BLAST/PSIBLAST alignment of GI: 254780687 and GI: 190890355 at iteration 1
>gi|190890355|ref|YP_001976897.1| flagellar C-ring motor switch protein [Rhizobium etli CIAT 652] Length = 316
>gi|190695634|gb|ACE89719.1| flagellar C-ring motor switch protein [Rhizobium etli CIAT 652] Length = 316
 Score =  209 bits (533), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 102/304 (33%), Positives = 167/304 (54%)

Query: 13  LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSH 72
           + P LLA+LTG LGD+  + KI S+ G +Y +F P + K +  LDV ++Y  C+ G  +H
Sbjct: 13  MDPALLAKLTGGLGDRGRVSKICSAFGEVYSEFFPDVIKSETGLDVTVNYLGCEIGYKNH 72

Query: 73  IIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEK 132
           ++     N     A+L +WS N  + C N  VITL+E+LLGA+ +TI +  +R LS +E 
Sbjct: 73  LVDDLSANVTLVDATLRNWSQNITLACGNGFVITLMEHLLGATADTIEEPADRLLSIIEL 132

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            LA     +I+ VL   ++      P+L   +  D   +      +EF   INM++T+  
Sbjct: 133 DLAVMVFDKIAKVLRSAVNAPGGFEPSLSAPHAHDARARPPEDKPDEFAAAINMSLTLAG 192

Query: 193 VASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTT 252
           + S F LI+PQ  LLKT +     + ++   S +  +    +  + +V ++ RI L+  T
Sbjct: 193 IVSEFSLIVPQTALLKTKVTPPKPKRQAAGASPEWTEQLGDQVRRSHVTLEARIRLQDLT 252

Query: 253 LKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLK 312
           L+ +  L +G VIPF         +SAN KE+Y CE GR G+NY +R+ D +N D + ++
Sbjct: 253 LRTISKLMVGDVIPFRDSGDVRVEVSANSKELYVCEFGRSGENYMVRVKDTMNSDDELIR 312

Query: 313 NFLH 316
           + ++
Sbjct: 313 HLMN 316