HHSEARCH alignment of GI: 254780687 and SCOP domain: d1xkra_

Alignment
>d1xkra_ d.252.1.1 (A:) Chemotaxis protein CheC {Thermotoga maritima [TaxId: 2336]}
Probab=98.88  E-value=1.4e-06  Score=59.47  Aligned_cols=177  Identities=11%  Similarity=0.064  Sum_probs=131.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCEEEEHHHHHHCCCCC---EEEEEEE-CCCCCCEEEEEECHHHHHH
Q ss_conf             99999999999999999999986298079986472566799897116886---3999997-3677833999988789999
Q gi|254780687|r   31 IEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKEN---FVFSQAS-LSSWSSNFFIGCSNNLVIT  106 (318)
Q Consensus        31 ~~~~~~~~~e~~~r~l~~~l~~~~~~~v~v~~~~ve~~~~~e~i~~l~~p---~~~~i~~-~~pl~g~~ll~id~~l~~~  106 (318)
                      ..+.++++..--+...+++|+..++..|++++..++..++.++...+..+   .+..... ..++.|.+++.++..-+-.
T Consensus         8 ~~D~l~Ei~NIg~G~AAtaLs~ll~~~v~l~vp~v~~~~~~e~~~~l~~~~~~~~~v~~~~~G~~~G~~ll~f~~~~a~~   87 (205)
T d1xkra_           8 QKDLLKEIGNIGAGNAATAISYMINKKVEISVPNVEIVPISKVIFIAKDPEEIVVGVKMPVTGDIEGSVLLIMGTTVVKK   87 (205)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHTSCEEEECCCEEEEEGGGGGGGSSCTTCEEEEEEEEEEESSCEEEEEEECHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCEEEEEEHHHHHHHHCCCCCEEEEEEEEEEECCCEEEEEEECHHHHHH
T ss_conf             99999999998888999999998599689877979997589999872786650899999866066648999988899999


Q ss_pred             HHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCHHHHHC-------HHH--HCCCCC
Q ss_conf             99887278887666666565798999999999999999999985100273200000244311-------000--012478
Q gi|254780687|r  107 LLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDY-------LKK--NTNRLS  177 (318)
Q Consensus       107 lid~~lGG~g~~~~~~~~R~lT~iE~~l~~~i~~~~~~~l~~a~~~~~~~~~~~~~~~~~~~-------~~~--~~~~~p  177 (318)
                      +++.|+|..+..     ..++++.+...+..+.+.+..++-.+|+...+....+..|.....       ...  ......
T Consensus        88 l~~~L~g~~~~~-----~~~~~e~~~sal~EvgNIl~ga~l~~ls~~l~~~i~~s~P~~~~d~~~~i~~~~~~~~~~~~~  162 (205)
T d1xkra_          88 ILEILTGRAPDN-----LLNLDEFSASALREIGNIMCGTYVSALADFLGFKIDTLPPQLVIDMISAIFAEASIEELEDNS  162 (205)
T ss_dssp             HHHHHHSCCCSC-----STTCCHHHHHHHHHHHHHHHHHHHHHHHHHHTCCEEECCCEEEEEEHHHHHHHHHHHHHSSCC
T ss_pred             HHHHHCCCCCCC-----CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEECCCCEEEECCHHHHCCHHHHHHHCCCC
T ss_conf             999856999776-----543037899999999999999999999998698776669978834635423536554302678


Q ss_pred             CCEEEEEEEEEEECC----EEEEEEEEEEHHHHHHHHHH
Q ss_conf             718999998866678----13799998504775256775
Q gi|254780687|r  178 NEFVTTINMNMTIEN----VASSFVLIIPQETLLKTTLI  212 (318)
Q Consensus       178 ~e~vi~i~~~v~~~~----~~g~~~l~lP~~~l~~~~~~  212 (318)
                      ++.++++...+.+++    ..|.+.++.....+.....+
T Consensus       163 ~~~vl~i~t~~~~~~~~~~i~g~l~ll~~~~sl~~L~~~  201 (205)
T d1xkra_         163 EDQIVFVETLLKVEEEEEPLTSYMMMIPKPGYLVKIFER  201 (205)
T ss_dssp             CCEEEEEEEEEEETTSSSCEEEEEEEEECTTHHHHHHHT
T ss_pred             CCEEEEEEEEEEECCCCCEEEEEEEECCCHHHHHHHHHH
T ss_conf             875999999999637786378999991598999999997


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: CheC-like
superfamily: CheC-like
family: CheC-like
domain: Chemotaxis protein CheC
species: Thermotoga maritima [TaxId: 2336]