BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780687|ref|YP_003065100.1| flagellar C-ring protein
[Candidatus Liberibacter asiaticus str. psy62]
         (318 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780687|ref|YP_003065100.1| flagellar C-ring protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040364|gb|ACT57160.1| flagellar C-ring protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 318

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/318 (100%), Positives = 318/318 (100%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI
Sbjct: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP
Sbjct: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF
Sbjct: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNV 240
           VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNV
Sbjct: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNV 240

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
           NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI
Sbjct: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300

Query: 301 TDRINFDQKSLKNFLHKR 318
           TDRINFDQKSLKNFLHKR
Sbjct: 301 TDRINFDQKSLKNFLHKR 318


>gi|315121854|ref|YP_004062343.1| flagellar motor switch protein fliM [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495256|gb|ADR51855.1| flagellar motor switch protein fliM [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 318

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 208/317 (65%), Positives = 254/317 (80%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           MR +   K+ SPLHP+LLARLTGKLGDKKTIE+IS +LG LY K LPK FKE++D+D+++
Sbjct: 1   MREKRTSKDISPLHPVLLARLTGKLGDKKTIERISYNLGQLYTKLLPKSFKEELDVDLNV 60

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           SY + QSGKFSHI+HSFKE FVF + SL+  SSN FIGCSNNLVI LLE LL AS ET  
Sbjct: 61  SYGNYQSGKFSHILHSFKERFVFYKTSLNGRSSNLFIGCSNNLVIVLLETLLRASCETTQ 120

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           + +NRSLST+EKKLA   + +I+ VL+QCIST Q +   L++ Y++D+LK+NTN LSNEF
Sbjct: 121 KSHNRSLSTIEKKLAHLIVTKIATVLDQCISTAQNNRVTLDENYELDFLKQNTNLLSNEF 180

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNV 240
           VT I M +TI+N+AS F LIIPQETLLK TLISLS Q KS    ED  D     TY+++V
Sbjct: 181 VTAITMVVTIDNIASLFTLIIPQETLLKITLISLSEQGKSAIPLEDCPDQLNGNTYKIHV 240

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            I++RINL+K TLKDV+ LKIGQV+PFL +EK  AIL+ANGKEIYSCELGR+GKNYT+RI
Sbjct: 241 KIESRINLQKITLKDVLNLKIGQVMPFLDKEKVYAILNANGKEIYSCELGRIGKNYTVRI 300

Query: 301 TDRINFDQKSLKNFLHK 317
            DRINFDQ+SL+NFLHK
Sbjct: 301 QDRINFDQESLRNFLHK 317


>gi|241203098|ref|YP_002974194.1| surface presentation of antigens (SPOA) protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240856988|gb|ACS54655.1| surface presentation of antigens (SPOA) protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 316

 Score =  213 bits (543), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 103/304 (33%), Positives = 169/304 (55%)

Query: 13  LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSH 72
           + P LLA+LTG LGD+  + KI SS G +Y +F P + K +  LDV ++Y  C+ G  +H
Sbjct: 13  MDPALLAKLTGGLGDRGGVAKICSSFGEIYSEFFPDVIKSETGLDVTVNYLGCEIGYKNH 72

Query: 73  IIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEK 132
           +I     N     A+L +WS N  + C N  VITL+E+LLGA+ +TI +  +R LS +E 
Sbjct: 73  LIEDLSANVTLVDATLRNWSQNITLACGNGFVITLMEHLLGATADTIEEPADRLLSIIEL 132

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            LA     +I+ VL   ++      P+L   + +D   +      +EF   INM++T+  
Sbjct: 133 DLAVMVFDKIAKVLRSAVNAPGGFEPSLSAPHALDARARPPEDRPDEFAAAINMSITLAG 192

Query: 193 VASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTT 252
           + S F LI+PQ  LLKT +     + ++  +S +  +    +  + +V ++ +I L+  T
Sbjct: 193 IVSEFALIVPQTALLKTKVTPPKPKRQATGKSPEWTEQLGDQVRRSHVTLEAKIRLQDLT 252

Query: 253 LKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLK 312
           L+ +  L +G VIPF         +SAN KE+Y CE GR G+NY +R+ D +N D + ++
Sbjct: 253 LRTISKLMVGDVIPFRDHGDVRVEVSANSKELYVCEFGRSGENYMVRVKDTMNSDDELIR 312

Query: 313 NFLH 316
           + ++
Sbjct: 313 HLMN 316


>gi|116250474|ref|YP_766312.1| flagella motor switch protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115255122|emb|CAK06196.1| putative flagella motor switch protein [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 316

 Score =  211 bits (538), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 104/304 (34%), Positives = 168/304 (55%)

Query: 13  LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSH 72
           + P LLA+LTG LGD+  + KI SS G +Y +F P + K +  LDV ++Y  C+ G  +H
Sbjct: 13  MDPALLAKLTGGLGDRGRVAKICSSFGEIYSEFFPDVIKSETGLDVTVNYLGCEIGYKNH 72

Query: 73  IIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEK 132
           +I     N     A+L +WS N  + C N  VITL+E+LLGA+ +TI +  +R LS +E 
Sbjct: 73  LIEDLSANVTLVDATLRNWSQNITLACGNGFVITLMEHLLGATADTIEEPADRLLSIIEL 132

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            LA     +I+ VL   ++      P+L   Y  D   +      +EF   INM++T+  
Sbjct: 133 DLAVMVFDKIAKVLRSAVNAPGGFEPSLSAPYAHDMRARPQEDRPDEFAAAINMSITLAG 192

Query: 193 VASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTT 252
           + S F LI+PQ  LLKT +     + ++ + S +  +    +  + +V ++ +I L+  T
Sbjct: 193 IVSEFSLIVPQTALLKTKVTPPKPKRQASSNSAEWTEQLGDQVRRSHVTLEAKIRLQDLT 252

Query: 253 LKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLK 312
           L+ +  L +G VIPF         +SAN KE+Y CE GR G+NY +R+ D +N D + ++
Sbjct: 253 LRTISKLMVGDVIPFRDHGDVRVEVSANSKELYVCEFGRSGENYMVRVKDTMNSDDELIR 312

Query: 313 NFLH 316
           + ++
Sbjct: 313 HLMN 316


>gi|327193028|gb|EGE59940.1| flagellar C-ring motor switch protein [Rhizobium etli CNPAF512]
          Length = 314

 Score =  211 bits (537), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 103/304 (33%), Positives = 168/304 (55%)

Query: 13  LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSH 72
           + P LLA+LTG LGD+  + KI S+ G +Y +F P + K +  LDV ++Y  C+ G  +H
Sbjct: 11  MDPALLAKLTGGLGDRGRVSKICSAFGEVYSEFFPDVIKSETGLDVTVNYLGCEIGYKNH 70

Query: 73  IIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEK 132
           ++     N     A+L +WS N  + C N  VITL+E+LLGA+ ETI +  +R LS +E 
Sbjct: 71  LVDDLSANVTLVDATLRNWSQNITLACGNGFVITLMEHLLGATAETIEEPADRLLSIIEL 130

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            LA     +I+ VL   ++      P+L   +  D   +      +EF   INM++T+  
Sbjct: 131 DLAVMVFDKIAKVLRSAVNAPGGFEPSLSAPHAHDARPRPPEDKPDEFAAAINMSLTLAG 190

Query: 193 VASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTT 252
           + S F LI+PQ  LLKT + +   + ++   S +  +    +  + +V ++ RI L+  T
Sbjct: 191 IVSEFSLIVPQTALLKTKVTAPKPKRQAAGASPEWSEQLGDQVRRSHVTLEARIRLQDLT 250

Query: 253 LKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLK 312
           L+ +  L +G VIPF         +SAN KE+Y CE GR G+NY +R+ D +N D + ++
Sbjct: 251 LRTISKLMVGDVIPFRDSGDVRVEVSANSKELYVCEFGRSGENYMVRVKDTMNSDDELIR 310

Query: 313 NFLH 316
           + ++
Sbjct: 311 HLMN 314


>gi|222084857|ref|YP_002543386.1| flagellar C-ring protein [Agrobacterium radiobacter K84]
 gi|221722305|gb|ACM25461.1| flagellar C-ring protein [Agrobacterium radiobacter K84]
          Length = 314

 Score =  210 bits (535), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 106/316 (33%), Positives = 170/316 (53%), Gaps = 2/316 (0%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           M  QS H   + + P+L A+LTG LGD  T+ K+ ++ G +Y +FLP I K +  LDV +
Sbjct: 1   MSQQSTHPKQT-MDPVLFAKLTGGLGDPATLAKLGTAFGQVYAEFLPDIIKSETGLDVSV 59

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
            Y  C+SG  S ++     N      SL +WS NF +GC    V+TL+E+LLGA  ETI 
Sbjct: 60  GYAGCRSGLMSELVAGIGSNCALVNGSLRNWSQNFLLGCGTGFVMTLMEHLLGAQPETID 119

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
               R LS +E  L+     +I+ VL   ++ T    P L+  Y+I+         +++F
Sbjct: 120 SPAARPLSVIELDLSVMVFDKIANVLRSAVNATGGFEPYLDPPYNIEDRPTPVAGQTDDF 179

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNV 240
              I M +++    S  V+I+PQ  LL+T + +  ++N S +      +    +  +  V
Sbjct: 180 AAAIAMTISLGKTVSEIVVIVPQYELLRTVVSAPRAKNPSASTGA-WAEQLNEQVRRSQV 238

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            ++ RI L+  TL  +  L +G VIPF+        +SAN K++Y CE GR G+NYT+R+
Sbjct: 239 TLEARIRLQSLTLDTISRLAVGDVIPFMDTSDVQVEVSANSKDLYVCEFGRSGENYTVRV 298

Query: 301 TDRINFDQKSLKNFLH 316
            D +N D + L++ ++
Sbjct: 299 KDTVNSDDELLRHLMN 314


>gi|190890355|ref|YP_001976897.1| flagellar C-ring motor switch protein [Rhizobium etli CIAT 652]
 gi|190695634|gb|ACE89719.1| flagellar C-ring motor switch protein [Rhizobium etli CIAT 652]
          Length = 316

 Score =  209 bits (533), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 102/304 (33%), Positives = 167/304 (54%)

Query: 13  LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSH 72
           + P LLA+LTG LGD+  + KI S+ G +Y +F P + K +  LDV ++Y  C+ G  +H
Sbjct: 13  MDPALLAKLTGGLGDRGRVSKICSAFGEVYSEFFPDVIKSETGLDVTVNYLGCEIGYKNH 72

Query: 73  IIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEK 132
           ++     N     A+L +WS N  + C N  VITL+E+LLGA+ +TI +  +R LS +E 
Sbjct: 73  LVDDLSANVTLVDATLRNWSQNITLACGNGFVITLMEHLLGATADTIEEPADRLLSIIEL 132

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            LA     +I+ VL   ++      P+L   +  D   +      +EF   INM++T+  
Sbjct: 133 DLAVMVFDKIAKVLRSAVNAPGGFEPSLSAPHAHDARARPPEDKPDEFAAAINMSLTLAG 192

Query: 193 VASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTT 252
           + S F LI+PQ  LLKT +     + ++   S +  +    +  + +V ++ RI L+  T
Sbjct: 193 IVSEFSLIVPQTALLKTKVTPPKPKRQAAGASPEWTEQLGDQVRRSHVTLEARIRLQDLT 252

Query: 253 LKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLK 312
           L+ +  L +G VIPF         +SAN KE+Y CE GR G+NY +R+ D +N D + ++
Sbjct: 253 LRTISKLMVGDVIPFRDSGDVRVEVSANSKELYVCEFGRSGENYMVRVKDTMNSDDELIR 312

Query: 313 NFLH 316
           + ++
Sbjct: 313 HLMN 316


>gi|222147563|ref|YP_002548520.1| flagellar motor switch protein [Agrobacterium vitis S4]
 gi|221734551|gb|ACM35514.1| flagellar motor switch protein [Agrobacterium vitis S4]
          Length = 319

 Score =  209 bits (533), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 106/304 (34%), Positives = 169/304 (55%)

Query: 12  PLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFS 71
           P+   LLARLTG LGD K++EK+    G LY +FLP +F  + +L +++ Y   +SG   
Sbjct: 15  PMDHALLARLTGGLGDMKSVEKLCQDFGQLYSEFLPDVFHSETNLTIEVGYLGFKSGLMR 74

Query: 72  HIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVE 131
            +I S  +NFV +  SL +WS NF + C N  VITL+E LLG   E I +   R LS +E
Sbjct: 75  DLIASLGDNFVLANTSLRNWSQNFVMACGNGFVITLMETLLGGMQEFIGEPIKRPLSNIE 134

Query: 132 KKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIE 191
             LA     +I+ VL   ++ T    P  E  ++ +   +       EF   ++M++ + 
Sbjct: 135 LDLAVMVFERIANVLRSGVNATGGFEPIFERPHNWENRLRQDGEQIEEFGALVHMSIKLG 194

Query: 192 NVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
            + S F LIIPQ+TLLKT + +  S+N+     ++  +  A +  +  V ++ RI+L+  
Sbjct: 195 KITSDFALIIPQKTLLKTNVTAPKSKNQVSKARKEWAEQLAEQVRKSQVTLEGRISLQSL 254

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSL 311
           +L  V  L  G VIPFL +      +SANG+++Y+CE GR G +YT+R+    + D + L
Sbjct: 255 SLLTVSKLAAGDVIPFLEKGDVTVDVSANGRDLYTCEFGRAGDHYTVRVKSMHSTDSELL 314

Query: 312 KNFL 315
           ++ +
Sbjct: 315 RHLM 318


>gi|86356304|ref|YP_468196.1| flagellar C-ring protein [Rhizobium etli CFN 42]
 gi|86280406|gb|ABC89469.1| flagellar C-ring protein [Rhizobium etli CFN 42]
          Length = 316

 Score =  208 bits (530), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 105/303 (34%), Positives = 165/303 (54%)

Query: 13  LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSH 72
           + P LLA+LTG LGD+  + KI S+ G +Y +FLP I K +  LDV +SY  C+ G  +H
Sbjct: 13  MDPALLAKLTGGLGDRGRVAKICSAFGDVYGEFLPDIIKSETGLDVTVSYLGCEIGYKNH 72

Query: 73  IIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEK 132
           ++     N     A+L +WS N  + C N  VITL+E+LLGA+ +TI +   R LS +E 
Sbjct: 73  LVDDLSHNVTLVDATLRNWSQNVTLACGNGFVITLMEHLLGATADTIEEPAERLLSVIEL 132

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            LA     +I+ VL   ++      P+L   +  D   +      +EF   INM++T+  
Sbjct: 133 DLAVMVFDKIAKVLRSAVNAPGGFEPSLSAPHAHDARPRPAEDKPDEFAAAINMSITLAG 192

Query: 193 VASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTT 252
           + S F LIIPQ  LLKT +     + ++   S +  +    +  + +V ++ +I L+  T
Sbjct: 193 IVSEFSLIIPQTALLKTKVTPPKPKRQTGGNSPEWTEQLGDQVRRSHVTLEAKIRLQDLT 252

Query: 253 LKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLK 312
           L+ +  L  G VIPF         +SAN KE+Y CE GR G+NY +R+ D +N D + ++
Sbjct: 253 LRTISKLMAGDVIPFHDSGDVRVEVSANSKELYICEFGRSGENYMVRVKDTMNSDDELIR 312

Query: 313 NFL 315
           + +
Sbjct: 313 HLM 315


>gi|209547920|ref|YP_002279837.1| hypothetical protein Rleg2_0312 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533676|gb|ACI53611.1| surface presentation of antigens (SPOA) protein [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 316

 Score =  206 bits (525), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 101/304 (33%), Positives = 167/304 (54%)

Query: 13  LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSH 72
           + P LLA+LTG LGDK  + KI SS G +Y +F P + K +  L+V ++Y  C+ G  +H
Sbjct: 13  MDPALLAKLTGGLGDKGRVAKICSSFGEIYSEFFPDVIKSETGLEVTVNYLGCEIGYKNH 72

Query: 73  IIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEK 132
           +I     N      +L +WS N  I C N  VITL+E+LLGA+ +TI +  +R LS +E 
Sbjct: 73  LIDDLSSNVTLVDVTLRNWSQNITIACGNGFVITLMEHLLGATADTIEEPADRLLSIIEM 132

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            LA     +I+ VL   ++      P+L   + ++   +      +EF   INM++T+  
Sbjct: 133 DLAVMVFDKIAKVLRSAVNAPGGFEPSLSVPHALEMRARPPEDRPDEFAAAINMSITLAG 192

Query: 193 VASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTT 252
           + S F L++PQ  LLKT +     + ++   S +  +    +  + +V ++ +I L+  T
Sbjct: 193 IVSEFSLMVPQTALLKTKVTPPKPKRQAGGSSAEWTEQLGDQVRRSHVTLEAKIRLQDLT 252

Query: 253 LKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLK 312
           L+ +  L +G VIPF         +SAN KE+Y CE GR G+NY +R+ D +N D + ++
Sbjct: 253 LRTISKLMVGDVIPFRDHGDVRVEVSANSKELYVCEFGRSGENYMVRVKDTMNSDDELIR 312

Query: 313 NFLH 316
           + ++
Sbjct: 313 HLMN 316


>gi|325291948|ref|YP_004277812.1| Flagellar motor switch protein [Agrobacterium sp. H13-3]
 gi|45479283|gb|AAS66685.1| FliM [Agrobacterium sp. H13-3]
 gi|325059801|gb|ADY63492.1| Flagellar motor switch protein [Agrobacterium sp. H13-3]
          Length = 319

 Score =  187 bits (476), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 94/301 (31%), Positives = 165/301 (54%), Gaps = 2/301 (0%)

Query: 17  LLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHS 76
           LLA+LTG L D+KTI K+ S +G+LY +FLP IF  +  + +D+ Y   +SG  + +I +
Sbjct: 18  LLAKLTGGLSDRKTIAKVGSDIGHLYSEFLPDIFHSETGIAIDVEYIGSESGLMTDLIAN 77

Query: 77  FKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAK 136
              NF  +  SL +W  NF +   N  VI L+E +LGA+ +TI +   RSLS +E  LA 
Sbjct: 78  IGGNFSVADCSLRNWCPNFMMAVGNGFVIALMERMLGAAADTIGEPDERSLSHIELDLAA 137

Query: 137 RTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASS 196
             + +I  VL   ++        ++  +  +        ++  +  T+ M + I  V+S 
Sbjct: 138 MVLGRIGGVLRSGVNAPGGFEATIDLPFTANGKSAFEEMIAGLYGVTVRMKIAIGKVSSE 197

Query: 197 FVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDV 256
           F LI+PQ  LLKT++ +  +  ++  +  + +D  + +  +  V ++ RI L+  TL+ +
Sbjct: 198 FALIVPQRPLLKTSIAAPKASAQALKKQAEWVDLISEQVKRSQVTLEARIKLETLTLRTI 257

Query: 257 VTLKIGQVIPF--LHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
             L  G VIPF  L ++     +SANG ++Y+CE G+ G  Y +R+ + ++ D + L++ 
Sbjct: 258 SRLVAGDVIPFQDLKQDDIGVEVSANGSKLYNCEFGKSGDRYMVRVKNNVSTDDEILRHL 317

Query: 315 L 315
           +
Sbjct: 318 M 318


>gi|159184367|ref|NP_353588.2| flagellar motor switch protein [Agrobacterium tumefaciens str. C58]
 gi|159139681|gb|AAK86373.2| flagellar motor switch protein [Agrobacterium tumefaciens str. C58]
          Length = 319

 Score =  186 bits (471), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 93/301 (30%), Positives = 168/301 (55%), Gaps = 2/301 (0%)

Query: 17  LLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHS 76
           LLA+LTG L D+KTI KI + +G+LY +FLP  F  +  + +D+ Y   +SG  + +I +
Sbjct: 18  LLAKLTGGLTDRKTIAKIGADIGHLYSEFLPDTFHSETGIAIDVEYIGSESGLMTDLIAN 77

Query: 77  FKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAK 136
             +N   +  SL +W  NF +   N  VI L+E +LGAS ++I     R+LS +E  LA 
Sbjct: 78  VGQNVAVADCSLRNWCPNFMMAVGNGFVIALMERMLGASPDSIGDPDERNLSHIELDLAA 137

Query: 137 RTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASS 196
             + +I+ VL   ++        ++  ++ +        ++  +  TI M + I  V+S 
Sbjct: 138 MVLGRIAGVLRSGVNAPGGFEATIDPPFNANGKSAFDEMIAGLYGVTIRMKIDIGKVSSE 197

Query: 197 FVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDV 256
           F LI+PQ  LLKT++++  +  ++  + E+ +D  +++  +  V ++ RI L+  TL+ +
Sbjct: 198 FSLIVPQRPLLKTSIVAPKASAQALKKQEEWMDMISQQVKRSQVTLEARIKLETLTLRTI 257

Query: 257 VTLKIGQVIPF--LHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
             L  G VIPF  L ++     +SANG ++Y+CE G+ G  Y +R+ + ++ D + L++ 
Sbjct: 258 SRLVAGDVIPFQDLKQDDIGVEVSANGSKLYNCEFGKSGDRYMVRVKNNVSTDDEILRHL 317

Query: 315 L 315
           +
Sbjct: 318 M 318


>gi|20141429|sp|Q44457|FLIM_AGRT5 RecName: Full=Flagellar motor switch protein FliM
          Length = 321

 Score =  186 bits (471), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 93/301 (30%), Positives = 168/301 (55%), Gaps = 2/301 (0%)

Query: 17  LLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHS 76
           LLA+LTG L D+KTI KI + +G+LY +FLP  F  +  + +D+ Y   +SG  + +I +
Sbjct: 20  LLAKLTGGLTDRKTIAKIGADIGHLYSEFLPDTFHSETGIAIDVEYIGSESGLMTDLIAN 79

Query: 77  FKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAK 136
             +N   +  SL +W  NF +   N  VI L+E +LGAS ++I     R+LS +E  LA 
Sbjct: 80  VGQNVAVADCSLRNWCPNFMMAVGNGFVIALMERMLGASPDSIGDPDERNLSHIELDLAA 139

Query: 137 RTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASS 196
             + +I+ VL   ++        ++  ++ +        ++  +  TI M + I  V+S 
Sbjct: 140 MVLGRIAGVLRSGVNAPGGFEATIDPPFNANGKSAFDEMIAGLYGVTIRMKIDIGKVSSE 199

