HHsearch alignment for GI: 254780687 and conserved domain: PRK08035

>PRK08035 type III secretion system protein; Validated.
Probab=98.17  E-value=1.2e-05  Score=56.35  Aligned_cols=71  Identities=21%  Similarity=0.171  Sum_probs=65.2

Q ss_pred             HHHHHCEEEEEEEEEEEEECHHHHHCCCCCCEEECCCCCCCEEEEEECCEEEEEEEEEEECCEEEEEEEEC
Q ss_conf             99740800799998123430989945799978982578997389999999999999987889789999842
Q gi|254780687|r  233 RKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR  303 (318)
Q Consensus       233 ~~l~~~~v~i~a~Lg~~~l~l~dil~L~vGDVI~L~~~~~~~v~v~v~g~~~f~g~~G~~~~~~AVrI~~~  303 (318)
T Consensus       246 v~L~~lPQtLl~EIGRlsL~lg~L~QLavG~~L~~~t~fygeV~IRLnGq~iG~G~Ll~Cd~~l~VRI~rW  316 (326)
T PRK08035        246 VELEQLPQQVLFEIGRLSLEIGQLRQLAVGDVLPVGGCFAPEVTIRLNGQIIGQGELIACDNELMVRITRW  316 (326)
T ss_pred             HHHHHCCCEEEEEEEEEEEEHHHHHHCCCCCEECCCCEECCEEEEEECCEEECCCCEEEECCEEEEEEEEE
T ss_conf             01554761118773066300677540055657201241623689998891852530784088569998762