGDN-LKKS 217
            +IG+F G+G+GK+ L+     +   +    S+   VGER RE  +   +      L K+
Sbjct: 148 GKIGLFGGAGVGKTVLIQELINNIAKEHGGYSVFAGVGERTREGNDLYHEMKESGVLDKT 207

Query: 218 VVVVATSDESPILRKMAPLTAVTIAEYF-SSKGDNVLLILDSITRFAHSIREIATNSGEL 276
            +V    +E P  R    LT +T+AEYF   +G +VLL +D+I RF  +  E++   G +
Sbjct: 208 ALVFGQMNEPPGARMRVALTGLTMAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRM 267

Query: 277 PVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHI 336
           P A GY  ++ +E+ +L ERI  +  +KG+IT+V +V V  D+  DP   +  + LD   
Sbjct: 268 PSAVGYQPTLATEMGQLQERI--TSTKKGSITSVQAVYVPADDLTDPAPATTFAHLDATT 325

Query: 337 VLNRSLAEEGRYPPVDPLASVSRLADKAWSADEK-KLVSSLTHLIHRFEETRDIRLIGG 394
           VL+R +A  G YP VDPL S SR  D     +E  ++   +  ++ R++E +DI  I G
Sbjct: 326 VLSRQIAALGIYPAVDPLDSTSRALDPKIVGEEHYEVAREVQSILQRYKELQDIIAILG 384