Query: 197 FVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDV 256
           F LI+PQ  LLKT++++  +  ++  + E+ +D  +++  +  V ++ RI L+  TL+ +
Sbjct: 200 FSLIVPQRPLLKTSIVAPKASAQALKKQEEWMDMISQQVKRSQVTLEARIKLETLTLRTI 259

Query: 257 VTLKIGQVIPF--LHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
             L  G VIPF  L ++     +SANG ++Y+CE G+ G  Y +R+ + ++ D + L++ 
Sbjct: 260 SRLVAGDVIPFQDLKQDDIGVEVSANGSKLYNCEFGKSGDRYMVRVKNNVSTDDEILRHL 319

Query: 315 L 315
           +
Sbjct: 320 M 320


>gi|1480838|gb|AAC45322.1| FliM [Agrobacterium tumefaciens]
 gi|2459705|gb|AAB71781.1| FliM [Agrobacterium tumefaciens]
          Length = 321

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 93/301 (30%), Positives = 168/301 (55%), Gaps = 2/301 (0%)

Query: 17  LLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHS 76
           LLA+LTG L D+KTI KI + +G+LY +FLP  F  +  + +D+ Y   +SG  + +I +
Sbjct: 20  LLAKLTGGLTDRKTIAKIGADIGHLYSEFLPDTFHSETGIAIDVEYIGSESGLMTDLIAN 79

Query: 77  FKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAK 136
             +N   +  SL +W  NF +   N  VI L+E +LGAS ++I     R+LS +E  LA 
Sbjct: 80  VGQNVAVADCSLRNWCPNFMMAVGNGFVIALMERMLGASPDSIGDPDERNLSHIELDLAA 139

Query: 137 RTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASS 196
             + +I+ VL   ++        ++  ++ +        ++  +  TI M + I  V+S 
Sbjct: 140 MVLGRIAGVLRSGVNAPCGFVATIDPPFNANGKSAFDEMIAGLYGVTIRMKIDIGKVSSE 199

Query: 197 FVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDV 256
           F LI+PQ  LLKT++++  +  ++  + E+ +D  +++  +  V ++ RI L+  TL+ +
Sbjct: 200 FSLIVPQRPLLKTSIVAPKASAQALKKQEEWMDMISQQVKRSQVTLEARIKLETLTLRTI 259

Query: 257 VTLKIGQVIPF--LHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
             L  G VIPF  L ++     +SANG ++Y+CE G+ G  Y +R+ + ++ D + L++ 
Sbjct: 260 SRLVAGDVIPFQDLKQDDIGVEVSANGSKLYNCEFGKSGDRYMVRVKNNVSTDDEILRHL 319

Query: 315 L 315
           +
Sbjct: 320 M 320


>gi|150395476|ref|YP_001325943.1| surface presentation of antigens (SPOA) protein [Sinorhizobium
           medicae WSM419]
 gi|150026991|gb|ABR59108.1| surface presentation of antigens (SPOA) protein [Sinorhizobium
           medicae WSM419]
          Length = 315

 Score =  174 bits (441), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 90/299 (30%), Positives = 155/299 (51%)

Query: 17  LLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHS 76
           LLAR+ G LGD K I++++  L  ++ + LP + + +   DV I+Y   ++G  + ++  
Sbjct: 16  LLARMIGALGDDKVIDRLALELAQIFDELLPGVLRSETGCDVTIAYAGFRAGLRNELVAG 75

Query: 77  FKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAK 136
             +  +    SL +W ++F IGC + ++I L+E LLGA    I +   RSLS +E  +A 
Sbjct: 76  LGDGVLIGDLSLRNWCTDFQIGCDSPVLIALVEALLGAEPAGIEEPAPRSLSKIEIDVAL 135

Query: 137 RTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASS 196
                I+ VL   ++      P +   Y+     K    L + +  +I+M + +  V S+
Sbjct: 136 PVFHGIAEVLRIAVNAPGGFEPVVGRPYNSAERAKPDPALEDVYAASIDMTIGLGPVLST 195

Query: 197 FVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDV 256
           F +I+PQ TLLKT  +S     K +N   +  +    +  +  V ++ RI L+  TL  +
Sbjct: 196 FSVIVPQSTLLKTRFVSPKGAGKDQNAKTEWTEQLEEQVRRSAVALEARIRLESLTLDTI 255

Query: 257 VTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFL 315
             L+ G VIPF   +     +SANG+++Y CE GR G  YT+R+ D    +Q  L++ +
Sbjct: 256 ARLQAGDVIPFHDGQDVRVEVSANGRDLYVCEFGRSGSKYTVRVKDTHGSEQDILRHIM 314


>gi|15964406|ref|NP_384759.1| flagellar motor switch transmembrane protein [Sinorhizobium
           meliloti 1021]
 gi|307318903|ref|ZP_07598334.1| surface presentation of antigens (SPOA) protein [Sinorhizobium
           meliloti AK83]
 gi|17380372|sp|O54246|FLIM_RHIME RecName: Full=Flagellar motor switch protein FliM
 gi|15073583|emb|CAC45225.1| Flagellar motor switch transmembrane protein [Sinorhizobium
           meliloti 1021]
 gi|306895317|gb|EFN26072.1| surface presentation of antigens (SPOA) protein [Sinorhizobium
           meliloti AK83]
          Length = 315

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 90/299 (30%), Positives = 156/299 (52%)

Query: 17  LLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHS 76
           L+AR+TG LGD K I + +  L  ++ + LP + + +   DV I+Y   ++G  + +I +
Sbjct: 16  LIARMTGALGDDKVIGRTALELAQVFDELLPGVLQSETGCDVTIAYAGFRTGLRNELIAA 75

Query: 77  FKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAK 136
             +  +    SL +W ++F +GC + ++I L+E LLGA   +I +   RSLS +E  +A 
Sbjct: 76  LGDGVLLGDLSLRNWCADFQVGCDSPVLIALVEALLGAEPTSIEEPAPRSLSKIEIDVAL 135

Query: 137 RTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASS 196
                I+ VL   ++      P +   Y+     K    L + F  +I+M + +  V S+
Sbjct: 136 PVFHGIAEVLRTAVNAPGGFEPVVGRPYNSAERAKPDPVLQDVFAASIDMTIGLGPVLST 195

Query: 197 FVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDV 256
           F +I+PQ TLLKT ++S     +  N   +  +    +  +  V ++ RI L+  TL  +
Sbjct: 196 FSVIVPQSTLLKTRVVSRKGAGEDRNAKTEWTEQLEEQVRRSAVALEARIRLESLTLDTL 255

Query: 257 VTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFL 315
             L+ G VIPF   +     +SANG+++Y CE GR G  YT+R+ D    +Q  L++ +
Sbjct: 256 SRLQAGDVIPFHDGQDVRVEVSANGRDLYVCEFGRSGSRYTVRVKDTHGSEQDILRHIM 314


>gi|307311548|ref|ZP_07591189.1| surface presentation of antigens (SPOA) protein [Sinorhizobium
           meliloti BL225C]
 gi|306899565|gb|EFN30194.1| surface presentation of antigens (SPOA) protein [Sinorhizobium
           meliloti BL225C]
          Length = 315

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 90/299 (30%), Positives = 156/299 (52%)

Query: 17  LLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHS 76
           L+AR+TG LGD K I + +  L  ++ + LP + + +   DV I+Y   ++G  + +I +
Sbjct: 16  LIARMTGALGDDKVIGRTALELAQVFDELLPGVLQSETGCDVTIAYAGFRTGLRNELIAA 75

Query: 77  FKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAK 136
             +  +    SL +W ++F +GC + ++I L+E LLGA   +I +   RSLS +E  +A 
Sbjct: 76  LGDGVLLGDLSLRNWCADFQVGCDSPVLIALVEALLGAEPTSIEEPAPRSLSKIEIDVAL 135

Query: 137 RTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASS 196
                I+ VL   ++      P +   Y+     K    L + F  +I+M + +  V S+
Sbjct: 136 PVFHGIAEVLRTAVNAPGGFEPVVGRPYNSAERGKPDPVLQDVFAASIDMTIGLGPVLST 195

Query: 197 FVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDV 256
           F +I+PQ TLLKT ++S     +  N   +  +    +  +  V ++ RI L+  TL  +
Sbjct: 196 FSVIVPQSTLLKTRVVSRKGAGEDRNAKTEWTEQLEEQVRRSAVALEARIRLESLTLDTL 255

Query: 257 VTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFL 315
             L+ G VIPF   +     +SANG+++Y CE GR G  YT+R+ D    +Q  L++ +
Sbjct: 256 SRLQAGDVIPFHDGQDVRVEVSANGRDLYVCEFGRSGSRYTVRVKDTHGSEQDILRHIM 314


>gi|3894104|emb|CAA11954.1| flagellar C-ring protein [Sinorhizobium meliloti]
          Length = 315

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 90/299 (30%), Positives = 156/299 (52%)

Query: 17  LLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHS 76
           L+AR+TG LGD K I + +  L  ++ + LP + + +   DV I+Y   ++G  + +I +
Sbjct: 16  LIARMTGALGDDKVIGRTALELAQVFDELLPGVLQSETGCDVTIAYAGFRTGLRNDLIAA 75

Query: 77  FKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAK 136
             +  +    SL +W ++F +GC + ++I L+E LLGA   +I +   RSLS +E  +A 
Sbjct: 76  LGDGVLLGDFSLRNWCADFQVGCDSPVLIALVEALLGAEPTSIEEPAPRSLSKIEIDVAL 135

Query: 137 RTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASS 196
                I+ VL   ++      P +   Y+     K    L + F  +I+M + +  V S+
Sbjct: 136 PVFHGIAEVLRTAVNAPGGFEPVVGRPYNSAERAKPDPVLEDVFAASIDMTIGLGPVLST 195

Query: 197 FVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDV 256
           F +I+PQ TLLKT ++S     +  N   +  +    +  +  V ++ RI L+  TL  +
Sbjct: 196 FSVIVPQSTLLKTRIVSRKGAGEDRNAKTEWTEQLEEQVRRSAVALEARIRLESLTLDTL 255

Query: 257 VTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFL 315
             L+ G VIPF   +     +SANG+++Y CE GR G  YT+R+ D    +Q  L++ +
Sbjct: 256 SRLQAGDVIPFHDGQDVRVEVSANGRDLYVCEFGRSGSRYTVRVKDTHGSEQDILRHIM 314


>gi|227820849|ref|YP_002824819.1| Flagellar motor switch protein FliM [Sinorhizobium fredii NGR234]
 gi|227339848|gb|ACP24066.1| Flagellar motor switch protein FliM [Sinorhizobium fredii NGR234]
          Length = 315

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 89/299 (29%), Positives = 155/299 (51%)

Query: 17  LLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHS 76
           LLAR+TG LGD KTI + +  LG+++ + LP++ K++   D+ I Y   + G  + +I  
Sbjct: 16  LLARMTGALGDDKTIGRTALELGHVFSERLPEMLKQETGRDIAIGYAGVKMGFRNELIAD 75

Query: 77  FKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAK 136
             E  + S  SL +W + F IGC + ++I L+E LLGA    I +   R+LS +E  +A 
Sbjct: 76  LGEAVLLSDVSLRNWCAEFQIGCDSPVLIALVEALLGAEPIDIEEPLPRALSKIEIDVAV 135

Query: 137 RTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASS 196
               +I+  +   +       P +   ++          L + +  +I+M   +  V S+
Sbjct: 136 PVFERIAEAVRMAVDAPGGFEPVVGRPHNGAERLPPDPALEDVYAASIDMTFGLGPVLST 195

Query: 197 FVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDV 256
           F +IIPQ  LLKT ++   +  ++E+   D  +    +  +  V ++ RI L+  TL  +
Sbjct: 196 FSVIIPQNVLLKTQIVPPGNAGRNESMKTDWSEQLEEQIRRSAVTLEARIQLESLTLDTI 255

Query: 257 VTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFL 315
             L+ G VIPF   +     ++ANG+++Y CE GR G  YT+R+ D    +Q  L++ +
Sbjct: 256 SRLQPGDVIPFHDGQDVRVEVNANGRDLYVCEFGRSGSRYTVRVKDTHGSEQDILRHIM 314


>gi|1870714|gb|AAB48838.1| FliM [Sinorhizobium meliloti]
          Length = 258

 Score =  125 bits (314), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 67/237 (28%), Positives = 122/237 (51%)

Query: 17  LLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHS 76
           L+AR+TG LGD K I + +  L  ++ + LP + + +   DV I+Y   ++G  + +I +
Sbjct: 16  LIARMTGALGDDKVIGRTALELAQVFDELLPGVLQSETGCDVTIAYAGFRTGLRNELIAA 75

Query: 77  FKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAK 136
             +  +    SL +W ++F +GC   ++I L+E LLG +  +I +   RSLS +E  +A 
Sbjct: 76  LGDGVLLGDLSLRNWCADFQVGCDTPVLIALVEALLGPNPTSIEEPPPRSLSKIEIDVAL 135

Query: 137 RTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASS 196
              ++I+ VL   ++      P +   Y+     K    L + F  +I+M + +  V S+
Sbjct: 136 PVFSRIAEVLRTAVNAPGGFEPVVGRPYNSAERAKPDPVLQDVFAASIDMTIGLGPVLST 195

Query: 197 FVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTL 253
           F +I+PQ TLLKT ++S     +  N   +  +    +  +  V ++ RI L+  TL
Sbjct: 196 FSVIVPQSTLLKTRVVSRKGAGEDRNAKTEWTEQLEEQVRRSAVALEARIRLESLTL 252


>gi|218672165|ref|ZP_03521834.1| flagellar C-ring motor switch protein [Rhizobium etli GR56]
          Length = 209

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 65/208 (31%), Positives = 112/208 (53%)

Query: 108 LENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDID 167
           +E+LLGA+ +TI +  +R LS +E  LA     +I+ VL   ++      P+L   +  D
Sbjct: 1   MEHLLGATADTIEEPADRLLSIIELDLAVMVFDKIAKVLRSAVNAPGGFEPSLSAPHAHD 60

Query: 168 YLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDL 227
              +      +EF   INM++T+  + S F LI+PQ  LLKT +     + ++   S + 
Sbjct: 61  TRPRPAEDKPDEFAAAINMSITLAGIVSEFSLIVPQTALLKTQVTPPKPKRQAGGASPEW 120

Query: 228 IDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSC 287
            +    +  + +V ++ RI L+  TL+ +  L +G VIPF    +    +SAN KE+Y C
Sbjct: 121 TEQLGDQVRRSHVTLEARIRLQDLTLRTISKLMVGDVIPFRDTGEVRVEVSANSKELYIC 180

Query: 288 ELGRVGKNYTIRITDRINFDQKSLKNFL 315
           E GR G+NY +R+ D +N D + +++ +
Sbjct: 181 EFGRSGENYMVRVKDTMNSDDELIRHLM 208


>gi|218508217|ref|ZP_03506095.1| flagellar C-ring motor switch protein [Rhizobium etli Brasil 5]
          Length = 188

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 97/187 (51%)

Query: 130 VEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMT 189
           +E  LA     +I+ VL   ++      P+L   +  D   +      +EF   INM++T
Sbjct: 2   IELDLAVMVFDKIANVLRSAVNAPGGFEPSLSAPHAPDARPRPPEDKPDEFAAAINMSLT 61

Query: 190 IENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLK 249
           +  + S F LI+PQ  LLKT + +   + ++   S +  +    +  + +V ++ RI L+
Sbjct: 62  LAGIVSEFSLIVPQTALLKTKVTAPKPKRQAAGASPEWTEQLGDQVRRSHVTLEARIRLQ 121

Query: 250 KTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
             TL+ +  L +G VIPF         +SAN KE+Y CE GR G+NY +R+ D +N D +
Sbjct: 122 DLTLRTISKLMVGDVIPFRDSGDVRVEVSANSKELYVCEFGRSGENYMVRVKDTMNSDDE 181

Query: 310 SLKNFLH 316
            +++ ++
Sbjct: 182 LIRHLMN 188


>gi|163758006|ref|ZP_02165094.1| flagellar motor switch transmembrane protein [Hoeflea phototrophica
           DFL-43]
 gi|162284295|gb|EDQ34578.1| flagellar motor switch transmembrane protein [Hoeflea phototrophica
           DFL-43]
          Length = 315

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 72/306 (23%), Positives = 127/306 (41%), Gaps = 2/306 (0%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +T    P LL R+ G  GD   IE    SL       L + F+   ++ +       Q G
Sbjct: 11  DTYEFDPELLDRMIGAKGDAAVIEAKCHSLQSAMCGPLERAFEMATNVHLSARPGEIQQG 70

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
               ++  F ++ VF    +  WS +    C   LVI ++E LLG S      +  R LS
Sbjct: 71  SRRQLLSVFGQDAVFCDTWIEGWSRDISALCGTKLVIAMVECLLGGSDPEELDIAARPLS 130

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
            +E  ++     Q++  L +  S    +         +D  +   +   +     I + +
Sbjct: 131 GIELDMSLVVFEQLNDTLREVASKDPTAKAGAGKPM-LDIPEAEDDPKPDFHAAAITLEL 189

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINL 248
              +V +   LI+PQ  LLKT  I+ S +N      +D  +    +  +  +N+   + L
Sbjct: 190 QFGSVVTPLTLILPQSILLKTKPIT-SKKNAPNAVDDDWAERLNARVSRSQINLQAAVAL 248

Query: 249 KKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
               + ++  L++G +I F         LSANGK +Y+C LG+ G  Y +++      D+
Sbjct: 249 APLPVGEISRLQVGDLIGFAQTGDIEVTLSANGKALYTCALGKSGARYMVKVEGDAGPDE 308

Query: 309 KSLKNF 314
               +F
Sbjct: 309 NWRSDF 314


>gi|218662604|ref|ZP_03518534.1| flagellar C-ring motor switch protein [Rhizobium etli IE4771]
          Length = 169

 Score = 91.7 bits (226), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/144 (32%), Positives = 73/144 (50%), Gaps = 4/144 (2%)

Query: 13  LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSH 72
           + P LLA+LTG LGD+  + KI S+ G +Y +F P + K +  LDV ++Y  C+ G  +H
Sbjct: 13  MDPALLAKLTGGLGDRGRVSKICSAFGEVYSEFFPDVIKGETGLDVTVNYLGCEIGYKNH 72

Query: 73  IIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEK 132
           +I     N     A+L +WS N  + C N  VITL+            +  +R LS +E 
Sbjct: 73  LIDDLSANVTLVDATLRNWSQNVTLACGNGFVITLMGAPARRHRRYDREPADRLLSIIEL 132

Query: 133 KLAKRTIAQISAVLNQCISTTQES 156
            LA     +I+    +C +  Q +
Sbjct: 133 DLAVMVFDKIA----KCCARGQRA 152


>gi|170741398|ref|YP_001770053.1| flagellar motor switch protein FliM [Methylobacterium sp. 4-46]
 gi|168195672|gb|ACA17619.1| flagellar motor switch protein FliM [Methylobacterium sp. 4-46]
          Length = 303

 Score = 85.5 bits (210), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 69/268 (25%), Positives = 116/268 (43%), Gaps = 23/268 (8%)

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S  S +SG F  ++  ++ N V        W  +  +G   + V T++E LLGA     P
Sbjct: 48  SLMSVESGLFGDLLEPYEANAVVGIFYSPQWDGHLLVGLDRDFVFTMVEVLLGADGSEPP 107

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLE------DFYDIDYLKKNTN 174
               R+ S++E ++A+ T  QI   L    +    ++  LE      DF  I        
Sbjct: 108 VEEARNFSSIELRIAQMTFEQIGKALEAAFALVSVATLKLERTETRMDFAII-------G 160

Query: 175 RLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSED-----LID 229
           R SN+ V    +   + N      LIIPQ  +L     SLS     E+ S D      I 
Sbjct: 161 RRSNKAVAAKFLLQAL-NRGGEMFLIIPQ-AVLNPMRQSLSKVLTGESTSRDPRWEKQIS 218

Query: 230 PFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCEL 289
              RKT    V +   +  +  TL ++  LK+GQV+      ++   L  N + ++ C++
Sbjct: 219 TEVRKT---EVTLRAVLEERTLTLGEIADLKVGQVLTLDATPRSRVKLQGNDQALFWCQV 275

Query: 290 GRVGKNYTIRITDRINFDQKSLKNFLHK 317
           G+    Y +R+ D+I+ D++ +   L +
Sbjct: 276 GQANGAYVLRVEDQIDQDKEFMDGVLAR 303


>gi|254473349|ref|ZP_05086746.1| flagellar motor switch protein FliM [Pseudovibrio sp. JE062]
 gi|211957465|gb|EEA92668.1| flagellar motor switch protein FliM [Pseudovibrio sp. JE062]
          Length = 321

 Score = 79.7 bits (195), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 58/259 (22%), Positives = 116/259 (44%), Gaps = 7/259 (2%)

Query: 60  ISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETI 119
           ++  S  + +    +  +++  V +      W +   +G     + +++E LLG   E  
Sbjct: 65  LAVQSVSNERIGDALEQYEDRAVVAVLHAQEWDARILLGFDRTFIFSMVEVLLGGDGEEE 124

Query: 120 PQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYD-IDYLKKNTNRLSN 178
           P L +RSL+ VE++LA R   + +  L        ++S  +E   + +++ +  T R SN
Sbjct: 125 PFLEDRSLTNVEQRLAYRMFEEAATALETAFEAIADTSLKVERLENRMEFAQ--TGRKSN 182

Query: 179 EFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLIDPFARKTY 236
             V    M   I        +IIPQ  L  L+  L  + S  +   +       F ++  
Sbjct: 183 PCVLA-KMTAEIIGREGEIFIIIPQSVLNPLRENLTQVLS-GEVAGRDTRWTKQFQQEVQ 240

Query: 237 QLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNY 296
           +  V +   +  ++ TL++V   ++G V+      KT   L  N + +++C LG+V  +Y
Sbjct: 241 RTEVKLTAILEEQRMTLEEVAQFEVGLVLELNATPKTAVQLECNSQPLFNCRLGQVAGSY 300

Query: 297 TIRITDRINFDQKSLKNFL 315
           T+R+ + I  + + L + L
Sbjct: 301 TVRVEELIEQEGELLDDIL 319


>gi|188579889|ref|YP_001923334.1| flagellar motor switch protein FliM [Methylobacterium populi BJ001]
 gi|179343387|gb|ACB78799.1| flagellar motor switch protein FliM [Methylobacterium populi BJ001]
          Length = 335

 Score = 75.1 bits (183), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 58/263 (22%), Positives = 108/263 (41%), Gaps = 17/263 (6%)

