RPSBLAST alignment for GI: 254780684 and conserved domain: KOG1351

>gnl|CDD|36565 KOG1351, KOG1351, KOG1351, Vacuolar H+-ATPase V1 sector, subunit B [Energy production and conversion]. Length = 489
 Score =  113 bits (283), Expect = 1e-25
 Identities = 76/289 (26%), Positives = 140/289 (48%), Gaps = 18/289 (6%)

Query: 93  FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVI 152
            R   S    GR+ N  GKPID    +   D  ++I  +      R   E+  +TGI  I
Sbjct: 96  LRTPVSEDMLGRIFNGSGKPIDKGPPVLAEDY-LDINGQPINPYARIYPEEMIQTGISAI 154

Query: 153 DIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDK---------------VIISLVGE 197
           D+   +  GQ+I +F+ +G+  + + +   R     K               ++ + +G 
Sbjct: 155 DVMNSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVKRPEKDVHDGHEDNFAIVFAAMGV 214

Query: 198 RGREVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSK-GDNVLLI 255
                R F +D+  + ++++  + +  +++  I R + P  A+T AE+ + +   +VL+I
Sbjct: 215 NMETARFFKQDFEENGSMERVCLFLNLANDPTIERIITPRLALTTAEFLAYQCEKHVLVI 274

Query: 256 LDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLV 315
           L  ++ +A ++RE++    E+P  RGYP  ++++L  + ER G  E   G+IT +  + +
Sbjct: 275 LTDMSSYADALREVSAAREEVPGRRGYPGYMYTDLATIYERAGRVEGRNGSITQIPILTM 334

Query: 316 DGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKA 364
             D+   PI D    I +G I ++R L     YPP++ L S+SRL   A
Sbjct: 335 PNDDITHPIPDLTGYITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSA 383