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S +  +SG+F   + ++  N V      + W  +  +G   + + T++E L G+     P
Sbjct: 81  SLSGVESGRFGEFLDAYDANAVVGIFHAAEWDGHVLVGLDRDFLYTMVEVLFGSDGSEPP 140

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLE------DFYDIDYLKKNTN 174
               R+ S +E ++A+    Q+   L        +++  LE      +F  I        
Sbjct: 141 VEDERTFSAIELRIAQMVFEQVGKALESSFGLVSQTAFRLERTETRMEFAVI-------G 193

Query: 175 RLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSED--LIDPFA 232
           R SN+ V    +   + N      LIIPQ T+L     +L+     E+ + D       A
Sbjct: 194 RRSNKAVQAKFLLQAL-NRGGEMFLIIPQ-TVLNPLRPALAKVLTGESAARDPRWAQQIA 251

Query: 233 RKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRV 292
            +  +  V +   +  +  TL ++  LK+GQV+       T   L  N + ++ C  G+ 
Sbjct: 252 AEVQKTTVRLRAVLEERHLTLGEIAGLKVGQVLTLDATPATRIKLEGNDRPLFWCRAGQS 311

Query: 293 GKNYTIRITDRINFDQKSLKNFL 315
              Y +R+ D IN +++     L
Sbjct: 312 QGAYVLRVEDAINPEKEGGHGLL 334


>gi|118589946|ref|ZP_01547350.1| flagellar motor switch protein FliM [Stappia aggregata IAM 12614]
 gi|118437443|gb|EAV44080.1| flagellar motor switch protein FliM [Stappia aggregata IAM 12614]
          Length = 319

 Score = 74.7 bits (182), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 59/268 (22%), Positives = 126/268 (47%), Gaps = 19/268 (7%)

Query: 60  ISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETI 119
           IS +  ++ +   ++  F+ N + +      W +   +G   + + TL++ L GA     
Sbjct: 62  ISVSYVENNRIGDVLDEFESNALVAVLYSPEWDARVLVGFDRDFIFTLVDVLFGADGTEP 121

Query: 120 PQLYNRSLSTVEKKLAKRTIAQISA-VLNQCISTTQESSPNLEDFYD-IDYLKKNTNRLS 177
           P    R  S +E ++A RT+ +++A  L +  +   E++  +E     +D+      R +
Sbjct: 122 PIDDERPFSNIETRIA-RTMFEVAAKALAESFAPIAETTLKIERIESRMDF--AVVGRRN 178

Query: 178 NEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLI-----SLSSQNKSENQSEDLIDP 230
           N  V    +   I      F+ ++P  TL  L+  L       +SS++K   Q       
Sbjct: 179 NPAVVARLLQQAIGRGGEVFI-VMPHSTLNPLRQRLSQVLSGEMSSRDKQWTQH------ 231

Query: 231 FARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
           F  +  +  V ++  +  ++ +L D+  L++GQVI      ++   L+ N + +++C+LG
Sbjct: 232 FHNEIQRTEVKLEAILEEREMSLGDLANLRVGQVIELQATARSPVTLACNDQPVFTCQLG 291

Query: 291 RVGKNYTIRITDRINFDQKSLKNFLHKR 318
           ++  +YT++I + I+ ++K L + L  R
Sbjct: 292 QLNGSYTLQIDELIHEEEKDLFDDLRNR 319


>gi|163850084|ref|YP_001638127.1| flagellar motor switch protein FliM [Methylobacterium extorquens
           PA1]
 gi|163661689|gb|ABY29056.1| flagellar motor switch protein FliM [Methylobacterium extorquens
           PA1]
          Length = 344

 Score = 73.9 bits (180), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 55/257 (21%), Positives = 106/257 (41%), Gaps = 5/257 (1%)

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S +  +SG+F   + ++  N V        W  +  +G   + + T++E L G+     P
Sbjct: 90  SLSGVESGRFGEFLDAYDANAVVGIFQAPEWDGHVLVGLDRDFLYTMVEVLFGSDGAEPP 149

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
               R+ S +E ++A+    Q+   L        +++  LE   +         R SN+ 
Sbjct: 150 VEDERTFSAIELRIAQMVFEQVGKALESSFGLVSQTAFRLERM-ETRMEFAVIGRRSNKA 208

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSED--LIDPFARKTYQL 238
           V    +   + N      LIIPQ T+L     +L      E+ + D    +  A +  + 
Sbjct: 209 VQAKFLLQAL-NRGGEMFLIIPQ-TVLNPLRPALGKVLTGESAARDPRWAEQIAAEVQKT 266

Query: 239 NVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTI 298
            V +   +  +  TL ++  LK+GQV+       T   L  N + ++ C  G+   +Y +
Sbjct: 267 TVRLRAVLEERHLTLGEIAGLKVGQVLTLDATPATRIKLEGNDRPLFWCRAGQSQGSYVL 326

Query: 299 RITDRINFDQKSLKNFL 315
           R+ + IN +++     L
Sbjct: 327 RVEESINPEKEGGHGLL 343


>gi|218461631|ref|ZP_03501722.1| flagellar C-ring motor switch protein [Rhizobium etli Kim 5]
          Length = 98

 Score = 73.9 bits (180), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 48/82 (58%)

Query: 13 LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSH 72
          + P LLA+LTG LGD+  + KI S+ G +Y +F P + K +  LDV ++Y  C+ G  +H
Sbjct: 13 MDPALLAKLTGGLGDRGRVSKICSAFGEVYSEFFPDVIKSETGLDVTVNYLGCEIGYKNH 72

Query: 73 IIHSFKENFVFSQASLSSWSSN 94
          +I     N     A+L +WS N
Sbjct: 73 LIDDLSANVTLVDATLRNWSQN 94


>gi|218528687|ref|YP_002419503.1| surface presentation of antigens (SPOA) protein [Methylobacterium
           chloromethanicum CM4]
 gi|254559229|ref|YP_003066324.1| flagellar motor switch protein FliM [Methylobacterium extorquens
           DM4]
 gi|218520990|gb|ACK81575.1| surface presentation of antigens (SPOA) protein [Methylobacterium
           chloromethanicum CM4]
 gi|254266507|emb|CAX22271.1| Flagellar motor switch protein FliM [Methylobacterium extorquens
           DM4]
          Length = 340

 Score = 73.9 bits (180), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 57/263 (21%), Positives = 108/263 (41%), Gaps = 17/263 (6%)

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S +  +SG+F   + ++  N V        W  +  +G   + + T++E L G+     P
Sbjct: 86  SLSGVESGRFGEFLDAYDANAVVGIFQAPEWDGHVLVGLDRDFLYTMVEVLFGSDGAEPP 145

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLE------DFYDIDYLKKNTN 174
               R+ S +E ++A+    Q+   L        +++  LE      +F  I        
Sbjct: 146 VEDERTFSAIELRIAQMVFEQVGKALESSFGLVSQTAFRLERMETRMEFAVI-------G 198

Query: 175 RLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSED--LIDPFA 232
           R SN+ V    +   + N      LIIPQ T+L     +L      E+ + D    +  A
Sbjct: 199 RRSNKAVQAKFLLQAL-NRGGEMFLIIPQ-TVLNPLRPALGKVLTGESAARDPRWAEQIA 256

Query: 233 RKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRV 292
            +  +  V +   +  +  TL ++  LK+GQV+       T   L  N + ++ C  G+ 
Sbjct: 257 AEVQKTTVRLRAVLEERHLTLGEIAGLKVGQVLTLDATPATRIKLEGNDRPLFWCRAGQS 316

Query: 293 GKNYTIRITDRINFDQKSLKNFL 315
             +Y +R+ + IN +++     L
Sbjct: 317 QGSYVLRVEESINPEKEGGHGLL 339


>gi|240137217|ref|YP_002961686.1| Flagellar motor switch protein FliM [Methylobacterium extorquens
           AM1]
 gi|240007183|gb|ACS38409.1| Flagellar motor switch protein FliM [Methylobacterium extorquens
           AM1]
          Length = 344

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 57/263 (21%), Positives = 108/263 (41%), Gaps = 17/263 (6%)

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S +  +SG+F   + ++  N V        W  +  +G   + + T++E L G+     P
Sbjct: 90  SLSGVESGRFGEFLDAYDANAVVGIFQAPEWDGHVLVGLDRDFLYTMVEVLFGSDGAEPP 149

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLE------DFYDIDYLKKNTN 174
               R+ S +E ++A+    Q+   L        +++  LE      +F  I        
Sbjct: 150 VEDERTFSAIELRIAQMVFEQVGKALESSFGLVSQTAFRLERMETRMEFAVI-------G 202

Query: 175 RLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSED--LIDPFA 232
           R SN+ V    +   + N      LIIPQ T+L     +L      E+ + D    +  A
Sbjct: 203 RRSNKAVQAKFLLQAL-NRGGEMFLIIPQ-TVLNPLRPALGKVLTGESAARDPRWAEQIA 260

Query: 233 RKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRV 292
            +  +  V +   +  +  TL ++  LK+GQV+       T   L  N + ++ C  G+ 
Sbjct: 261 AEVQKTTVRLRAVLEERHLTLGEIAGLKVGQVLTLDATPATRIKLEGNDRPLFWCRAGQS 320

Query: 293 GKNYTIRITDRINFDQKSLKNFL 315
             +Y +R+ + IN +++     L
Sbjct: 321 QGSYVLRVEESINPEKEGGHGLL 343


>gi|13472567|ref|NP_104134.1| flagellar motor switch protein FliM [Mesorhizobium loti MAFF303099]
 gi|14023313|dbj|BAB49920.1| flagellar motor switch protein; FliM [Mesorhizobium loti
           MAFF303099]
          Length = 315

 Score = 73.6 bits (179), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 65/308 (21%), Positives = 130/308 (42%), Gaps = 21/308 (6%)

Query: 10  TSPLHP-----ILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           TSP  P     +++ RL G  G+   +      +       L K    ++ + V +   +
Sbjct: 2   TSPGSPAQARSLIIERLVGDSGEAAQVIGTGRGMAERAAPLLQKSLTSELGVPVTVDLRA 61

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +  + +       + F  +  + S+ S    +      +  ++  L G   ET      
Sbjct: 62  VEVSRVAEARSRAGDTFAMTIVASSTSSDAMTLVIDAPAIAIMVCTLFGGDPETPASPIE 121

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R LS +E  ++     Q++  LN   S  +     L     +   +   + L +     I
Sbjct: 122 RDLSQIEVDVSTMLFQQVAQALNG--SGRRSLDLRLPVPRAMSGTEAKRHVLRDGAALRI 179

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDP-----FARKTYQLN 239
            + ++    + +  + +PQ        I L+S++ + + + D   P     F+ +  +  
Sbjct: 180 VLGISTPADSGTVTVTMPQR-------IVLASRDSAASTAGDDHGPSWRERFSEEVMRST 232

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           V ++  + L + TL D+ +L++GQVI F    ++ A LSA G+ ++ CE G++G+NYT+R
Sbjct: 233 VALEATMPLARLTLGDLASLEVGQVIDFDETAQSRARLSARGQTLFVCEFGKLGQNYTVR 292

Query: 300 ITDRINFD 307
           I  R  FD
Sbjct: 293 I--RHPFD 298


>gi|182679717|ref|YP_001833863.1| flagellar motor switch protein FliM [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182635600|gb|ACB96374.1| flagellar motor switch protein FliM [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 313

 Score = 73.6 bits (179), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 68/269 (25%), Positives = 113/269 (42%), Gaps = 31/269 (11%)

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           + +S  + +   I+ +++ N V +   + +W S   +G     + TL+E   G      P
Sbjct: 58  TVSSIGTERIGDILDAYENNTVVAIIHVQAWDSRILVGFDRAFISTLIETFYGGDGSEPP 117

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLE------DFYDIDYLKKNTN 174
            +  R LS +E KLA+     +   L    ST  E+    E      DF  I        
Sbjct: 118 NIEKRPLSNIEIKLAQTIFDLLPKALQTSFSTISETVFKFERLETKLDFAVI------AP 171

Query: 175 RLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLI--DPFA 232
           R +  F+T IN+ +   +      ++IPQ +L      +   Q    + + D +  DP  
Sbjct: 172 RNTFGFITRINLRILGRH--GEMFVVIPQSSL------NSIRQELGRDLANDAVVRDPRW 223

Query: 233 RKTYQ-----LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSC 287
            K  Q       V +   I      L D   LKIGQV+P     K+ A L  N + ++ C
Sbjct: 224 TKQIQNEISRTEVEVRAIIEDSHFVLGDFTELKIGQVLPLQATTKSRAKLECNAEPLFWC 283

Query: 288 ELGRVGKNYTIRITDRINFDQKSLKNFLH 316
           ++G+    YT+R+ D I  DQ+  K+F+ 
Sbjct: 284 QVGQEDGFYTLRVEDFI--DQE--KDFIE 308


>gi|170748130|ref|YP_001754390.1| flagellar motor switch protein FliM [Methylobacterium radiotolerans
           JCM 2831]
 gi|170654652|gb|ACB23707.1| flagellar motor switch protein FliM [Methylobacterium radiotolerans
           JCM 2831]
          Length = 309

 Score = 73.2 bits (178), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 54/269 (20%), Positives = 114/269 (42%), Gaps = 25/269 (9%)

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S ++ +S +F  I+  ++ N +        W S+  +G   + + T++E LLG+     P
Sbjct: 54  SLSNVESQRFGDILEPYESNAIAGIFQAPEWDSHILVGFDRDFIFTMVEVLLGSDGSEPP 113

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLE------DFYDIDYLKKNTN 174
               RS S +E ++A+R   Q+   +    +   ++   LE      DF  I   ++N  
Sbjct: 114 LDEERSFSNIEMRIAQRLFEQVGRAVQSAFALVADTPFKLERTELRMDFAVIG--RRNNQ 171

Query: 175 RLSNEFVTTINMNMTIENVASSFVLIIPQETL------LKTTLISLSSQNKSENQSEDLI 228
            ++ +F+      +   N      ++IPQ  L      L   L+  +S   S    +   
Sbjct: 172 AVAAKFL------LQALNRGGEMFIVIPQSVLNPMRQSLARILVGETSARDSRWTRQ--- 222

Query: 229 DPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCE 288
              A +  +  V +   +  K   L ++  L +GQV+      ++   L  N ++++ C+
Sbjct: 223 --IAGEVQKTPVTLKAILEEKPLALGEIADLAVGQVLELRATPRSRVKLVGNDRDLFWCD 280

Query: 289 LGRVGKNYTIRITDRINFDQKSLKNFLHK 317
           +G+      +R+   I+ DQ+ + + L +
Sbjct: 281 VGQEDGAIVLRVDHFIDQDQEFIDDVLAR 309


>gi|158422267|ref|YP_001523559.1| flagellar motor switch protein [Azorhizobium caulinodans ORS 571]
 gi|158329156|dbj|BAF86641.1| flagellar motor switch protein [Azorhizobium caulinodans ORS 571]
          Length = 309

 Score = 73.2 bits (178), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 58/265 (21%), Positives = 110/265 (41%), Gaps = 17/265 (6%)

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S +S ++G+   ++  ++   V     +  W S+  +G   + V T++E L GA     P
Sbjct: 54  SLSSIETGRIGDVLEMYEGMAVAGVFHVPMWDSHIIVGFDRDFVFTMIEALFGADGSEPP 113

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQC---ISTTQESSPNLEDFYDIDYLKKNTNRLS 177
               RS S +E ++++    Q+   L+     +S TQ      E   D   + +  N   
Sbjct: 114 VDDERSFSNIELRISQAIFEQMQKALHNAFTMVSDTQFKFERQETRMDFAVIGRRNN--- 170

Query: 178 NEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQ 237
                T    +   N      +IIPQ  L      +L+    +E    D   P   K  +
Sbjct: 171 --LAVTAKFLLQALNRGGEMFVIIPQSALTPMRQ-ALARTTPAETSGRD---PIWTKQIR 224

Query: 238 LNVN---IDTRINLKKT--TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRV 292
             VN   +  R  L++    L ++   K+GQV+      +T   L +  + ++ C LG+ 
Sbjct: 225 DEVNRTQVKVRAILEERHYPLGEIADFKVGQVLHLQATPRTLVKLESADQPLFWCHLGQA 284

Query: 293 GKNYTIRITDRINFDQKSLKNFLHK 317
              Y +R+ ++IN +Q+ + + L +
Sbjct: 285 EGAYVLRVEEQINLNQEFVDDILPR 309


>gi|254504068|ref|ZP_05116219.1| flagellar motor switch protein FliM, putative [Labrenzia alexandrii
           DFL-11]
 gi|222440139|gb|EEE46818.1| flagellar motor switch protein FliM, putative [Labrenzia alexandrii
           DFL-11]
          Length = 319

 Score = 73.2 bits (178), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 62/279 (22%), Positives = 129/279 (46%), Gaps = 9/279 (3%)

Query: 44  KFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNL 103
           + +  + ++K      IS +  ++ +   ++  F+ N + +      W +   +G   + 
Sbjct: 46  RLMADVMRQKSPSPSYISVSYVENNRIGDVLDEFESNALVAVLYSPEWDARVLVGFDRDF 105

Query: 104 VITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISA-VLNQCISTTQESSPNLED 162
           + TL++ L GA     P    R  S +E ++A RTI +I+A  L +  +   E++  +E 
Sbjct: 106 IFTLVDVLFGADGTEPPIDEERPFSNIETRIA-RTIFEIAAKSLAESFAPIAETTLKIER 164

Query: 163 FYD-IDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNK 219
               +D+      R +N  V    +   I      FV ++P  TL  L+  L  + S   
Sbjct: 165 IESRMDF--AVVGRSNNPAVVGRLLQQAIGRGGEVFV-VLPHATLNPLRQALSQVLSGEM 221

Query: 220 SENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSA 279
           S  + +     F  +  +  V ++  +  ++  L ++  LK+GQVI      ++   L+ 
Sbjct: 222 S-GRDKQWTQHFHNEIQRTEVKLEAILEEREMHLGELSNLKVGQVIELQATARSPVTLAC 280

Query: 280 NGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLHKR 318
           N + I++C+LG++  +YT++I + I+ ++K L + L  R
Sbjct: 281 NDQPIFTCQLGQLDGSYTLQIEELIHEEEKDLFDDLRNR 319


>gi|260466628|ref|ZP_05812816.1| surface presentation of antigens (SPOA) protein [Mesorhizobium
           opportunistum WSM2075]
 gi|259029634|gb|EEW30922.1| surface presentation of antigens (SPOA) protein [Mesorhizobium
           opportunistum WSM2075]
          Length = 315

 Score = 69.3 bits (168), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 63/310 (20%), Positives = 127/310 (40%), Gaps = 25/310 (8%)

Query: 10  TSPLHP-----ILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           TSP  P     +++ RL G  G+   +     ++       L K     + + V +   +
Sbjct: 2   TSPGSPAQARSLIIERLVGDSGEADQVIDAGRAMAERAVPLLQKGLSSGLGVPVIVDLKA 61

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +  + +       +NF  +     + S    +      +  ++  L G   +       
Sbjct: 62  VEVSRVTEARSRAGDNFAMTVVGSPASSDAMTLVIDAAAIAIMVSTLFGGDPDMPVSPIE 121

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R LS +E  ++     +++  LN     + E    L     +  ++   + L +     I
Sbjct: 122 RDLSPLEADVSTMVFQEVAQALNGSGQRSLEL--RLPAPRAMSGIEARRHVLRDGAAIRI 179

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDP-------FARKTYQ 237
            + ++    + S  +++PQ        I L+ ++   + SE   DP       F+ +  +
Sbjct: 180 VLGISTPVDSGSITVMMPQR-------IVLAGRDGIASASE--ADPGTSWRARFSEEVMR 230

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             V ++  + L + TL D+  L++GQVI F    ++ A L A G+ ++ CE G++G+NYT
Sbjct: 231 STVALEATMPLARLTLGDLAKLEVGQVIDFEETAQSRARLGARGQTLFVCEFGKLGQNYT 290

Query: 298 IRITDRINFD 307
           +RI  R  FD
Sbjct: 291 VRI--RHPFD 298


>gi|328545470|ref|YP_004305579.1| flagellar motor switch protein FliM [polymorphum gilvum
           SL003B-26A1]
 gi|326415211|gb|ADZ72274.1| Flagellar motor switch protein FliM, putative [Polymorphum gilvum
           SL003B-26A1]
          Length = 314

 Score = 68.6 bits (166), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/309 (19%), Positives = 130/309 (42%), Gaps = 28/309 (9%)

Query: 12  PLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFS 71
           P+ P+L  R+     D   + + S+S  Y                   IS +  ++ +  
Sbjct: 31  PMLPVLFDRMARVFAD--AMRQKSTSPSY-------------------ISVSCIENERIG 69

Query: 72  HIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVE 131
            ++  ++ N + +      W +   +G   + + T+++ L GA     P    RS S +E
Sbjct: 70  DVLDEYEANALVAVLYSPEWDTRMLVGFDRDFIFTMIDVLFGADGTEPPIDEERSFSNIE 129

Query: 132 KKLAKRTIAQISAVLNQCISTTQESSPNLEDFYD-IDYLKKNTNRLSNEFVTTINMNMTI 190
            ++A+      +  L +  S   E++  +E     +D+      R +N  V    +   I
Sbjct: 130 TRIARSVFEVAAKALQESFSPIAETTLKIERVESRMDF--AVVGRRNNPAVVARLLLQAI 187

Query: 191 ENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINL 248
                 FV ++P  TL  L+  L  + S   S  + +     F  +  +  V +   +  
Sbjct: 188 GRGGEIFV-VMPHSTLNPLRQRLSQVLSGEMS-GRDKQWTQHFQTEIQRTEVRLQAVLEE 245

Query: 249 KKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
           ++ TL ++  L++GQ+I      ++   L  N + I++C LG++  +YT+++ D I+ ++
Sbjct: 246 RELTLGEIANLQVGQIIELQATPRSPVKLECNQQPIFNCLLGQLDGSYTLQVEDLIHLEK 305

Query: 309 KSLKNFLHK 317
             + + L +
Sbjct: 306 DIVDDLLSR 314


>gi|217976217|ref|YP_002360364.1| surface presentation of antigens (SPOA) protein [Methylocella
           silvestris BL2]
 gi|217501593|gb|ACK49002.1| surface presentation of antigens (SPOA) protein [Methylocella
           silvestris BL2]
          Length = 314

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 96/241 (39%), Gaps = 27/241 (11%)

Query: 90  SWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQC 149
           +W S   IG  ++ + TL E L G      P    R LS++E +LA + +      L   
Sbjct: 88  AWDSRILIGLDHDFIFTLAEALFGGDGGEAPFTQGRKLSSLELRLAHKALDLFGRALQSA 147

Query: 150 ISTTQESSPNLE------DFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQ 203
            ST  +++  LE      DF  I           N F  T  + + I        ++IPQ
Sbjct: 148 FSTVSDTAFKLERVETRLDFAVIAP--------RNAFGVTAKIKLRILGRHGEMFILIPQ 199

Query: 204 ETLLKTTLISLSSQNKSENQSEDLI--DPFARKTYQLNVN---IDTR--INLKKTTLKDV 256
             L          Q    N S+D    DP   +  +  +    I+ R  I  +   L D+
Sbjct: 200 AALNSV------RQQLGRNLSDDAAVRDPAWTRQIEGEIGRAEIEVRGVIEERHFLLGDI 253

Query: 257 VTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLH 316
             LK+G ++       T   L  N + ++ C LG+    YT+RI + ++ +Q+ +   L 
Sbjct: 254 ADLKVGGILQLKSTPSTRVRLECNAEPLFWCNLGQGDGVYTLRIDESMSREQEFVDEMLS 313

Query: 317 K 317
           +
Sbjct: 314 R 314


>gi|27381992|ref|NP_773521.1| hypothetical protein bll6881 [Bradyrhizobium japonicum USDA 110]
 gi|27355162|dbj|BAC52146.1| bll6881 [Bradyrhizobium japonicum USDA 110]
          Length = 313

 Score = 63.2 bits (152), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 53/255 (20%), Positives = 110/255 (43%), Gaps = 13/255 (5%)

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           +   II  ++ N V +      W S   I    + V T++E + G+     P    RS S
Sbjct: 66  RVGDIIKDYEANAVAAVLYAEQWDSRIIIMLDRDFVFTMVEAMFGSDGAEPPLDVERSFS 125

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
            +E +L +    + +  L    + T   +  +E   +         R  N    +I  N+
Sbjct: 126 NIEIRLVQALFERFAKALQSAFAGTSNVTFRVERV-ETAMASLAIGRSGN---MSICANI 181

Query: 189 TIENV--ASSFVLIIPQETL--LKTTL--ISLSSQNKSENQSEDLIDPFARKTYQLNVNI 242
            ++ +       LIIP   L  L+  L  + +S    S+ +  + ++    +T    V +
Sbjct: 182 MLQALYRGGQMFLIIPHSALNPLRQKLAHVVVSDGRASDPRWREQMESEVHRT---EVTL 238

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
              ++ K  TL DVV  ++GQV+      +T A L +N + ++ C++G++   Y +++ D
Sbjct: 239 SAVLDEKMVTLGDVVKFQVGQVLELEATPRTLARLESNNQVLFWCQIGQLDGYYAMQVAD 298

Query: 303 RINFDQKSLKNFLHK 317
            ++  ++ + + L +
Sbjct: 299 PVDQKREFVDDILSR 313


>gi|319781690|ref|YP_004141166.1| surface presentation of antigens (SPOA) protein [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317167578|gb|ADV11116.1| surface presentation of antigens (SPOA) protein [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 315

 Score = 60.8 bits (146), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 57/305 (18%), Positives = 120/305 (39%), Gaps = 14/305 (4%)

Query: 16  ILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIH 75
           +++ RL G  G+   +     ++       L K    +  + V +   + +  +      
Sbjct: 13  LIIERLVGDSGEAAQVIDAGRAMAERAVPLLQKTLTSEFGVPVVVDLKAIEVSRVPEARS 72

Query: 76  SFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLA 135
              + F  +    S+ S    +      +  ++  L G   +       R LS +E  ++
Sbjct: 73  RAGDTFAMTVIGSSASSDAMTLVIDAPAIAIMVCTLFGGDPDLPASPIERDLSQIEIDVS 132

Query: 136 KRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVAS 195
                Q++  LN   S  +     L     +   +     L +     I + ++    + 
Sbjct: 133 TMVFQQVAQALNG--SGKRSLDLRLPAPRAMSGTEAKRYVLRDGAAIRIVLGISTPADSG 190

Query: 196 SFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDP-----FARKTYQLNVNIDTRINLKK 250
           +  + +PQ  +L       +S++ +   S+D   P     F+ +  +  V ++  + L +
Sbjct: 191 TVTVTMPQRVVL-------ASRDGAVPVSDDDHGPSWRARFSEEVMRSTVALEATMPLAR 243

Query: 251 TTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
            TL D+   +IG VI F    ++ A LSA GK ++ CE G++G+NYT+RI    +  Q  
Sbjct: 244 LTLGDLAGFEIGDVIEFEETAQSQARLSARGKTLFVCEFGKLGQNYTVRIRQPYDAGQDF 303

Query: 311 LKNFL 315
           +   +
Sbjct: 304 IDGLM 308


>gi|90422602|ref|YP_530972.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           BisB18]
 gi|90104616|gb|ABD86653.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           BisB18]
          Length = 311

 Score = 59.7 bits (143), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 57/255 (22%), Positives = 103/255 (40%), Gaps = 15/255 (5%)

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S +   S + S I+  ++   + +     +W +   IG   + + T++E L GA     P
Sbjct: 56  SLSGVGSDRLSDIVDRYEGEAIAAVFYAQAWDARVLIGFDRDFIYTMIELLFGADGAEPP 115

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYD-IDYLKKNTNRLSNE 179
               R  S VE  +A+    +    L    S   + +  LE     +DYL     RL+N 
Sbjct: 116 LDMPRVFSNVEMHVAQALFERFGKALQSSFSRASDVNFTLERVETRMDYLA--VGRLNNM 173

Query: 180 FVTTINMNMTIENVASSFVLIIPQETL-----LKTTLISLSSQNKSENQSEDLIDPFARK 234
            V   N+ +   +      ++IP   L       + +++  S +   N S  L     R 
Sbjct: 174 AVCA-NILLQGLDRGGEMFIVIPHAALNPIRQALSQIVTGESASTDPNWSRQLHSEIKRT 232

Query: 235 TYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGK 294
              L   ++ R      TL +V    +GQVI       T   L  N + ++ C+LG++  
Sbjct: 233 EVVLKAVLEER----PFTLGEVAGFHVGQVIKLNATPNTMVRLECNNQRLFWCQLGQLNG 288

Query: 295 NYTIRITDRINFDQK 309
            Y++++ +  + DQK
Sbjct: 289 VYSLQVKE--SADQK 301


>gi|121602879|ref|YP_989408.1| flagellar motor switch protein FliM [Bartonella bacilliformis
           KC583]
 gi|120615056|gb|ABM45657.1| flagellar motor switch protein FliM [Bartonella bacilliformis
           KC583]
          Length = 323

 Score = 58.5 bits (140), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 53/97 (54%), Gaps = 5/97 (5%)

Query: 225 EDLIDPF-----ARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSA 279
           E  +DP       ++  Q +V I+  +     TL +++ LK+GQV+P          L +
Sbjct: 226 EKRMDPLWTKRLRKEVSQAHVQIEAFMQQGSMTLNELLNLKVGQVLPLPINAVKQVKLRS 285

Query: 280 NGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLH 316
             K +Y C LG++GKN++IR+TD I+ +++ +   +H
Sbjct: 286 GDKSLYKCSLGKIGKNFSIRVTDPIDEEKEMINELVH 322


>gi|115523171|ref|YP_780082.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           BisA53]
 gi|115517118|gb|ABJ05102.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           BisA53]
          Length = 275

 Score = 57.0 bits (136), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 56/255 (21%), Positives = 105/255 (41%), Gaps = 15/255 (5%)

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S +   S + S I+  ++   + +     +W +   IG   + + T++E L GA     P
Sbjct: 20  SLSGVGSDRLSEILDRYEGEAIAAVFYAQAWDARVLIGFDRDFIYTMIELLFGADGAEPP 79

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYD-IDYLKKNTNRLSNE 179
               R  S VE  +A+    +    L    S   + +  L+     +DYL     R +N 
Sbjct: 80  LDMPRVFSNVELHVAEALFERFGKALQSSFSMASDVTFTLDRVETRMDYLA--IGRPNNM 137

Query: 180 FVTTINMNMTIENVASSFVLIIPQETL--LKTTL---ISLSSQNKSENQSEDLIDPFARK 234
            V+   +   ++     F+ +IP   L  ++T L   ++  S +   N S  L     R 
Sbjct: 138 AVSAQILLQGLDRGGEMFI-VIPHAALNPIRTALSQIVTGESASTDPNWSRQLHSEIQRT 196

Query: 235 TYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGK 294
              L   ++ R      TL +V    +GQVI       T   L  N + ++ C++G++  
Sbjct: 197 EVVLRAVLEER----PFTLGEVAKFHVGQVIKLNATPNTMVRLECNNQRLFWCQMGQLNG 252

Query: 295 NYTIRITDRINFDQK 309
            Y++++ +  + DQK
Sbjct: 253 AYSLQVKE--SADQK 265


>gi|27380936|ref|NP_772465.1| flagellar motor switch protein FliM [Bradyrhizobium japonicum USDA
           110]
 gi|27354102|dbj|BAC51090.1| flagellar motor switch protein [Bradyrhizobium japonicum USDA 110]
          Length = 400

 Score = 57.0 bits (136), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 55/257 (21%), Positives = 105/257 (40%), Gaps = 26/257 (10%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
           V++S     S +F   ++S     V S      W +       +NL+ ++++ LLG    
Sbjct: 131 VEVSLDRITSVRFGDYMNSIPLPAVLSVFKAEEWDNFGMATVDSNLIYSMIDVLLGGRRG 190

Query: 118 TIP-QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNT--- 173
           T   ++  R  +T+E +L KR +  + A   Q        +      + ID L+ N    
Sbjct: 191 TSQLRIEGRPYTTIETELVKRLVEVVLADAEQAFRPLSPVT------FTIDRLETNPRFA 244

Query: 174 --NRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLID 229
             +R +N  +  + + + +E+   +  L++P  T+  ++  L+ +    K         D
Sbjct: 245 AISRPANAAIL-VRLRIDMEDRGGNIELLLPYATIEPIRGVLLQMFMGEKFGR------D 297

Query: 230 P-----FARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEI 284
           P     FA +  Q  +++D  +      LK ++ LK+G  +P   R      +      I
Sbjct: 298 PVWEGHFATEIGQAEISVDAVLYEADIPLKQLMRLKVGDTLPLDMRADANVTVRCGDVTI 357

Query: 285 YSCELGRVGKNYTIRIT 301
               +GRVG    IR+T
Sbjct: 358 TEGRMGRVGDRVAIRVT 374


>gi|294140210|ref|YP_003556188.1| flagellar motor switch protein FliM [Shewanella violacea DSS12]
 gi|293326679|dbj|BAJ01410.1| flagellar motor switch protein FliM [Shewanella violacea DSS12]
          Length = 343

 Score = 57.0 bits (136), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 54/254 (21%), Positives = 104/254 (40%), Gaps = 19/254 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S    Q  KF   +H+       +    S       I     LV  L++N  G     
Sbjct: 76  EVSINGVQMLKFGEYVHTLFVPTSLNMVRFSPLKGTGLITMEARLVFILVDNFFGGDGRF 135

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E+++       +  +L       +++   + D  + +YL    N  ++
Sbjct: 136 HAKIEGREFTPTERRI-------VQLLLKIIFEDYKDAWAPVMD-VEFEYLDSEVNPAMA 187

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFA 232
           N     E V   + ++ ++     F + +P  ++++     L +  +S+ Q  D+    A
Sbjct: 188 NIVSPTEVVVVSSFHIEVDGGGGDFHITMPY-SMIEPIRELLDAGVQSDTQDTDMRWSLA 246

Query: 233 RK--TYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
            K     ++V ID  I  ++ TLKDV+  K G +IP    E    +L       Y C+LG
Sbjct: 247 LKDEIMDIDVGIDATIVEQQITLKDVMEFKAGDIIPVELPEHI--VLRVEDLPTYRCKLG 304

Query: 291 RVGKNYTIRITDRI 304
           +   N  +RIT++I
Sbjct: 305 KTRDNLALRITEKI 318


>gi|256059632|ref|ZP_05449829.1| hypothetical protein Bneo5_04675 [Brucella neotomae 5K33]
 gi|261323602|ref|ZP_05962799.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261299582|gb|EEY03079.1| conserved hypothetical protein [Brucella neotomae 5K33]
          Length = 316

 Score = 55.1 bits (131), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/240 (20%), Positives = 101/240 (42%), Gaps = 22/240 (9%)

Query: 80  NFVFSQASL------SSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKK 133
           N +F +A++        W  + ++     LV +++E + GA     P   +R    VE+K
Sbjct: 73  NDIFDKAAIITPLKAERWGCSLYLALDAVLVFSVIEAMFGAQGNLGPVDADRPFGMVEQK 132

Query: 134 LAKRTIAQISAVLNQCISTTQES---SPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTI 190
           +A      ++  L++  +T+      +P   D  D     +    LS  F  T  + +T 
Sbjct: 133 IANLLAGHLAGALDRVFNTSSSQPLFAPG--DCIDTADFDRENFELSRLF--TCRIAVTA 188

Query: 191 ENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDP-FARKTYQ----LNVNIDTR 245
                   L++P+ T         +   +  +Q+    DP +A+K  Q      + ++  
Sbjct: 189 AGKTGQMHLLLPRSTHKPMQDAVAAFLRRPMDQA----DPAWAKKLRQGVSRARIELEAF 244

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           +     +L  +  L+IGQV+           L A  ++++ C LG+ G ++T+++ D +N
Sbjct: 245 MQQGSMSLDALSRLEIGQVLKLPVDAMEQVRLRAGNQQLFKCTLGKSGIHFTVKVGDPVN 304


>gi|296447445|ref|ZP_06889370.1| surface presentation of antigens (SPOA) protein [Methylosinus
           trichosporium OB3b]
 gi|296255065|gb|EFH02167.1| surface presentation of antigens (SPOA) protein [Methylosinus
           trichosporium OB3b]
          Length = 339

 Score = 55.1 bits (131), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/224 (20%), Positives = 96/224 (42%), Gaps = 9/224 (4%)

Query: 97  IGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQES 156
           +G     V  ++E L GA          R+L++VE +LA+  + +++  L    ++T  +
Sbjct: 120 LGAERKFVFAMVEGLFGADGSEPFYEEERALTSVEIRLARLVLDRLAKALQISFASTAGA 179

Query: 157 SPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS 216
           +  L+             R  +  +      +T     S  ++  PQ  +L     +L++
Sbjct: 180 ALALDPVEPKPEPAGAARRSGSALIC--RFRLTAFGAESEALVTFPQ-GVLDPLREALAA 236

Query: 217 QNKSENQSEDLIDPFARKT----YQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREK 272
              +  QS D +  +A++         V++   +  +  TL DV   ++GQ++       
Sbjct: 237 DPATTIQSADPL--WAQRMKDRITATEVSLTAVMERRDLTLGDVARFEVGQIVELPVSPT 294

Query: 273 TCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLH 316
               L   G+ ++ CE+G+    YTIRI D ++ +Q+ + + L 
Sbjct: 295 GLIALECEGQTLFWCEIGQKDGAYTIRIADFVDKEQEFIDDMLG 338


>gi|256158143|ref|ZP_05456059.1| hypothetical protein BcetM4_04820 [Brucella ceti M490/95/1]
 gi|256252906|ref|ZP_05458442.1| hypothetical protein BcetB_01037 [Brucella ceti B1/94]
 gi|261219994|ref|ZP_05934275.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|265996661|ref|ZP_06109218.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|260918578|gb|EEX85231.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|262550958|gb|EEZ07119.1| conserved hypothetical protein [Brucella ceti M490/95/1]
          Length = 316

 Score = 54.7 bits (130), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/240 (20%), Positives = 101/240 (42%), Gaps = 22/240 (9%)

Query: 80  NFVFSQASL------SSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKK 133
           N +F +A++        W  + ++     LV +++E + GA     P   +R    VE+K
Sbjct: 73  NDIFDKAAIITPLKAERWGCSLYLALDAVLVFSVIEAMFGAQGNLGPVDADRPFGMVEQK 132

Query: 134 LAKRTIAQISAVLNQCISTTQES---SPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTI 190
           +A      ++  L++  +T+      +P   D  D     +    LS  F  T  + +T 
Sbjct: 133 IANLLAGHLAGALDRVFNTSSSQPLFAPG--DCIDTADFDRENFELSRLF--TCRIAVTA 188

Query: 191 ENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDP-FARKTYQ----LNVNIDTR 245
                   L++P+ T         +   +  +Q+    DP +A+K  Q      + ++  
Sbjct: 189 AGKTGQMHLLLPRSTHKPMQDAVAAFLRRPMDQA----DPAWAKKLRQEVSRARIELEAF 244

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           +     +L  +  L+IGQV+           L A  ++++ C LG+ G ++T+++ D +N
Sbjct: 245 MQQGSMSLDALSRLEIGQVLKLPVDAMEQVQLRAGNQQLFKCTLGKSGIHFTVKVGDPVN 304


>gi|23499888|ref|NP_699328.1| flagellar motor switch protein FliM [Brucella suis 1330]
 gi|161620211|ref|YP_001594097.1| surface presentation of antigens (SPOA) protein [Brucella canis
           ATCC 23365]
 gi|163844320|ref|YP_001621975.1| hypothetical protein BSUIS_B0131 [Brucella suis ATCC 23445]
 gi|254702553|ref|ZP_05164381.1| hypothetical protein Bsuib36_01102 [Brucella suis bv. 3 str. 686]
 gi|254711391|ref|ZP_05173202.1| hypothetical protein BpinB_14272 [Brucella pinnipedialis B2/94]
 gi|254711990|ref|ZP_05173801.1| hypothetical protein BcetM6_01072 [Brucella ceti M644/93/1]
 gi|254715060|ref|ZP_05176871.1| hypothetical protein BcetM_01082 [Brucella ceti M13/05/1]
 gi|256014915|ref|YP_003104924.1| flagellar motor switch protein FliM [Brucella microti CCM 4915]
 gi|256029979|ref|ZP_05443593.1| hypothetical protein BpinM2_04895 [Brucella pinnipedialis
           M292/94/1]
 gi|260568539|ref|ZP_05839008.1| flagellar motor switch protein FliM [Brucella suis bv. 4 str. 40]
 gi|261216767|ref|ZP_05931048.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261318997|ref|ZP_05958194.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261319634|ref|ZP_05958831.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261753131|ref|ZP_05996840.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|265987000|ref|ZP_06099557.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|23463463|gb|AAN33333.1| flagellar motor switch protein FliM, putative [Brucella suis 1330]
 gi|161337022|gb|ABX63326.1| surface presentation of antigens (SPOA) protein [Brucella canis
           ATCC 23365]
 gi|163675043|gb|ABY39153.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
 gi|255997575|gb|ACU49262.1| flagellar motor switch protein FliM [Brucella microti CCM 4915]
 gi|260155204|gb|EEW90285.1| flagellar motor switch protein FliM [Brucella suis bv. 4 str. 40]
 gi|260921856|gb|EEX88424.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261292324|gb|EEX95820.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261298220|gb|EEY01717.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261742884|gb|EEY30810.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|264659197|gb|EEZ29458.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
          Length = 316

 Score = 54.7 bits (130), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/240 (20%), Positives = 101/240 (42%), Gaps = 22/240 (9%)

Query: 80  NFVFSQASL------SSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKK 133
           N +F +A++        W  + ++     LV +++E + GA     P   +R    VE+K
Sbjct: 73  NDIFDKAAIITPLKAERWGCSLYLALDAVLVFSVIEAMFGAQGNLGPVDADRPFGMVEQK 132

Query: 134 LAKRTIAQISAVLNQCISTTQES---SPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTI 190
           +A      ++  L++  +T+      +P   D  D     +    LS  F  T  + +T 
Sbjct: 133 IANLLAGHLAGALDRVFNTSSSQPLFAPG--DCIDTADFDRENFELSRLF--TCRIAVTA 188

Query: 191 ENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDP-FARKTYQ----LNVNIDTR 245
                   L++P+ T         +   +  +Q+    DP +A+K  Q      + ++  
Sbjct: 189 AGKTGQMHLLLPRSTHKPMQDAVAAFLRRPMDQA----DPAWAKKLRQEVSRARIELEAF 244

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           +     +L  +  L+IGQV+           L A  ++++ C LG+ G ++T+++ D +N
Sbjct: 245 MQQGSMSLDALSRLEIGQVLKLPVDAMEQVRLRAGNQQLFKCTLGKSGIHFTVKVGDPVN 304


>gi|254706317|ref|ZP_05168145.1| hypothetical protein BpinM_04820 [Brucella pinnipedialis
           M163/99/10]
 gi|261313764|ref|ZP_05952961.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261302790|gb|EEY06287.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
          Length = 316

 Score = 54.7 bits (130), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/240 (20%), Positives = 101/240 (42%), Gaps = 22/240 (9%)

Query: 80  NFVFSQASL------SSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKK 133
           N +F +A++        W  + ++     LV +++E + GA     P   +R    VE+K
Sbjct: 73  NDIFDKAAIITPLKAERWGCSLYLALDAVLVFSVIEAMFGAQGNLGPVDADRPFGMVEQK 132

Query: 134 LAKRTIAQISAVLNQCISTTQES---SPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTI 190
           +A      ++  L++  +T+      +P   D  D     +    LS  F  T  + +T 
Sbjct: 133 IANLLAGHLAGALDRVFNTSSSQPLFAPG--DCIDTADFDRENFELSRLF--TCRIAVTA 188

Query: 191 ENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDP-FARKTYQ----LNVNIDTR 245
                   L++P+ T         +   +  +Q+    DP +A+K  Q      + ++  
Sbjct: 189 AGKTGQMHLLLPRSTHKPMQDAVAAFLRRPMDQA----DPAWAKKLRQEVSRARIELEAF 244

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           +     +L  +  L+IGQV+           L A  ++++ C LG+ G ++T+++ D +N
Sbjct: 245 MQQGSMSLDALSRLEIGQVLKLPVDAMEQVRLRAGNQQLFKCTLGKSGIHFTVKVGDPVN 304


>gi|306841070|ref|ZP_07473793.1| surface presentation of antigen protein [Brucella sp. BO2]
 gi|306288908|gb|EFM60211.1| surface presentation of antigen protein [Brucella sp. BO2]
          Length = 253

 Score = 54.7 bits (130), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/239 (20%), Positives = 102/239 (42%), Gaps = 20/239 (8%)

Query: 80  NFVFSQASL------SSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKK 133
           N +F +A++        W  + ++     LV +++E + GA     P   +R    VE+K
Sbjct: 10  NDIFDKAAIITPLKAERWGCSLYLTLDAVLVFSVIEAMFGAQGNLGPVDADRPFGMVEQK 69

Query: 134 LAKRTIAQISAVLNQCISTTQESSPNLE--DFYDIDYLKKNTNRLSNEFVTTINMNMTIE 191
           +A      ++  L++  +T   S P     D  D     ++   LS  F  T ++ +T  
Sbjct: 70  IANLLAGHLAGALDRVFNTG-SSQPLFAPGDCIDTADFDRDNFELSRLF--TCHIAVTAA 126

Query: 192 NVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDP-FARKTYQ----LNVNIDTRI 246
                  L++P+ T         +   +  +Q+    DP +A+K  Q      + ++  +
Sbjct: 127 GKTGQMHLLLPRSTHKPMQDAVAAFLRRPMDQA----DPAWAKKLRQEVSRARIELEAFM 182

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
                +L  +  L+IGQV+           L A  ++++ C LG+ G ++T+++ D +N
Sbjct: 183 QQGSMSLDALSRLEIGQVLKLPVDAMEQVRLRAGNQQLFKCTLGKSGIHFTVKVGDPVN 241


>gi|110632665|ref|YP_672873.1| surface presentation of antigens (SPOA) protein [Mesorhizobium sp.
           BNC1]
 gi|110283649|gb|ABG61708.1| surface presentation of antigens (SPOA) protein [Chelativorans sp.
           BNC1]
          Length = 311

 Score = 54.7 bits (130), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/302 (19%), Positives = 114/302 (37%), Gaps = 14/302 (4%)

Query: 12  PLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFS 71
           P+  +++ RL G  GD + + + + +        L  IF+ K    + +     +  + +
Sbjct: 10  PMRDLVVERLVGATGDLRQVTEAARTTAMRSLPVLQDIFQAKFSAPLVLDIAGVEVVRLA 69

Query: 72  HI---IHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
            +     SF    V          +      + +L++++L   LG   +  P   +R  S
Sbjct: 70  ELKPEPDSFDALVVIPATDSRDALTMRLDAQALSLLVSIL---LGGDPDIPPSPLDRPPS 126

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESS-PNLEDFYDIDYLKKNTNRLSNEFVTTINMN 187
            +E  +A+      +  LN   S +     P  +        K+   R  +     I  +
Sbjct: 127 RIELDVARLVFGAFAQALNGTGSRSLGLRLPAPQPLAGPGDFKRFLVR--DGPGIRIAFS 184

Query: 188 MTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
           +    V+      +P   +LK    +    + +  Q +     F  +  +  V +   I 
Sbjct: 185 LGAGPVSGILTAWLPHRIILKARAPAAEDDSPAHTQWKQR---FGEEVRRSTVQVTATIP 241

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
           L K  L  +  LK GQV+           LS   + ++ CE GR+G+NYT+RI  R  FD
Sbjct: 242 LTKLPLGALANLKPGQVLELQENAPRETRLSVRNRPVFVCEFGRLGQNYTVRI--RQPFD 299

Query: 308 QK 309
            +
Sbjct: 300 DR 301


>gi|294853149|ref|ZP_06793821.1| flagellar motor switch protein FliM [Brucella sp. NVSL 07-0026]
 gi|294818804|gb|EFG35804.1| flagellar motor switch protein FliM [Brucella sp. NVSL 07-0026]
          Length = 348

 Score = 54.7 bits (130), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/239 (20%), Positives = 101/239 (42%), Gaps = 20/239 (8%)

Query: 80  NFVFSQASL------SSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKK 133
           N +F +A++        W  + ++     LV +++E + GA     P   +R    VE+K
Sbjct: 105 NDIFDKAAIITPLKAERWGCSLYLALDAVLVFSVIEAMFGAQGNLGPVDADRPFGMVEQK 164

Query: 134 LAKRTIAQISAVLNQCISTTQESSPNLE--DFYDIDYLKKNTNRLSNEFVTTINMNMTIE 191
           +A      ++  L++  +T+  S P     D  D     +    LS  F  T  + +T  
Sbjct: 165 IANLLAGHLAGALDRVFNTS-SSQPLFAPGDCIDTADFDRENFELSRLF--TCRIAVTAA 221

Query: 192 NVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDP-FARKTYQ----LNVNIDTRI 246
                  L++P+ T         +   +  +Q+    DP +A+K  Q      + ++  +
Sbjct: 222 GKTGQMHLLLPRSTHKPMQDAVAAFLRRPMDQA----DPAWAKKLRQEVSRARIELEAFM 277

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
                +L  +  L+IGQV+           L A  ++++ C LG+ G ++T+++ D +N
Sbjct: 278 QQGSMSLDALSRLEIGQVLKLPVDAMEQVRLRAGNQQLFKCTLGKSGIHFTVKVGDPVN 336


>gi|306846301|ref|ZP_07478862.1| surface presentation of antigens protein [Brucella sp. BO1]
 gi|306273296|gb|EFM55165.1| surface presentation of antigens protein [Brucella sp. BO1]
          Length = 316

 Score = 54.3 bits (129), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/237 (20%), Positives = 100/237 (42%), Gaps = 16/237 (6%)

Query: 80  NFVFSQASL------SSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKK 133
           N +F +A++        W  + ++     LV +++E + GA     P   +R    VE+K
Sbjct: 73  NDIFDKAAIITPLKAERWGCSLYLALDAVLVFSVIEAMFGAQGNLGPVDADRPFGMVEQK 132

Query: 134 LAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENV 193
           +A      ++  L++  +T   S P       ID    + + L    + T  + +T    
Sbjct: 133 IANLLAGHLADALDRVFNTGS-SQPLFAPGDCIDTADFDRDNLELSRLFTCRIAVTAAGK 191

Query: 194 ASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDP-FARKTYQ----LNVNIDTRINL 248
                L++P+ T         +   +  +Q+    DP +A+K  Q      + ++  +  
Sbjct: 192 TGQMHLLLPRSTHKPMQDAVAAFLRRPMDQA----DPAWAKKLRQEVSRARIELEAFMQQ 247

Query: 249 KKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
              +L  +  L+IGQV+           L A  ++++ C LG+ G ++T+++ D +N
Sbjct: 248 GSMSLDALSRLEIGQVLKLPVDAMEQVRLRAGNQQLFKCTLGKSGIHFTVKVGDPVN 304


>gi|254699436|ref|ZP_05161264.1| hypothetical protein Bsuib55_01034 [Brucella suis bv. 5 str. 513]
 gi|261749887|ref|ZP_05993596.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261739640|gb|EEY27566.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
          Length = 316

 Score = 53.9 bits (128), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/240 (20%), Positives = 100/240 (41%), Gaps = 22/240 (9%)

Query: 80  NFVFSQASL------SSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKK 133
           N +F +A++        W  + ++     LV +++E + GA     P   +R    VE+K
Sbjct: 73  NDIFDKAAIITPLKAERWGCSLYLALDAVLVFSVIEAMFGAQGNLGPVDADRPFGMVEQK 132

Query: 134 LAKRTIAQISAVLNQCISTTQES---SPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTI 190
           +A      ++  L++  +T+      +P   D  D     +    LS  F  T  + +T 
Sbjct: 133 IANLLAGHLAGALDRVFNTSSSQPLFAPG--DCIDTADFDRENFELSRLF--TCRIAVTA 188

Query: 191 ENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDP-FARKTYQ----LNVNIDTR 245
                   L++P+ T         +   +  +Q+    DP +A+K  Q      + ++  
Sbjct: 189 AGKTGQMHLLLPRSTHKPMQDAVAAFLRRPMDQA----DPAWAKKLRQEVSRARIELEAF 244

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           +      L  +  L+IGQV+           L A  ++++ C LG+ G ++T+++ D +N
Sbjct: 245 MQQGSMLLDALSRLEIGQVLKLPVDAMEQVRLRAGNQQLFKCTLGKSGIHFTVKVGDPVN 304


>gi|212634374|ref|YP_002310899.1| flagellar motor switch protein FliM [Shewanella piezotolerans WP3]
 gi|212555858|gb|ACJ28312.1| Flagellar motor switch protein FliM [Shewanella piezotolerans WP3]
          Length = 342

 Score = 53.5 bits (127), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/255 (20%), Positives = 102/255 (40%), Gaps = 19/255 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S    Q  KF   +H+       +    S       I     LV  L++N  G     
Sbjct: 75  EVSINGVQMLKFGEYVHTLFVPTSLNMVRFSPLKGTALITMEARLVFILVDNFFGGDGRF 134

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E+++       +  +L       +E+   + D  + DYL    N  ++
Sbjct: 135 HAKIEGREFTPTERRI-------VQLLLKIIFEDYKEAWAPVMDV-EFDYLDSEVNPAMA 186

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDL--IDP 230
           N     E V   + ++ ++     F + +P  ++++     L +  +S+ Q  D+     
Sbjct: 187 NIVSPTEVVVVSSFHIEVDGGGGDFHITMPY-SMIEPIRELLDAGVQSDTQDTDMRWSQA 245

Query: 231 FARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
              +   ++V ID  +   + TL+DV+  K G VIP    E    IL       Y C++G
Sbjct: 246 LRDEIMDVDVGIDATVVEHQVTLRDVLEFKAGDVIPVELPEHI--ILKVEDLPTYRCKMG 303

Query: 291 RVGKNYTIRITDRIN 305
           +  +N  ++I ++I 
Sbjct: 304 KTKENLALKICEQIQ 318


>gi|148256789|ref|YP_001241374.1| flagellar motor switch protein FliM [Bradyrhizobium sp. BTAi1]
 gi|146408962|gb|ABQ37468.1| Flagellar motor switch protein FliM [Bradyrhizobium sp. BTAi1]
          Length = 400

 Score = 52.8 bits (125), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 59/271 (21%), Positives = 109/271 (40%), Gaps = 26/271 (9%)

Query: 57  DVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASH 116
           +V++S     S +F   ++S     V S      W +       + L+ ++++ LLG   
Sbjct: 130 NVEVSLDRITSVRFGDYMNSIPLPAVLSVFKAEEWENFGLATVDSTLIYSIIDVLLGGRR 189

Query: 117 -ETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNT-- 173
             T  ++  R  +T+E  L KR I     VL+      +  SP     + ID L+ N   
Sbjct: 190 GNTQLRVEGRPYTTIETNLVKRLI---EVVLSDAEQAFRPLSPVR---FTIDRLETNPRF 243

Query: 174 ---NRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLI 228
              +R +N  +  + + + +E+   +  L++P  T+  ++  L+ +    K         
Sbjct: 244 AAISRPANAAIL-VKLRIDMEDRGGNIELLLPYATIEPIRPVLLQMFMGEKFGR------ 296

Query: 229 DP-----FARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKE 283
           DP     FA +  Q  V +D  +      LK ++ LK+G  +P   R      +      
Sbjct: 297 DPVWEGHFATEIAQAEVAVDAVLYEADVPLKQLMRLKVGDTLPLDIRPDALVAVRCGSTM 356

Query: 284 IYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
           +    +GRVG    IR+T  +     +L  F
Sbjct: 357 LTEGRMGRVGDRVAIRVTKNLRKPNTTLAMF 387


>gi|163744328|ref|ZP_02151688.1| flagellar motor switch protein [Oceanibulbus indolifex HEL-45]
 gi|161381146|gb|EDQ05555.1| flagellar motor switch protein [Oceanibulbus indolifex HEL-45]
          Length = 315

 Score = 52.8 bits (125), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 57/253 (22%), Positives = 98/253 (38%), Gaps = 41/253 (16%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           +I  TS +   +   + S +   + + A+   W S        +L+ ++LE +LG    T
Sbjct: 54  EIELTSLEYMPYEDAMESIQSPSLIAIANAEGWGSQIACVVEPDLLFSVLEIMLGGRRAT 113

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQIS-AVLNQCISTTQESSPNLEDFYDIDYLKKNTNRL- 176
             +   R L+ +E+KL +R +A++S   L QC+   Q+ SP     +DI  L+ N   + 
Sbjct: 114 TQEWKPRGLTAIEQKLGRR-LAELSLKGLAQCL---QDVSPVQ---FDIQSLESNPRSVM 166

Query: 177 ---SNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPF-- 231
                     + M+M  E+ +    L++P  TL              +  S  L  PF  
Sbjct: 167 LAAPRTATVLVRMHMQFEDRSGHMALVLPYGTL--------------DEVSAQLAQPFLG 212

Query: 232 ARKTYQLNVNIDTRINLKKTT-------------LKDVVTLKIGQVIPFLHREKTCAILS 278
            R     N   D    +  TT             L +V+  K GQVI       T  +  
Sbjct: 213 GRSPTDSNARKDMNNQISSTTVTITGVLQEVTIPLHEVLEWKTGQVIDLGMTVDTPVVGM 272

Query: 279 ANGKEIYSCELGR 291
            N + ++    G+
Sbjct: 273 VNAQPMFQAAFGQ 285


>gi|127512304|ref|YP_001093501.1| flagellar motor switch protein FliM [Shewanella loihica PV-4]
 gi|126637599|gb|ABO23242.1| flagellar motor switch protein FliM [Shewanella loihica PV-4]
          Length = 341

 Score = 52.8 bits (125), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 54/254 (21%), Positives = 102/254 (40%), Gaps = 19/254 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S    Q  KF   +H+       +    S       I     LV  L++N  G     
Sbjct: 74  EVSINGVQMLKFGEYVHTLFVPTSLNMVRFSPLKGTALITMEARLVFILVDNFFGGDGRF 133

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E+++       +  +L       +E+   + D  + DYL    N  ++
Sbjct: 134 HAKIEGREFTPTERRI-------VQLLLKIIFEDYKEAWAPVMDV-EFDYLDSEVNPAMA 185

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFA 232
           N     E V   + ++ ++     F + +P  ++++     L +  +S+ Q  D+    A
Sbjct: 186 NIVSPTEVVVVSSFHIEVDGGGGDFHITMPY-SMIEPIRELLDAGVQSDTQDTDMRWSQA 244

Query: 233 RK--TYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
            K     + V +D  I  K+ +LKDV+  K G +IP    E    +L       Y C+LG
Sbjct: 245 LKDEIMDVEVGLDATIVEKEISLKDVMGFKAGDIIPVEMPE--YIVLRVEDLPTYRCKLG 302

Query: 291 RVGKNYTIRITDRI 304
           R  +N  + I ++I
Sbjct: 303 RSRENLALNIREKI 316


>gi|157961196|ref|YP_001501230.1| flagellar motor switch protein FliM [Shewanella pealeana ATCC
           700345]
 gi|157846196|gb|ABV86695.1| flagellar motor switch protein FliM [Shewanella pealeana ATCC
           700345]
          Length = 342

 Score = 52.8 bits (125), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 51/254 (20%), Positives = 98/254 (38%), Gaps = 19/254 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S    Q  KF   +H+       +    S       I     LV  L++N  G     
Sbjct: 75  EVSINGVQMLKFGEYVHTLFVPTSLNMVRFSPLKGTALITMEARLVFILVDNFFGGDGRF 134

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E+++ +  +  I     +  +   E           DYL    N  ++
Sbjct: 135 HAKIEGREFTPTERRIVQLLLKIIFEDYKEAWAPVMEVQ--------FDYLDSEVNPAMA 186

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDL--IDP 230
           N     E V   + ++ ++     F + +P  ++++     L +  +S+ Q  D+     
Sbjct: 187 NIVSPTEVVVVSSFHIEVDGGGGDFHITMPY-SMIEPIRELLDAGVQSDTQDTDMRWSQA 245

Query: 231 FARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
              +   ++V ID  I   K TL++V+  K G VIP    E    IL       Y C++G
Sbjct: 246 LRDEIMDVDVGIDATIVEHKLTLREVLEFKAGDVIPVELPEHI--ILKVEDLPTYRCKMG 303

Query: 291 RVGKNYTIRITDRI 304
           +   N  ++I ++I
Sbjct: 304 KAKDNLALKICEKI 317


>gi|75675317|ref|YP_317738.1| flagellar motor switch protein FliM [Nitrobacter winogradskyi
           Nb-255]
 gi|74420187|gb|ABA04386.1| Flagellar motor switch protein FliM [Nitrobacter winogradskyi
           Nb-255]
          Length = 401

 Score = 52.8 bits (125), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 51/257 (19%), Positives = 104/257 (40%), Gaps = 26/257 (10%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASH- 116
           V++S     S +F   ++S     V S      W +       ++L+ ++++ LLG    
Sbjct: 132 VEVSLDRITSVRFGDYLNSIPLPAVLSVFKAEEWENFGLAMVDSSLIYSMIDVLLGGRRG 191

Query: 117 ETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-- 174
           ++  ++  R  +T+E  L KR +  + A   Q        S      + ID L+ N    
Sbjct: 192 QSSLRIEGRPYTTIETNLVKRLVEVVLADAEQAFRPLSPVS------FSIDRLETNPRFA 245

Query: 175 ---RLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLID 229
              R +N  +  + + + +E+   +  L++P  T+  ++  L+ +    K         D
Sbjct: 246 AITRPANAAIL-VRLRIDMEDRGGTIELLLPYATIEPIRNVLLQMFMGEKFGR------D 298

Query: 230 P-----FARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEI 284
           P      A +  Q  + +D  +   +  L+ ++TLK+G  +P   R      +      +
Sbjct: 299 PIWESHLATEIAQAQIAVDAVLYEAEIPLRQLMTLKVGDTLPLEMRPDASVAVRCGSVTL 358

Query: 285 YSCELGRVGKNYTIRIT 301
               +GRVG    IR++
Sbjct: 359 TEGRMGRVGDRVAIRVS 375


>gi|225685986|ref|YP_002733958.1| Flagellar motor switch protein fliM [Brucella melitensis ATCC
           23457]
 gi|256262888|ref|ZP_05465420.1| flagellar motor switch protein FliM [Brucella melitensis bv. 2 str.
           63/9]
 gi|225642091|gb|ACO02004.1| Flagellar motor switch protein fliM [Brucella melitensis ATCC
           23457]
 gi|263092725|gb|EEZ16934.1| flagellar motor switch protein FliM [Brucella melitensis bv. 2 str.
           63/9]
 gi|326410312|gb|ADZ67376.1| Flagellar motor switch protein fliM [Brucella melitensis M28]
 gi|326553605|gb|ADZ88244.1| Flagellar motor switch protein fliM [Brucella melitensis M5-90]
          Length = 316

 Score = 52.4 bits (124), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 48/240 (20%), Positives = 100/240 (41%), Gaps = 22/240 (9%)

Query: 80  NFVFSQASL------SSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKK 133
           N +F +A++        W  + ++     LV +++E + GA     P   +     VE+K
Sbjct: 73  NDIFDKAAIITPLKAERWGCSLYLALDAVLVFSVIEAMFGAQGNLGPVDADHPFGMVEQK 132

Query: 134 LAKRTIAQISAVLNQCISTTQES---SPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTI 190
           +A      ++  L++  +T+      +P   D  D     +    LS  F  T  + +T 
Sbjct: 133 IANLLAGHLAGALDRVFNTSSSQPLFAPG--DCIDTADFDRENFELSRLF--TCRIAVTA 188

Query: 191 ENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDP-FARKTYQ----LNVNIDTR 245
                   L++P+ T         +   +  +Q+    DP +A+K  Q      + ++  
Sbjct: 189 AGKTGQMHLLLPRSTHKPMQDAVAAFLRRPMDQA----DPAWAKKLRQEVSRARIELEAF 244

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           +     +L  +  L+IGQV+           L A  ++++ C LG+ G ++T+++ D +N
Sbjct: 245 MQQGSMSLDALSRLEIGQVLKLPVDAMEQVRLRAGNQQLFKCTLGKSGIHFTVKVGDPVN 304


>gi|17989455|ref|NP_542088.1| flagellar motor switch protein FLIM [Brucella melitensis bv. 1 str.
           16M]
 gi|256043048|ref|ZP_05445993.1| flagellar motor switch protein FLIM [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256111966|ref|ZP_05452917.1| flagellar motor switch protein FLIM [Brucella melitensis bv. 3 str.
           Ether]
 gi|260564280|ref|ZP_05834765.1| flagellar motor switch protein FliM [Brucella melitensis bv. 1 str.
           16M]
 gi|265989486|ref|ZP_06102043.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265993415|ref|ZP_06105972.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|17985334|gb|AAL54352.1| flagellar motor switch protein flim [Brucella melitensis bv. 1 str.
           16M]
 gi|260151923|gb|EEW87016.1| flagellar motor switch protein FliM [Brucella melitensis bv. 1 str.
           16M]
 gi|262764285|gb|EEZ10317.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263000155|gb|EEZ12845.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 316

 Score = 52.4 bits (124), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 48/240 (20%), Positives = 100/240 (41%), Gaps = 22/240 (9%)

Query: 80  NFVFSQASL------SSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKK 133
           N +F +A++        W  + ++     LV +++E + GA     P   +     VE+K
Sbjct: 73  NDIFDKAAIITPLKAERWGCSLYLALDAVLVFSVIEAMFGAQGNLGPVDADHPFGMVEQK 132

Query: 134 LAKRTIAQISAVLNQCISTTQES---SPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTI 190
           +A      ++  L++  +T+      +P   D  D     +    LS  F  T  + +T 
Sbjct: 133 IANLLAGHLAGALDRVFNTSSSQPLFAPG--DCIDTADFDRENFELSRLF--TCRIAVTA 188

Query: 191 ENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDP-FARKTYQ----LNVNIDTR 245
                   L++P+ T         +   +  +Q+    DP +A+K  Q      + ++  
Sbjct: 189 AGKTGQMHLLLPRSTHKPMQDAVAAFLRRPMDQA----DPAWAKKLRQEVSRARIELEAF 244

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           +     +L  +  L+IGQV+           L A  ++++ C LG+ G ++T+++ D +N
Sbjct: 245 MQQGSMSLDALSRLEIGQVLKLPVDAMEQVRLRAGNQQLFKCTLGKSGIHFTVKVGDPVN 304


>gi|330721397|gb|EGG99462.1| Flagellar motor switch protein FliM [gamma proteobacterium
           IMCC2047]
          Length = 329

 Score = 52.4 bits (124), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 48/213 (22%), Positives = 92/213 (43%), Gaps = 22/213 (10%)

Query: 102 NLVITLLENLLGAS-HETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNL 160
           +LV+ L++   G   H+    +  R  +  E+++ ++ ++Q+   + Q   T  +     
Sbjct: 125 DLVVNLVDRFFGGGVHDN--AIGEREFTVTEQRIIQKVLSQVFVDMKQAWQTIMD----- 177

Query: 161 EDFYDIDYLKKNTNRL------SNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISL 214
               D +YL    N         +E V      + IE       + IP  ++L+    +L
Sbjct: 178 ---IDFEYLSNEENPAMIKAISPSEVVVLSTFEIKIEEKGGRIQVAIPY-SMLEPVREAL 233

Query: 215 SSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREK 272
            S  + +N+  D    +   R     +V I  R+  +K TL++++  K G VIP    E 
Sbjct: 234 DSGVQVDNEYTDGNWAEALQRDLRYASVPISCRVAERKITLREILNFKAGDVIPIDMPE- 292

Query: 273 TCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
             +IL ANG  IY   +G   ++  ++I  +I+
Sbjct: 293 -SSILMANGVPIYEAAVGASNEHLALKIKRQID 324


>gi|167623386|ref|YP_001673680.1| flagellar motor switch protein FliM [Shewanella halifaxensis
           HAW-EB4]
 gi|167353408|gb|ABZ76021.1| flagellar motor switch protein FliM [Shewanella halifaxensis
           HAW-EB4]
          Length = 342

 Score = 52.4 bits (124), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 53/254 (20%), Positives = 100/254 (39%), Gaps = 19/254 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S    Q  KF   +H+       +    S       I     LV  L++N  G     
Sbjct: 75  EVSINGVQMLKFGEYVHTLFVPTSLNMVRFSPLKGTALITMEARLVFILVDNFFGGDGRF 134

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E+++       +  +L       +++   + D    DYL    N  ++
Sbjct: 135 HAKIEGREFTPTERRI-------VQLLLKIIFEDYKDAWAPVMDV-QFDYLDSEVNPAMA 186

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDL--IDP 230
           N     E V   + ++ ++     F + +P  ++++     L +  +S+ Q  D+     
Sbjct: 187 NIVSPTEVVVVSSFHIEVDGGGGDFHITMPY-SMIEPIRELLDAGVQSDTQDTDMRWSQA 245

Query: 231 FARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
              +   ++V ID  I   K TLK V+  K G VIP    E    IL       Y C++G
Sbjct: 246 LRDEIMDVDVGIDATIVEHKVTLKQVLEFKAGDVIPVELPEYI--ILKVEDLPTYRCKMG 303

Query: 291 RVGKNYTIRITDRI 304
           R  +N  ++I ++I
Sbjct: 304 RTKENLALKICEQI 317


>gi|153011533|ref|YP_001372747.1| surface presentation of antigens (SPOA) protein [Ochrobactrum
           anthropi ATCC 49188]
 gi|151563421|gb|ABS16918.1| surface presentation of antigens (SPOA) protein [Ochrobactrum
           anthropi ATCC 49188]
          Length = 317

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/220 (20%), Positives = 91/220 (41%), Gaps = 11/220 (5%)

Query: 91  WSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCI 150
           W S  ++     LV +++E + GA         +R    +E+K++      +++ L+Q  
Sbjct: 92  WGSTLYLTADATLVFSVIEAMYGAQGHVGSVDEDRPFGMLEQKISALLAGHLASSLDQVF 151

Query: 151 STTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTT 210
           +   ++     +  D     +     S  F   I++  T         L++P+ T     
Sbjct: 152 AANGQALFTAGECTDTAEFDRENFERSRLFACRIDV--TAAGKTGQVHLLLPRSTHKPMQ 209

Query: 211 LISLSSQNKSENQSEDLIDP-FARKTYQ----LNVNIDTRINLKKTTLKDVVTLKIGQVI 265
               +   +  NQ+    DP +A+K  Q      + ++  I     TL  +  L+IGQV+
Sbjct: 210 DAVAAFLRRPMNQT----DPSWAKKMRQEVSRARIELEAFIQQGSMTLDALSMLEIGQVL 265

Query: 266 PFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
                      L A  ++++ C LG+ G ++T+++ D +N
Sbjct: 266 KLPVDAMKQVRLRAGDQQLFKCTLGKSGIHFTVKVGDPVN 305


>gi|92116939|ref|YP_576668.1| flagellar motor switch protein FliM [Nitrobacter hamburgensis X14]
 gi|91799833|gb|ABE62208.1| flagellar motor switch protein FliM [Nitrobacter hamburgensis X14]
          Length = 401

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/257 (19%), Positives = 103/257 (40%), Gaps = 26/257 (10%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASH- 116
           V++S     S +F   ++S     V S      W +       ++L+ ++++ LLG    
Sbjct: 132 VEVSLDRITSVRFGDYMNSIPLPAVLSVFKAEEWENFGLAMVDSSLIYSMIDVLLGGRRG 191

Query: 117 ETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-- 174
           +T  ++  R  +T+E  L KR +  + A   Q        +      + ID L+ N    
Sbjct: 192 QTSLRIEGRPYTTIETNLVKRLVEVVLADAEQAFRPLSPVT------FSIDRLETNPRFA 245

Query: 175 ---RLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLID 229
              R +N  +  + + + +E+   +  L++P  T+  ++  L+ +    K         D
Sbjct: 246 AITRPANAAIL-VRLRIDMEDRGGTIELLLPYATIEPIRNVLLQMFMGEKFGR------D 298

Query: 230 P-----FARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEI 284
           P      A +  Q  + +D  +   +  LK ++ LK+G  +P   R      +      +
Sbjct: 299 PIWESHLATEIAQAQIAVDAVLYEAEIPLKQLMALKVGDTLPLDMRPDASVAVRCGSVTL 358

Query: 285 YSCELGRVGKNYTIRIT 301
               +GRVG    IR++
Sbjct: 359 TEGRMGRVGDRVAIRVS 375


>gi|115523559|ref|YP_780470.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           BisA53]
 gi|115517506|gb|ABJ05490.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           BisA53]
          Length = 403

 Score = 51.6 bits (122), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/261 (19%), Positives = 109/261 (41%), Gaps = 26/261 (9%)

Query: 57  DVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASH 116
           +V++S     S +FS  ++S     V S      W +       ++L+ ++++ LLG   
Sbjct: 133 NVEVSLDRITSVRFSDYMNSIPLPAVLSVFKAEEWENFGLATVDSSLIYSMIDVLLGGRR 192

Query: 117 -ETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN- 174
            +T  ++  R  +T+E  L KR +  + A   Q        +      + ID L+ N   
Sbjct: 193 GQTSMRIEGRPYTTIETNLVKRLVEVVLADAEQAFRPLSPVT------FKIDRLETNPRF 246

Query: 175 ----RLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLI 228
               R +N  +  + +++ +E+   +  L++P  T+  ++  L+ +    K         
Sbjct: 247 AAITRPANAAIL-VRLHIDMEDRGGNIELLLPYATIEPIRAVLMQMFMGEKFGR------ 299

Query: 229 DP-----FARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKE 283
           DP      A +  Q  +++D  +   +  LK +++LK+G  +P   R      +      
Sbjct: 300 DPIWEGHLATEITQAQISVDAVLYEAELPLKQLMSLKVGDTLPLEMRPDALVSVRCGSVI 359

Query: 284 IYSCELGRVGKNYTIRITDRI 304
           +    +GRV     IR+T ++
Sbjct: 360 LTEGRMGRVADRVAIRVTKQL 380


>gi|77918773|ref|YP_356588.1| flagellar biosynthesis protein, component of motor switch
           [Pelobacter carbinolicus DSM 2380]
 gi|77544856|gb|ABA88418.1| flagellar biosynthesis protein, component of motor switch
           [Pelobacter carbinolicus DSM 2380]
          Length = 331

 Score = 51.2 bits (121), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/226 (23%), Positives = 95/226 (42%), Gaps = 25/226 (11%)

Query: 91  WSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCI 150
           W   F       L   LLE+LLG + +    L  RSL+ +E  + + TIA     LN+  
Sbjct: 116 WRGVFIF--KEKLAFYLLEHLLGGAPDVNLNLPGRSLTAIETSVLRNTIADACLDLNKTF 173

Query: 151 STTQ---------ESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLII 201
           +  +         ESS  L     I+ +  + + L+  FV T N      N+    VL++
Sbjct: 174 APLEKIESSLVKIESSTRL-----INIVPGDASVLAAHFVVTGN------NLEDEIVLVL 222

Query: 202 PQETL--LKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTL 259
           P   L  LK  +    S   SE+Q         ++  Q++V++  ++     T++D++  
Sbjct: 223 PMAMLDPLKEKMRE-GSAVFSESQDRPWQTQLEQEIEQMDVDLSAQMATLNLTVRDILNF 281

Query: 260 KIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           K+G ++       +   + A G+  +    G       +RI+ RIN
Sbjct: 282 KVGDILDLGCAPSSPLQVRAAGQPKFQAIAGTHQGKKAVRISGRIN 327


>gi|332296623|ref|YP_004438546.1| flagellar motor switch protein FliM [Thermodesulfobium narugense
           DSM 14796]
 gi|332179726|gb|AEE15415.1| flagellar motor switch protein FliM [Thermodesulfobium narugense
           DSM 14796]
          Length = 323

 Score = 51.2 bits (121), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 65/289 (22%), Positives = 122/289 (42%), Gaps = 36/289 (12%)

Query: 29  KTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASL 88
           +T+E I  + G L    L  + +  M LD    +++     +   I+S     +    S 
Sbjct: 52  RTLELIHETYGRLVATSLSSLVRGSMRLD----FSAIDQVPYEEFINSLIPPAMIVIISW 107

Query: 89  SSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQ 148
            +   +  +  + N+ + L++ LLG S   +P    R+ + +E  L  + + +    L +
Sbjct: 108 ENTGLSMVLEMNLNITLALVDRLLGGS--GLPPPSPRAPTDIENALIAKLVDRHLVALEE 165

Query: 149 CISTTQESSPNLEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIP 202
              T    S        + ++   TN        +NE V  I M++ I +++    L IP
Sbjct: 166 AWRTVYPVS--------LTFVGTETNPEFAQIVPANEMVVLITMDIGIGDLSGIMSLAIP 217

Query: 203 QETLLKTTLISLSSQN-----KSENQSEDLIDPFARKTYQ--LNVNIDTRINLKKT--TL 253
             +LL+  +  LS+Q      K+EN  E          YQ  LNV ++ ++ L      L
Sbjct: 218 Y-SLLEPIVNHLSAQRFFVKKKAENDIE------REYVYQHVLNVMVNLQVCLGHMHIPL 270

Query: 254 KDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
           +D++ L++G  +    +      +    K+ +    GRVGKN  I+IT+
Sbjct: 271 RDLINLRVGDTLLLDTKVDKPLDVKIEKKQKFLGVPGRVGKNLAIKITE 319


>gi|170725980|ref|YP_001760006.1| flagellar motor switch protein FliM [Shewanella woodyi ATCC 51908]
 gi|169811327|gb|ACA85911.1| flagellar motor switch protein FliM [Shewanella woodyi ATCC 51908]
          Length = 342

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/254 (20%), Positives = 102/254 (40%), Gaps = 19/254 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S    Q  KF   +H+       +    +       I     LV  L++N  G     
Sbjct: 75  EVSINGVQMLKFGEYVHTLFVPTSLNMVRFNPLKGTALITMEARLVFILVDNFFGGDGRF 134

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E+++       +  +L       +++   + D  + DYL    N  ++
Sbjct: 135 HAKIEGREFTPTERRI-------VQLLLKIIFEDYKDAWAPVMD-VEFDYLDSEVNPAMA 186

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFA 232
           N     E V   + ++ ++     F + +P  ++++     L +  +S+ Q  D+    A
Sbjct: 187 NIVSPTEVVVISSFHIEVDGGGGDFHITMPY-SMIEPIRELLDAGVQSDTQDTDMRWSQA 245

Query: 233 RK--TYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
            K     +NV +D  +   + TLKDV+ LK G +IP    E    IL       + C+LG
Sbjct: 246 LKDEIMDVNVGLDATVVEHQITLKDVMELKQGDIIPVELPEHI--ILRVEDLPTFRCKLG 303

Query: 291 RVGKNYTIRITDRI 304
           +   N  +R+  +I
Sbjct: 304 KARDNLALRVIQKI 317


>gi|146341901|ref|YP_001206949.1| flagellar motor switch protein FliM [Bradyrhizobium sp. ORS278]
 gi|146194707|emb|CAL78732.1| Flagellar motor switch protein FliM [Bradyrhizobium sp. ORS278]
          Length = 400

 Score = 50.8 bits (120), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 56/271 (20%), Positives = 106/271 (39%), Gaps = 26/271 (9%)

Query: 57  DVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASH 116
           +V++S     S +F   ++S     V S      W +       + L+ ++++ LLG   
Sbjct: 130 NVEVSLDRITSVRFGDYMNSIPLPAVLSVFKAEEWENFGLAMVDSTLIYSIIDVLLGGRR 189

Query: 117 -ETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNT-- 173
             T  ++  R  +T+E  L KR I  + A   Q               + ID L+ N   
Sbjct: 190 GNTQLRVEGRPYTTIETNLVKRLIEVVLADAEQAFRPLSPVR------FTIDRLETNPRF 243

Query: 174 ---NRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLI 228
              +R +N  +  + + + +E+   +  L++P  T+  ++  L+ +    K         
Sbjct: 244 AAISRPANAAIL-VKLRIDMEDRGGNIELLLPYATIEPIRPVLLQMFMGEKFGR------ 296

Query: 229 DP-----FARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKE 283
           DP     FA +  +  V +D  +      LK ++ LK+G  +P   R      +      
Sbjct: 297 DPVWEGHFATEITRAEVAVDAVLYEADVPLKQLMRLKVGDTLPLDIRPDALVAVRCGNTM 356

Query: 284 IYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
           +    +GRVG    IR+T  +     +L  F
Sbjct: 357 LTEGRMGRVGDRVAIRVTKNLRKPHTTLAMF 387


>gi|308048759|ref|YP_003912325.1| flagellar motor switch protein FliM [Ferrimonas balearica DSM 9799]
 gi|307630949|gb|ADN75251.1| flagellar motor switch protein FliM [Ferrimonas balearica DSM 9799]
          Length = 357

 Score = 50.4 bits (119), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 57/271 (21%), Positives = 111/271 (40%), Gaps = 20/271 (7%)

Query: 54  MDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLG 113
           M  + ++S    Q  KF   +H+       +            I     LV  L++N  G
Sbjct: 70  MRRNAEVSINGVQMVKFGEYVHTLFVPTSLNMVRFRPLKGTGLITMEARLVFILVDNFFG 129

Query: 114 ASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNT 173
                  ++  R  +  E+++       I  +L       +ES   + D  + +YL    
Sbjct: 130 GDGRFQAKIEGREFTPTERRI-------IQLLLKTVFEDYKESWAPVMD-VEFEYLDSEV 181

Query: 174 N-RLSN-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDL 227
           N  ++N     E V   + ++ ++     F + +P  ++++     L +  +S+ Q  D+
Sbjct: 182 NPAMANIVSPTEVVVVSSFHIELDGGGGDFHITLPY-SMIEPIRELLDAGVQSDKQDTDM 240

Query: 228 IDPFARKTYQLNVNID--TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIY 285
               A +   ++V +D  T +  ++ TL+D++ +K G +IP    E    ++       +
Sbjct: 241 RWAKALQDEIMDVPVDLSTMLLEQELTLRDIMEMKAGDIIPVEMPEHL--LVRIEDLPTF 298

Query: 286 SCELGRVGKNYTIRITDRINFDQKSLKNFLH 316
             +LGR G N  +RI +RI    KS KN L 
Sbjct: 299 RGKLGRKGDNVAVRIEERIP-RPKSYKNELQ 328


>gi|85715055|ref|ZP_01046040.1| flagellar motor switch protein [Nitrobacter sp. Nb-311A]
 gi|85698252|gb|EAQ36124.1| flagellar motor switch protein [Nitrobacter sp. Nb-311A]
          Length = 400

 Score = 50.4 bits (119), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 52/258 (20%), Positives = 104/258 (40%), Gaps = 26/258 (10%)

Query: 57  DVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASH 116
           +V++S     S +F   ++S     V S      W +       ++L+ ++++ LLG   
Sbjct: 130 NVEVSLDRITSVRFGDYLNSIPLPAVLSVFKAEEWENFGLAMVDSSLIYSMIDVLLGGRR 189

Query: 117 -ETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN- 174
            +T  ++  R  +T+E  L KR +  + A   Q        S      + ID L+ N   
Sbjct: 190 GQTSLRIEGRPYTTIETNLVKRLVEVVLADAEQAFRPLSPVS------FSIDRLETNPRF 243

Query: 175 ----RLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLI 228
               R +N  +  + + + +E+   +  L++P  T+  ++  L+ +    K         
Sbjct: 244 AAITRPANAAIL-VRLRIDMEDRGGTIELLLPYATIEPIRNVLLQMFMGEKFGR------ 296

Query: 229 DP-----FARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKE 283
           DP      A +  Q  + +D  +   +  LK ++TLK+G  +    R      +      
Sbjct: 297 DPIWESHLATEIAQAQIAVDAVLYEAEIPLKQLMTLKVGDTLALEMRPDASVAVRCGSVT 356

Query: 284 IYSCELGRVGKNYTIRIT 301
           +    +GRVG    IR++
Sbjct: 357 LTEGRMGRVGDRVAIRVS 374


>gi|296122747|ref|YP_003630525.1| flagellar motor switch protein FliM [Planctomyces limnophilus DSM
           3776]
 gi|296015087|gb|ADG68326.1| flagellar motor switch protein FliM [Planctomyces limnophilus DSM
           3776]
          Length = 375

 Score = 49.7 bits (117), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 62/273 (22%), Positives = 113/273 (41%), Gaps = 27/273 (9%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
           V++   S     +S  + S +    F+         +  +  S +++  +++ LLG   E
Sbjct: 90  VEVKLISVDQLTYSEFVFSLENPTCFNLLESKGLEGHLILDLSPSIIFPIVDRLLGGGKE 149

Query: 118 TIPQLYNRSLSTVEKKLAKR-TIAQISAVLNQ----C---ISTTQ-ESSPNLEDFYDIDY 168
           +IP + +R L+ +E +L  R T+  I+ + N     C   +  TQ ES+P L        
Sbjct: 150 SIPSIPSRPLTEIELQLVSRITLLVINGLENAWHNVCSLGLKVTQIESNPQLVQIVP--- 206

Query: 169 LKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLI 228
                    NE +  ++  +T+  V     L IP  T+   +   LSS   S  Q + L 
Sbjct: 207 --------PNEVIVLVSFEITMGEVRGIMNLCIPFNTIEPLSG-KLSSDTWSAYQKKGL- 256

Query: 229 DPFARKTYQLNVN---IDTRINLKKT--TLKDVVTLKIGQVIPFLHREKTCAILSANGKE 283
           DP  R   +  ++   +   +NL  T  T +D+  L +G VI   H ++    +   G  
Sbjct: 257 DPKQRVILEDGLSKAAVKMIVNLAHTRLTARDLAHLAVGDVIMTEHPKEDGLEVVVEGCP 316

Query: 284 IYSCELGRVGKNYTIRITDRINFDQKSLKNFLH 316
           ++  + G V     IR+T  +   +  L+  L 
Sbjct: 317 MFMAKPGAVKGKKAIRVTGMVAHSRDILREKLQ 349


>gi|86750893|ref|YP_487389.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           HaA2]
 gi|86573921|gb|ABD08478.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           HaA2]
          Length = 401

 Score = 49.7 bits (117), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 48/254 (18%), Positives = 108/254 (42%), Gaps = 18/254 (7%)

Query: 57  DVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASH 116
           +V++S     S +FS  ++S     V        W +       ++L+ ++++ LLG   
Sbjct: 131 NVEVSLDRITSVRFSDYMNSIPLPAVLCVFKAEEWQNFGLATVDSSLIYSMIDVLLGGRR 190

Query: 117 -ETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNT-- 173
            +   ++  R  +T+E  L KR +  + A   Q        +      + ID L+ N   
Sbjct: 191 GQAAIRIEGRPYTTIETNLVKRLLEVVLADAEQAFRPLSPVA------FSIDRLETNPRF 244

Query: 174 ---NRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNK-SENQSEDL 227
              +R +N  +  + +++ +E+   +  L++P  T+  ++  L+ +    K   +Q  + 
Sbjct: 245 AAISRPANAAIL-VRLHIDMEDRGGNIELLLPYATIEPIRGVLMQMFMGEKFGRDQVWE- 302

Query: 228 IDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSC 287
               A +  Q ++++D  +   +  L+ ++ L++G  +P   R      +      +   
Sbjct: 303 -GHLATEIGQADISVDAVLYEAEVPLRQLMALQVGDTLPLDLRADALVAVRCGSVTLTEG 361

Query: 288 ELGRVGKNYTIRIT 301
            +GRVG    IR+T
Sbjct: 362 RMGRVGDRVAIRVT 375


>gi|114562367|ref|YP_749880.1| flagellar motor switch protein FliM [Shewanella frigidimarina NCIMB
           400]
 gi|114333660|gb|ABI71042.1| flagellar motor switch protein FliM [Shewanella frigidimarina NCIMB
           400]
          Length = 342

 Score = 49.3 bits (116), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 48/254 (18%), Positives = 105/254 (41%), Gaps = 19/254 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S    Q  KF   +H+       +    S       I     LV  L++N  G     
Sbjct: 75  EVSINGVQMLKFGEYVHTLFVPTSLNMVRFSPLKGTALITMEARLVFILVDNFFGGDGRF 134

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E+++       +  +L       +E+   + D  + +YL    N  ++
Sbjct: 135 HAKIEGREFTPTERRI-------VQLLLKIIFEDYKEAWAPVMD-VEFEYLDSEVNPAMA 186

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFA 232
           N     E V   + ++ ++     F + +P  ++++     L +  +S+ Q  D+    A
Sbjct: 187 NIVSPTEVVVINSFHIEVDGGGGDFHITMPY-SMIEPIRELLDAGVQSDKQDTDMRWSQA 245

Query: 233 RKTYQLNVNIDTRINL--KKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
            +   ++V +   +N+   + TL+DV+  K G +IP    E    ++   G   Y C++G
Sbjct: 246 LRDEIMDVQVGFDVNVVEHEVTLRDVMGFKAGDIIPIDLPEHI--MMRIEGLPTYRCKMG 303

Query: 291 RVGKNYTIRITDRI 304
           +   N  ++I+++I
Sbjct: 304 KSRDNLALKISEKI 317


>gi|254720632|ref|ZP_05182443.1| hypothetical protein Bru83_14198 [Brucella sp. 83/13]
 gi|265985676|ref|ZP_06098411.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|264664268|gb|EEZ34529.1| conserved hypothetical protein [Brucella sp. 83/13]
          Length = 316

 Score = 49.3 bits (116), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 49/239 (20%), Positives = 99/239 (41%), Gaps = 20/239 (8%)

Query: 80  NFVFSQASL------SSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKK 133
           N +F +A++        W  + ++     LV +++E + GA     P   +R    VE+K
Sbjct: 73  NDIFDKAAIITPLKAERWGCSLYLTLDAVLVFSVIEAMFGAQGNLGPVDGDRPFGMVEQK 132

Query: 134 LAKRTIAQISAVLNQCISTTQESSPNLE--DFYDIDYLKKNTNRLSNEFVTTINMNMTIE 191
           +A      ++  L++  +T   S P     D  D     +    LS  F  T  + +T  
Sbjct: 133 IANLLAGHLADALDRVFNTGS-SQPLFAPGDCIDTADFDRENFELSRLF--TCRIAVTAA 189

Query: 192 NVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDP-FARKTYQ----LNVNIDTRI 246
                  L++P+ T         +   +  +Q+    DP +A+K  Q      + ++  +
Sbjct: 190 GKTGQMHLLLPRSTHKPMQDAVAAFLRRPMDQA----DPAWAKKLRQEVSRARIELEAFM 245

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
                +L  +  L+IGQV+             A  ++++ C LG+ G ++T+++ D +N
Sbjct: 246 QQGSMSLDALSRLEIGQVLKLPVDAMEQVRPRAGNQQLFKCTLGKSGIHFTVKVGDPVN 304


>gi|163750543|ref|ZP_02157781.1| flagellar motor switch protein [Shewanella benthica KT99]
 gi|161329698|gb|EDQ00687.1| flagellar motor switch protein [Shewanella benthica KT99]
          Length = 348

 Score = 49.3 bits (116), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 52/254 (20%), Positives = 100/254 (39%), Gaps = 19/254 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S    Q  KF   +H+       +    S       I     LV  L++N  G     
Sbjct: 81  EVSINGVQMIKFGEYVHTLFVPTSLNMVKFSPLKGTGLITMEARLVFILVDNFFGGDGRF 140

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E+++       +  +L       +E+   + D  + +YL    N  ++
Sbjct: 141 HAKIEGREFTPTERRI-------VQLLLKIIFEDYKEAWAPVMD-VEFEYLDSEVNPAMA 192

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFA 232
           N     E V   + ++ ++     F + +P  ++++     L +  +S+ Q  D     A
Sbjct: 193 NIVSPTEVVVVSSFHIEVDGGGGDFHITMPY-SMIEPIRELLDAGVQSDTQDTDKRWSMA 251

Query: 233 RK--TYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
            K     + V ID  I  ++  LKDV+  + G +IP    E    +L       Y C+LG
Sbjct: 252 LKDEIMDIKVGIDATIVDQEIALKDVMKFRAGDIIPVDLPEHI--VLRVEDLPTYRCKLG 309

Query: 291 RVGKNYTIRITDRI 304
           +   N  +RI ++I
Sbjct: 310 KSRDNLALRIIEKI 323


>gi|306837356|ref|ZP_07470235.1| surface presentation of antigens (SPOA) protein [Brucella sp. NF
           2653]
 gi|306407548|gb|EFM63748.1| surface presentation of antigens (SPOA) protein [Brucella sp. NF
           2653]
          Length = 348

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/239 (20%), Positives = 99/239 (41%), Gaps = 20/239 (8%)

Query: 80  NFVFSQASL------SSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKK 133
           N +F +A++        W  + ++     LV +++E + GA     P   +R    VE+K
Sbjct: 105 NDIFDKAAIITPLKAERWGCSLYLTLDAVLVFSVIEAMFGAQGNLGPVDGDRPFGMVEQK 164

Query: 134 LAKRTIAQISAVLNQCISTTQESSPNLE--DFYDIDYLKKNTNRLSNEFVTTINMNMTIE 191
           +A      ++  L++  +T   S P     D  D     +    LS  F  T  + +T  
Sbjct: 165 IANLLAGHLADALDRVFNTG-SSQPLFAPGDCIDTADFDRENFELSRLF--TCRIAVTAA 221

Query: 192 NVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDP-FARKTYQ----LNVNIDTRI 246
                  L++P+ T         +   +  +Q+    DP +A+K  Q      + ++  +
Sbjct: 222 GKTGQMHLLLPRSTHKPMQDAVAAFLRRPMDQA----DPAWAKKLRQEVSRARIELEAFM 277

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
                +L  +  L+IGQV+             A  ++++ C LG+ G ++T+++ D +N
Sbjct: 278 QQGSMSLDALSRLEIGQVLKLPVDAMEQVRPRAGNQQLFKCTLGKSGIHFTVKVGDPVN 336


>gi|254785477|ref|YP_003072906.1| flagellar motor switch protein FliM [Teredinibacter turnerae T7901]
 gi|237685691|gb|ACR12955.1| flagellar motor switch protein FliM [Teredinibacter turnerae T7901]
          Length = 332

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/259 (16%), Positives = 99/259 (38%), Gaps = 28/259 (10%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           D+S    Q  KF   +H+       +            I     LV  L++N  G     
Sbjct: 76  DVSVGGIQIQKFGEYVHTLYVPTSLNMVKFRPLRGTALIILDAKLVFKLVDNFFGGDGRH 135

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E ++ +  + Q+   L++     +          D +Y+    N  ++
Sbjct: 136 -AKIEGREFTPTELRVVQMVLEQVFVDLHEAWKAVK--------LIDFEYINSEVNPSMA 186

Query: 178 N-----------EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSED 226
           N            F   ++      ++   + ++ P   +L   L     Q+ ++ + + 
Sbjct: 187 NIVSPSEVVVVSTFHVELDGGGGELHITMPYSMVEPIREILDAGL-----QSDTDERDDR 241

Query: 227 LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYS 286
            +        +  V+++  +  +  TL+++V LK+G +IP    E    I +ANG  ++ 
Sbjct: 242 WVQALREDVMRARVDLECDVVRRDITLREIVDLKVGDIIPVTMPE--VHIATANGVPMFQ 299

Query: 287 CELGRVGKNYTIRITDRIN 305
            ++G+   N  +RI D ++
Sbjct: 300 AKIGQCNNNLALRILDYVD 318


>gi|91976164|ref|YP_568823.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           BisB5]
 gi|91682620|gb|ABE38922.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           BisB5]
          Length = 400

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/254 (18%), Positives = 106/254 (41%), Gaps = 18/254 (7%)

Query: 57  DVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASH 116
           +V++S     S +F   ++S     V        W +       ++L+ ++++ LLG   
Sbjct: 130 NVEVSLDRITSVRFGDYMNSIPLPAVLCVFKAEEWQNFGLATVDSSLIYSMIDVLLGGRR 189

Query: 117 -ETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNT-- 173
            +   ++  R  +T+E  L KR +  + A   Q        +      + ID L+ N   
Sbjct: 190 GQAALRIEGRPYTTIETNLVKRLLQVVLADAEQAFRPLSPVA------FSIDRLETNPRF 243

Query: 174 ---NRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNK-SENQSEDL 227
              +R +N  +  + +++ +E+   +  L++P  T+  ++  L+ +    K   +Q  + 
Sbjct: 244 AAISRPANAAIL-VRLHIDMEDRGGNIELLLPYATIEPIRGVLMQMFMGEKFGRDQVWE- 301

Query: 228 IDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSC 287
               A +  Q  +++D  +   +  LK ++ L++G  +P   R      +      +   
Sbjct: 302 -GHLATEVVQAEISVDAVLYEAEVPLKQLMALQVGDTLPLDLRADALVAVRCGSVTLTEG 360

Query: 288 ELGRVGKNYTIRIT 301
            +GRVG    IR+T
Sbjct: 361 RMGRVGDRVAIRVT 374


>gi|39936958|ref|NP_949234.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           CGA009]
 gi|192292786|ref|YP_001993391.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           TIE-1]
 gi|39650815|emb|CAE29338.1| possible flagellar motor switch protein FliM [Rhodopseudomonas
           palustris CGA009]
 gi|192286535|gb|ACF02916.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           TIE-1]
          Length = 400

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/254 (18%), Positives = 107/254 (42%), Gaps = 18/254 (7%)

Query: 57  DVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASH 116
           +V++S     S +F   ++S     V        W +       ++L+ ++++ LLG   
Sbjct: 130 NVEVSLDRITSVRFGDYMNSIPLPAVLCVFKAEEWQNFGLATVDSSLIYSMIDVLLGGRR 189

Query: 117 -ETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNT-- 173
            +   ++  R  +T+E  L KR +  + A   Q        S      + ID L+ N   
Sbjct: 190 GQAALRIEGRPYTTIETNLVKRLLEVVLADAEQAFRPLSPVS------FSIDRLETNPRF 243

Query: 174 ---NRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNK-SENQSEDL 227
              +R +N  +  + +++ +E+   +  L++P  T+  ++  L+ +    K   +Q  + 
Sbjct: 244 AAISRPANAAIL-VRLHIDMEDRGGNIELLLPYATIEPIRGVLMQMFMGEKFGRDQVWE- 301

Query: 228 IDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSC 287
               A +  Q ++++D  +   +  L+ ++ L++G  +P   R      +      +   
Sbjct: 302 -GHLATEIVQADISVDAVLYEAELPLRQLMALQVGDTLPLELRADATVAVRCGSVVLTEG 360

Query: 288 ELGRVGKNYTIRIT 301
            +GRVG    IR+T
Sbjct: 361 RMGRVGDRVAIRVT 374


>gi|319409195|emb|CBI82839.1| Flagellar motor switch protein FliM [Bartonella schoenbuchensis R1]
          Length = 335

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 44/78 (56%)

Query: 239 NVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTI 298
           +V+I+  I     TL ++  L++GQV+           L +  K +Y C LG++G N++I
Sbjct: 257 HVSIEAFIQQGSMTLDELSKLQVGQVLSLPANAVKQIKLRSGKKSLYKCSLGKMGTNFSI 316

Query: 299 RITDRINFDQKSLKNFLH 316
           R+TD I+ +++ +   +H
Sbjct: 317 RVTDPIDEEKEMIDELVH 334


>gi|316932826|ref|YP_004107808.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           DX-1]
 gi|315600540|gb|ADU43075.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           DX-1]
          Length = 400

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/254 (18%), Positives = 107/254 (42%), Gaps = 18/254 (7%)

Query: 57  DVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASH 116
           +V++S     S +F   ++S     V        W +       ++L+ ++++ LLG   
Sbjct: 130 NVEVSLDRITSVRFGDYMNSIPLPAVLCVFKAEEWQNFGLATVDSSLIYSMIDVLLGGRR 189

Query: 117 -ETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNT-- 173
            +   ++  R  +T+E  L KR +  + A   Q        S      + ID L+ N   
Sbjct: 190 GQAALRIEGRPYTTIETNLVKRLLEVVLADAEQAFRPLSPVS------FSIDRLETNPRF 243

Query: 174 ---NRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNK-SENQSEDL 227
              +R +N  +  + +++ +E+   +  L++P  T+  ++  L+ +    K   +Q  + 
Sbjct: 244 AAISRPANAAIL-VRLHIDMEDRGGNIELLLPYATIEPIRGVLMQMFMGEKFGRDQVWE- 301

Query: 228 IDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSC 287
               A +  Q ++++D  +   +  L+ ++ L++G  +P   R      +      +   
Sbjct: 302 -GHLATEIVQADISVDAVLYEAELPLRQLMALQVGDTLPLELRADATVAVRCGSVVLTEG 360

Query: 288 ELGRVGKNYTIRIT 301
            +GRVG    IR+T
Sbjct: 361 RMGRVGDRVAIRVT 374


>gi|307824486|ref|ZP_07654711.1| flagellar motor switch protein FliM [Methylobacter tundripaludum
           SV96]
 gi|307734470|gb|EFO05322.1| flagellar motor switch protein FliM [Methylobacter tundripaludum
           SV96]
          Length = 331

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 56/258 (21%), Positives = 102/258 (39%), Gaps = 28/258 (10%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           +I  +  Q  KFS  I         +    +       I     LV T+++N  G + + 
Sbjct: 88  EIFISGIQVQKFSEYIQGLLVPTNLTIVRFNPLRGKALIVIDPRLVFTVVDNFFGGAGQF 147

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             Q   R  +  E ++ +  I  I   L +      E         D +Y+    N R +
Sbjct: 148 YNQTEGREFTPTEMRVVRIIIDMIFKDLKEAWKPVME--------LDFEYVGAEINPRFA 199

Query: 178 N-----EFVTTINMNMTIE------NVASSFVLIIPQETLLKTTLISLSSQNKSENQSED 226
           N     E +    +++ +E      N+A  + ++ P   LL   + S S +     Q+  
Sbjct: 200 NIIGPGEIIVISTIHVELEGGGGDVNIAMPYAMLEPIRELLDA-ISSDSGEVDGGWQA-- 256

Query: 227 LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYS 286
                  +  +  V+I++ +  K  T++DV+ LK G VIP    +    IL A G  ++ 
Sbjct: 257 ---ALRGEVLRAEVSINSLLVEKNMTIRDVMRLKKGDVIPIDMPD--TVILKAEGIPVFE 311

Query: 287 CELGRVGKNYTIRITDRI 304
            ++G    NY I+I D++
Sbjct: 312 GKVGISDGNYAIQIIDKV 329


>gi|327398387|ref|YP_004339256.1| flagellar motor switch protein FliM [Hippea maritima DSM 10411]
 gi|327181016|gb|AEA33197.1| flagellar motor switch protein FliM [Hippea maritima DSM 10411]
          Length = 327

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/255 (20%), Positives = 104/255 (40%), Gaps = 26/255 (10%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
           V+I   S     ++  + S   N  F+  SLS    N       ++   L++ LLG   E
Sbjct: 82  VEIEVVSVDQMTYAEFVLSLSNNVSFNVVSLSPLDGNAVFSLEPDIGFALIDRLLGGIGE 141

Query: 118 TIPQLYNRSLSTVEKKL----AKRTIAQISAVLNQCISTT-----QESSPNLEDFYDIDY 168
           +     NR  + +E+ +     ++ + ++ +     I  +     QESSPN+        
Sbjct: 142 S--SNINRPFTDIEQSILLDVVRQAMEEMRSSWEPIIDISFEVVGQESSPNVVQIV---- 195

Query: 169 LKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQN---KSENQSE 225
                    +E V  +   + +          +P   +L+  L  + + +   +S+  +E
Sbjct: 196 -------APSEIVVLVVFEVKLGETTGIINWCLPV-IVLEPVLNKIGTHDILARSKKATE 247

Query: 226 DLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIY 285
           D I+  AR   ++ V ++ R+      ++D ++LK G ++    +      +  NG E Y
Sbjct: 248 DRIEDIARTLKEVLVYLEFRLGTAAMKVEDFLSLKEGDLLTLDKKVDDELPVFINGVEKY 307

Query: 286 SCELGRVGKNYTIRI 300
             +LGR G N  ++I
Sbjct: 308 GVKLGRKGYNKAVKI 322


>gi|209884529|ref|YP_002288386.1| flagellar motor switch protein FliM [Oligotropha carboxidovorans
           OM5]
 gi|209872725|gb|ACI92521.1| flagellar motor switch protein FliM [Oligotropha carboxidovorans
           OM5]
          Length = 398

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/257 (19%), Positives = 107/257 (41%), Gaps = 26/257 (10%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASH- 116
           V++S     S +F+  ++S     V +      W +       ++L+ ++++ LLG    
Sbjct: 129 VEVSLDRITSVRFADYLNSIPLPCVLTVFKAEEWENFGLFTVDSSLIYSMIDVLLGGRRG 188

Query: 117 ETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNT--- 173
           +T  ++  R  +T+E  L KR +  + A   Q        +      + ID L+ N    
Sbjct: 189 QTSLRIEGRPYTTIETNLVKRLVEVVLADAEQAFRPLSPVT------FTIDRLETNPRFA 242

Query: 174 --NRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLID 229
             +R +N  +  + + + +E+   +  L++P  T+  ++  L+ +    K         D
Sbjct: 243 AISRPANAAIL-VRLRVDMEDRGGNVELLLPYATIEPIRNVLLQMFMGEKFGR------D 295

Query: 230 P-----FARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEI 284
           P      A +  Q  + +D  +   +  LK +++L++G  +P   R      +     ++
Sbjct: 296 PIWEGHLATEIAQAELYVDAVLYEAEIPLKQLMSLQVGDTLPLDIRPDALVSVRCGDVKL 355

Query: 285 YSCELGRVGKNYTIRIT 301
               +GRVG    IR++
Sbjct: 356 SEGRMGRVGDRVAIRVS 372


>gi|90021820|ref|YP_527647.1| flagellar motor switch protein FliM [Saccharophagus degradans 2-40]
 gi|89951420|gb|ABD81435.1| flagellar motor switch protein FliM [Saccharophagus degradans 2-40]
          Length = 333

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/262 (18%), Positives = 100/262 (38%), Gaps = 31/262 (11%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           D+S    Q  KF   +H+       +            I     LV  L++N  G     
Sbjct: 76  DVSVGGIQIQKFGEYVHTLYVPTSLNMVKFRPLRGTALIILDAKLVFKLVDNFFGGDGRH 135

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E ++ +  + Q+   L +     +          D +Y+    N  ++
Sbjct: 136 -AKIEGREFTPTELRVVQMVLEQVFIDLKEAWKAVKA--------IDFEYINSEVNPSMA 186

Query: 178 N-----------EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSED 226
           N            F   ++      ++   + ++ P   +L   L     Q+ ++ + + 
Sbjct: 187 NIVSPSEVVVVSTFHVELDGGGGELHITMPYSMVEPIREVLDAGL-----QSDTDERDDR 241

Query: 227 LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYS 286
            +        +  V+++  +  ++ TL+D+V L+ G +IP    E    IL+ANG  ++ 
Sbjct: 242 WVRALQEDVMEARVDLEADLVRREVTLRDIVDLREGDIIPITMPEYN--ILTANGVPMFK 299

Query: 287 CELGRVGKNYTIRI---TDRIN 305
            +LG++  N  +RI    DR N
Sbjct: 300 TQLGQLNDNLAMRILGFVDRSN 321


>gi|317133477|ref|YP_004092791.1| flagellar motor switch protein FliM [Ethanoligenens harbinense
           YUAN-3]
 gi|315471456|gb|ADU28060.1| flagellar motor switch protein FliM [Ethanoligenens harbinense
           YUAN-3]
          Length = 335

 Score = 47.4 bits (111), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 58/291 (19%), Positives = 123/291 (42%), Gaps = 28/291 (9%)

Query: 29  KTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASL 88
           KT+  I  + G L   +L    +    ++V     + +  +F    ++ + N +     +
Sbjct: 53  KTLSIIYENYGRLLSSYLSGTLRSYCKVEV----LTIEEQRFFEYSNALESNVLMGVLDM 108

Query: 89  SSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQ 148
                +  +  S ++   +++ LLG   E      +R  + +E +L ++ +  +  ++  
Sbjct: 109 KPLEGSSMVTLSQSVAFGIIDRLLGGPGEIYEA--DRDYTDIEMQLLRQVVQTVCRLVGD 166

Query: 149 CISTTQESSPNLEDFYDIDYLKKNTNRLS-NEFVTTINMNMTIENVASSFVLIIPQETL- 206
                    P   DF  ++   + +  +S NE V  + +++ I +V  +    IP   L 
Sbjct: 167 AWENVYALQP---DFVRLENNSRQSQLVSPNETVVIVMLDVEIRDVVGNISFCIPYVILE 223

Query: 207 -----LKTTLISLSSQNKSENQS---EDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVT 258
                L T      S++K+ ++    E+L+    RK  Q+ + +   +   + TL + + 
Sbjct: 224 PVLEHLNTRYWFTESRSKTGDEQASRENLL----RKVRQIPIELRAVLGTARITLHEALQ 279

Query: 259 LKIGQVIPF-LHREKTCAILSANGKE-IYSCELGRVGKNYTIRITDRINFD 307
           L++G V+P   H ++  A+ S  GKE  +   LG    N  IR+ DRI  +
Sbjct: 280 LQVGDVVPLDQHLDEKAAVYS--GKEKWFEGTLGTWHNNRAIRV-DRIMLE 327


>gi|319406968|emb|CBI80605.1| Flagellar motor switch protein FliM [Bartonella sp. 1-1C]
          Length = 322

 Score = 47.4 bits (111), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 36/63 (57%)

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           V I+  I     TL ++ TLK+GQ++P          L +  K +Y C LG++G +++IR
Sbjct: 245 VRIEAFIQQGSMTLNELSTLKVGQILPLPANAAKQIRLRSGNKSLYKCSLGKIGTSFSIR 304

Query: 300 ITD 302
           +T+
Sbjct: 305 VTN 307


>gi|311030119|ref|ZP_07708209.1| flagellar motor switch protein FliM [Bacillus sp. m3-13]
          Length = 332

 Score = 47.4 bits (111), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 52/271 (19%), Positives = 109/271 (40%), Gaps = 17/271 (6%)

Query: 42  YKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSN 101
           + + L   F  ++   + IS  S     +   I S  +  + +   ++       +  + 
Sbjct: 63  FARLLTTYFSAQLRTYIQISVASVDQLPYEEFIRSIPKMTILNVFEVAPLEGRVVLEINP 122

Query: 102 NLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLE 161
            +   +L+  LG     + ++   SL+ +E KL             +   T  +  P L 
Sbjct: 123 TIAYAMLDRQLGGKGTGVNKV--DSLTEIETKLMTTLFEGAIENFGEAWDTIADIQPFLS 180

Query: 162 DFYDIDYLKKNTNRLS----NEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS- 216
           D      L+ N   L     NE V  I+MN+TI  V     + IP   +L+  +  LS+ 
Sbjct: 181 D------LEVNPQFLQLVSPNETVIVISMNITIGEVTGMINICIPH-VVLEPVIPKLSAH 233

Query: 217 ---QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKT 273
              + K++ + +  I    +      + + T +   + +  D++ + IG V+P   +   
Sbjct: 234 YWMEEKNKVRQDHEIATLEKAIRATALTVTTELGHSEISFSDLLNITIGDVLPLQQKIDE 293

Query: 274 CAILSANGKEIYSCELGRVGKNYTIRITDRI 304
             I+  + K  +  ++G+V KN  ++I ++I
Sbjct: 294 PIIVKVDNKPSFYGQVGQVKKNMAVQILEKI 324


>gi|319403952|emb|CBI77540.1| Flagellar motor switch protein FliM [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 322

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 36/63 (57%)

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           V I+  I     TL ++ TLK+GQ++P          L +  K +Y C LG++G +++IR
Sbjct: 245 VRIEAFIQQGSMTLNELSTLKVGQILPLPANAAKQIRLRSGNKSLYKCSLGKIGTSFSIR 304

Query: 300 ITD 302
           +T+
Sbjct: 305 VTN 307


>gi|90423020|ref|YP_531390.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           BisB18]
 gi|90105034|gb|ABD87071.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           BisB18]
          Length = 404

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 50/261 (19%), Positives = 105/261 (40%), Gaps = 26/261 (9%)

Query: 57  DVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASH 116
           +V++S     S +FS  + S     V S      W +       + L+ ++++ LLG   
Sbjct: 134 NVEVSLDRITSVRFSDYMSSIPLPAVLSVFKAEEWENFGLATVDSALIYSMIDVLLGGRR 193

Query: 117 -ETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN- 174
            +   ++  R  +T+E  L KR +  + A   Q        +      + ID L+ N   
Sbjct: 194 GQASMRVEGRPYTTIETNLVKRLVEVVLADAEQAFRPLSPVT------FKIDRLETNPRF 247

Query: 175 ----RLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLI 228
               R +N  +  + +++ +E+   +  L++P  T+  ++  L+ +    K         
Sbjct: 248 AAITRPANAAIL-VRLHIDMEDRGGNIELLLPYATIEPIRAVLMQMFMGEKFGR------ 300

Query: 229 DP-----FARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKE 283
           DP      + +  Q  +++D  +   +  LK ++ LK+G  +P   R      +      
Sbjct: 301 DPIWEGHLSTEIAQAEISVDAVLYEAEIPLKQLMRLKVGDTLPLELRADALVAVRCGNVT 360

Query: 284 IYSCELGRVGKNYTIRITDRI 304
           +    +GRV     IR+T ++
Sbjct: 361 LTEGRMGRVADRVAIRVTKQL 381


>gi|332531130|ref|ZP_08407044.1| flagellar motor switch protein FliM [Hylemonella gracilis ATCC
           19624]
 gi|332039415|gb|EGI75827.1| flagellar motor switch protein FliM [Hylemonella gracilis ATCC
           19624]
          Length = 331

 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/246 (19%), Positives = 101/246 (41%), Gaps = 11/246 (4%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           +IS    Q  ++S  +        F+  ++     N  I C  +L+  +++ L G   + 
Sbjct: 78  EISVGPVQVQRYSAFLRELAVPTSFNIMAVRPLRGNGMIVCEPSLIFGVIDTLYGGIGKF 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLS- 177
             ++  R  S  E+++  R +  IS    +           LE  Y    ++     ++ 
Sbjct: 138 QSRIEGRDFSATEQRIINRLVDVISDEYKKAWRGIYP----LELEYQRSEMQPQFANIAT 193

Query: 178 -NEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLIDPFARK 234
            +E V + +  + I  ++ +    IP  TL  ++  L S S+Q  S       ++   R+
Sbjct: 194 PSEIVVSSSFQLEIGEMSGTIHFCIPYATLEPIRDVLYS-STQGDSMEVDRRWVNVLTRE 252

Query: 235 TYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGK 294
               +V +   +    TT+++++ +K+G  I    + +  A +S  G  ++ C+ G    
Sbjct: 253 IQAADVTLVAELARANTTVEELLAMKVGDFIELERQPRIEATIS--GVPVFECQYGTHNA 310

Query: 295 NYTIRI 300
            Y IRI
Sbjct: 311 KYAIRI 316


>gi|157376191|ref|YP_001474791.1| flagellar motor switch protein FliM [Shewanella sediminis HAW-EB3]
 gi|157318565|gb|ABV37663.1| flagellar motor switch protein FliM [Shewanella sediminis HAW-EB3]
          Length = 341

 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 53/254 (20%), Positives = 99/254 (38%), Gaps = 19/254 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S    Q  KF   +H+       +    S       I     LV  L++N  G     
Sbjct: 74  EVSINGVQMLKFGEYVHTLFVPTSLNMVRFSPLKGTALITMEARLVFILVDNFFGGDGRF 133

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E+++       +  +L       +++   + D  + DYL    N  ++
Sbjct: 134 HAKIEGREFTPTERRI-------VQLLLKIIFEDYKDAWAPVMDV-EFDYLDSEVNPAMA 185

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFA 232
           N     E V   + ++ ++     F + +P  ++++     L +  +S+ Q  D+    A
Sbjct: 186 NIVSPTEVVVVSSFHIEVDGGGGDFHITMPY-SMIEPIRELLDAGVQSDTQDTDMRWSQA 244

Query: 233 RK--TYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
            K     ++V ID  I   + TLKDV+  K G VI     E    ++       Y C+LG
Sbjct: 245 LKDEIMDVDVGIDATIVEHQVTLKDVMEFKQGDVITVELPEHI--VMRVEDLPTYRCKLG 302

Query: 291 RVGKNYTIRITDRI 304
               N  +RI + I
Sbjct: 303 TARDNLALRICETI 316


>gi|217972623|ref|YP_002357374.1| flagellar motor switch protein FliM [Shewanella baltica OS223]
 gi|217497758|gb|ACK45951.1| flagellar motor switch protein FliM [Shewanella baltica OS223]
          Length = 342

 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 49/254 (19%), Positives = 99/254 (38%), Gaps = 19/254 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S    Q  KF   +H+       +    S       I     LV  L++N  G     
Sbjct: 75  EVSINGVQMLKFGEYVHTLFVPTSLNMVRFSPLKGTALITMEARLVFILVDNFFGGDGRF 134

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E+++       +  +L       +++   + D  + DYL    N  ++
Sbjct: 135 HAKIEGREFTPTERRI-------VQLLLKIIFEDYKDAWAPVMDV-EFDYLDSEVNPAMA 186

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDL--IDP 230
           N     E V   + ++ ++     F + +P  ++++     L +  +S+ Q  D+     
Sbjct: 187 NIVSPTEVVVINSFHIEVDGGGGDFHITMPY-SMIEPIRELLDAGVQSDKQDTDMRWSQA 245

Query: 231 FARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
              +   + V  D  I   + TLKDV+  K G +IP    E    ++       Y C++G
Sbjct: 246 LHDEIMDVKVGFDANIVEHELTLKDVMNFKAGDIIPIELPE--YIMMKIEDLPTYRCKMG 303

Query: 291 RVGKNYTIRITDRI 304
           R   N  ++I ++I
Sbjct: 304 RSRDNLALKIHEKI 317


>gi|126175121|ref|YP_001051270.1| flagellar motor switch protein FliM [Shewanella baltica OS155]
 gi|153001445|ref|YP_001367126.1| flagellar motor switch protein FliM [Shewanella baltica OS185]
 gi|304409952|ref|ZP_07391571.1| flagellar motor switch protein FliM [Shewanella baltica OS183]
 gi|307302335|ref|ZP_07582093.1| flagellar motor switch protein FliM [Shewanella baltica BA175]
 gi|125998326|gb|ABN62401.1| flagellar motor switch protein FliM [Shewanella baltica OS155]
 gi|151366063|gb|ABS09063.1| flagellar motor switch protein FliM [Shewanella baltica OS185]
 gi|304351361|gb|EFM15760.1| flagellar motor switch protein FliM [Shewanella baltica OS183]
 gi|306914373|gb|EFN44794.1| flagellar motor switch protein FliM [Shewanella baltica BA175]
          Length = 342

 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 49/254 (19%), Positives = 99/254 (38%), Gaps = 19/254 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S    Q  KF   +H+       +    S       I     LV  L++N  G     
Sbjct: 75  EVSINGVQMLKFGEYVHTLFVPTSLNMVRFSPLKGTALITMEARLVFILVDNFFGGDGRF 134

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E+++       +  +L       +++   + D  + DYL    N  ++
Sbjct: 135 HAKIEGREFTPTERRI-------VQLLLKIIFEDYKDAWAPVMDV-EFDYLDSEVNPAMA 186

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDL--IDP 230
           N     E V   + ++ ++     F + +P  ++++     L +  +S+ Q  D+     
Sbjct: 187 NIVSPTEVVVINSFHIEVDGGGGDFHITMPY-SMIEPIRELLDAGVQSDKQDTDMRWSQA 245

Query: 231 FARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
              +   + V  D  I   + TLKDV+  K G +IP    E    ++       Y C++G
Sbjct: 246 LHDEIMDVKVGFDANIVEHELTLKDVMNFKAGDIIPIELPE--YIMMKIEDLPTYRCKMG 303

Query: 291 RVGKNYTIRITDRI 304
           R   N  ++I ++I
Sbjct: 304 RSRDNLALKIYEKI 317


>gi|160876170|ref|YP_001555486.1| flagellar motor switch protein FliM [Shewanella baltica OS195]
 gi|160861692|gb|ABX50226.1| flagellar motor switch protein FliM [Shewanella baltica OS195]
 gi|315268366|gb|ADT95219.1| flagellar motor switch protein FliM [Shewanella baltica OS678]
          Length = 342

 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 49/254 (19%), Positives = 99/254 (38%), Gaps = 19/254 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S    Q  KF   +H+       +    S       I     LV  L++N  G     
Sbjct: 75  EVSINGVQMLKFGEYVHTLFVPTSLNMVRFSPLKGTALITMEARLVFILVDNFFGGDGRF 134

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E+++       +  +L       +++   + D  + DYL    N  ++
Sbjct: 135 HAKIEGREFTPTERRI-------VQLLLKIIFEDYKDAWAPVMDV-EFDYLDSEVNPAMA 186

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDL--IDP 230
           N     E V   + ++ ++     F + +P  ++++     L +  +S+ Q  D+     
Sbjct: 187 NIVSPTEVVVINSFHIEVDGGGGDFHITMPY-SMIEPIRELLDAGVQSDKQDTDMRWSQA 245

Query: 231 FARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
              +   + V  D  I   + TLKDV+  K G +IP    E    ++       Y C++G
Sbjct: 246 LHDEIMDVKVGFDANIVEHELTLKDVMNFKAGDIIPIELPE--YIMMKIEDLPTYRCKMG 303

Query: 291 RVGKNYTIRITDRI 304
           R   N  ++I ++I
Sbjct: 304 RSRDNLALKIHEKI 317


>gi|299131782|ref|ZP_07024977.1| flagellar motor switch protein FliM [Afipia sp. 1NLS2]
 gi|298591919|gb|EFI52119.1| flagellar motor switch protein FliM [Afipia sp. 1NLS2]
          Length = 399

 Score = 46.6 bits (109), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 49/257 (19%), Positives = 105/257 (40%), Gaps = 26/257 (10%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASH- 116
           V++S     S +F+  ++S     V +      W +       ++L+ ++++ LLG    
Sbjct: 130 VEVSLDRITSVRFADYLNSIPLPCVLTVFKAEEWENFGLFTVDSSLIYSMIDVLLGGRRG 189

Query: 117 ETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNT--- 173
           +T  ++  R  +T+E  L KR +  + A   Q        +      + ID L+ N    
Sbjct: 190 QTSLRIEGRPYTTIETNLVKRLVEVVLADAEQAFRPLSPVT------FTIDRLETNPRFA 243

Query: 174 --NRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLID 229
             +R +N  +  + + + +E+   +  L++P  T+  ++  L+ +    K         D
Sbjct: 244 AISRPANAAIL-VRLRVDMEDRGGNVELLLPYATIEPIRNVLLQMFMGEKFGR------D 296

Query: 230 P-----FARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEI 284
           P      A +  +  + +D  +      LK +++LK+G  +P   R      +      +
Sbjct: 297 PIWEGHLATEIAKAEMYVDAVLYEADMPLKQLMSLKVGDTLPLDIRPDAMVSVRCGDVTL 356

Query: 285 YSCELGRVGKNYTIRIT 301
               +GRVG    IR++
Sbjct: 357 SEGRMGRVGDRVAIRVS 373


>gi|319405393|emb|CBI79012.1| Flagellar motor switch protein FliM [Bartonella sp. AR 15-3]
          Length = 322

 Score = 46.2 bits (108), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 37/63 (58%)

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           V+I+  I     TL ++ TLK+GQ++P          L +  K +Y C LG++G +++IR
Sbjct: 245 VHIEAFIQQGSMTLNELSTLKVGQILPLPANAVKKIKLRSGNKSLYKCSLGKIGTSFSIR 304

Query: 300 ITD 302
           +T+
Sbjct: 305 VTN 307


>gi|323139660|ref|ZP_08074702.1| surface presentation of antigens (SPOA) protein [Methylocystis sp.
           ATCC 49242]
 gi|322395092|gb|EFX97651.1| surface presentation of antigens (SPOA) protein [Methylocystis sp.
           ATCC 49242]
          Length = 314

 Score = 45.8 bits (107), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 49/97 (50%), Gaps = 4/97 (4%)

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           + E  SE+L D   R    +NV I+ R      TL+D+  L++G V+       +   + 
Sbjct: 220 RDERWSENLYDNIVRTEVAVNVKIEAR----GFTLEDIANLEVGDVLGLPIAPTSPIRIE 275

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFL 315
           + G+ ++ C LG+   +YT+R+ D  +  Q  ++N L
Sbjct: 276 SEGRTLFWCTLGQKDGHYTVRLEDFSDERQSFIENIL 312


>gi|319898628|ref|YP_004158721.1| flagellar motor switch protein FliM [Bartonella clarridgeiae 73]
 gi|319402592|emb|CBI76137.1| Flagellar motor switch protein FliM [Bartonella clarridgeiae 73]
          Length = 322

 Score = 45.8 bits (107), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 39/64 (60%), Gaps = 2/64 (3%)

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPF-LHREKTCAILSANGKEIYSCELGRVGKNYTI 298
           V I+  I     TL ++  LK+GQV+P   + EK   + S N K +Y C LG++G +++I
Sbjct: 245 VRIEAFIQQGSMTLNELSILKVGQVLPLPANAEKQIRLRSGN-KSLYKCSLGKIGTSFSI 303

Query: 299 RITD 302
           R+T+
Sbjct: 304 RVTN 307


>gi|154253006|ref|YP_001413830.1| flagellar motor switch protein FliM [Parvibaculum lavamentivorans
           DS-1]
 gi|154156956|gb|ABS64173.1| flagellar motor switch protein FliM [Parvibaculum lavamentivorans
           DS-1]
          Length = 374

 Score = 45.8 bits (107), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 53/259 (20%), Positives = 111/259 (42%), Gaps = 22/259 (8%)

Query: 57  DVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASH 116
           +V++S  +  S +F   ++S     + +      W +       +NL+ ++++ LLG   
Sbjct: 92  NVEVSLDNVSSIRFGDYLNSIPLPAILAVFRAKQWDNYGMFTVDSNLIYSIVDVLLGGRR 151

Query: 117 ETIP-QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSP-NLEDFYDIDYLKKNTN 174
            T   ++  R  +T+E  L +R    I  VL    S  +  SP  LE    +D ++ N  
Sbjct: 152 GTAAMRIEGRPYTTIELNLVQR---MIEVVLQDVQSAFEPLSPVTLE----LDRMETNPR 204

Query: 175 ----RLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLI 228
                        + + + +E+      L++P  TL  ++  L+ +      E    D I
Sbjct: 205 FAAIARPANAAILVKLRVDMEDRGGRIELLLPYATLEPIRELLLQMF---MGEKFGRDTI 261

Query: 229 --DPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAI-LSANGKEIY 285
                A + +   V ++  ++ ++ +L++V+  ++GQ +  L+     AI L   G  + 
Sbjct: 262 WESHLATELWATKVPLEAVLDEQQLSLREVMDFRVGQTL-MLNSGPEGAIDLRCGGVRLG 320

Query: 286 SCELGRVGKNYTIRITDRI 304
             ++GRVG +  +R+   I
Sbjct: 321 KGKMGRVGNHVAVRVEQAI 339


>gi|83594172|ref|YP_427924.1| flagellar motor switch protein FliM [Rhodospirillum rubrum ATCC
           11170]
 gi|83577086|gb|ABC23637.1| flagellar motor switch protein FliM [Rhodospirillum rubrum ATCC
           11170]
          Length = 384

 Score = 45.8 bits (107), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 50/261 (19%), Positives = 111/261 (42%), Gaps = 26/261 (9%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
           V++S  + QS +F   ++S     + S      W +   +   ++++ ++++ LLG    
Sbjct: 133 VEVSLDNIQSYRFGDYLNSIPLPAMLSVFKAEEWDNYGLLTIDSSMIYSIVDVLLGGRRG 192

Query: 118 TIP-QLYNRSLSTVEKKLAKR----TIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKN 172
           T   ++  R  +T+E+ L +R     +A +SA  +     T          +  D L+ N
Sbjct: 193 TAAMRIEGRPYTTIERNLVERLVHVVLADLSAAFDPLSPVT----------FRFDRLETN 242

Query: 173 T-----NRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSE 225
                 +R SN  +    + + +E+      ++IP  TL  ++  L+ +    K    S 
Sbjct: 243 PRFATISRPSNAAIVA-KLRIDMEDRGGRLDMLIPYATLEPVRELLLQMFMGEKFGRDS- 300

Query: 226 DLIDP-FARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEI 284
            + +   A + +   V +D  ++     L  ++++++G  I F     +   L      +
Sbjct: 301 -IWETHLAEEMWSTEVQMDAILDEVYMPLNKILSMEVGSQILFNATPDSTVQLRCGDVPM 359

Query: 285 YSCELGRVGKNYTIRITDRIN 305
           +  ++GR G+N  IR+  + N
Sbjct: 360 FDGKMGRKGQNIAIRVDSKHN 380


>gi|331006682|ref|ZP_08329960.1| Flagellar motor switch protein FliM [gamma proteobacterium
           IMCC1989]
 gi|330419514|gb|EGG93902.1| Flagellar motor switch protein FliM [gamma proteobacterium
           IMCC1989]
          Length = 340

 Score = 45.4 bits (106), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 53/108 (49%), Gaps = 7/108 (6%)

Query: 197 FVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDV 256
           + +I P   +L   L     Q+ S+ + +  ++       Q NV +DT     K  LKD+
Sbjct: 217 YSMIEPIREMLDAGL-----QSDSDERDDRWVNSLREDIMQANVRLDTNFVQSKILLKDI 271

Query: 257 VTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
           V LK G VIP    E+   I +ANG  ++  ++G+   N+ +++ + I
Sbjct: 272 VDLKEGDVIPIELPEEY--ITNANGVPMFKVDIGQSNGNFALKVNEVI 317


>gi|89094448|ref|ZP_01167388.1| flagellar motor switch protein [Oceanospirillum sp. MED92]
 gi|89081340|gb|EAR60572.1| flagellar motor switch protein [Oceanospirillum sp. MED92]
          Length = 325

 Score = 45.4 bits (106), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 50/254 (19%), Positives = 99/254 (38%), Gaps = 20/254 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           D++    Q  K+   IH+       +   ++             LV  L++N  G     
Sbjct: 80  DVTVGGVQVMKYGDYIHTLYVPTSMNLIRVNPLRGTALFIMDAKLVFKLVDNFFGGDGRH 139

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E +L  + + Q    L +  +  +E S         D+L    N  ++
Sbjct: 140 A-KIEGREFTPTETRLIHKALEQFFLDLEEAWNPVKELS--------FDHLGHEMNPAMA 190

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLIDP 230
           N     E V      + +E  +  F + +P   L  ++  L+S   Q+  + + E     
Sbjct: 191 NVINPTEVVVVSTFQVDLEGGSGEFHVAMPYSMLEPIRDLLVS-GFQSGEDEKDERWQVA 249

Query: 231 FARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
             R      + ++  +  ++ TL+DVV L+ G +IP    E     L AN   +Y+C +G
Sbjct: 250 LQRDILMAGLPLEMTLAQQEMTLRDVVDLQAGDIIPIELPETFE--LKANKVPVYNCTMG 307

Query: 291 RVGKNYTIRITDRI 304
               N  +++ ++I
Sbjct: 308 VSRGNLAVKVVNQI 321


>gi|260772330|ref|ZP_05881246.1| flagellar motor switch protein FliM [Vibrio metschnikovii CIP
           69.14]
 gi|260611469|gb|EEX36672.1| flagellar motor switch protein FliM [Vibrio metschnikovii CIP
           69.14]
          Length = 281

 Score = 45.4 bits (106), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 44/211 (20%), Positives = 96/211 (45%), Gaps = 21/211 (9%)

Query: 103 LVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQES-SPNLE 161
           LV  L+EN  G       ++  R  +  E+++       I  +L    +  +E+ SP + 
Sbjct: 51  LVFILVENFFGGDGRYHARIEGREFTPTERRV-------IQLLLKIVFADYKEAWSPVMG 103

Query: 162 DFYDIDYLKKNTN-RLSN-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLS 215
              + +YL    N  ++N     E +   + ++ ++     F +++P  ++++     L 
Sbjct: 104 --VEFEYLDSEVNPSMANIVSPTEVIVVCSFHIEVDGGGGDFHMVMPY-SMVEPIRELLD 160

Query: 216 SQNKSENQSEDLIDPFARKTYQLNVNIDTRINL--KKTTLKDVVTLKIGQVIPFLHREKT 273
           +  +S+    D+    A +   ++V I+ R+NL  +   L+D++ L++G +IP    E  
Sbjct: 161 AGVQSDKMETDVRWSSALRDEIMDVPINFRVNLLEQDIALRDLMDLQVGDIIPIKMPEH- 219

Query: 274 CAILSANGKEIYSCELGRVGKNYTIRITDRI 304
            AI+       Y  ++GR G    ++I+ +I
Sbjct: 220 -AIMFVEELPTYRVKMGRSGDKLAVQISQKI 249


>gi|307546956|ref|YP_003899435.1| flagellar motor switch protein FliM [Halomonas elongata DSM 2581]
 gi|307218980|emb|CBV44250.1| flagellar motor switch protein FliM [Halomonas elongata DSM 2581]
          Length = 347

 Score = 45.4 bits (106), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 46/208 (22%), Positives = 85/208 (40%), Gaps = 20/208 (9%)

Query: 102 NLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLE 161
           NLV  +++NL G     + +   R  +  E+++ +R +     +  +  S +  S   LE
Sbjct: 121 NLVFMVVDNLFGGDGRFLTKSEGREFTNTEQRIIQRMLR----LAIEAYSDSWRSVYPLE 176

Query: 162 DFYDIDYLK-------KNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLI 212
               I +L+        N     NE V   N N+ + N+ASSF + +P   +  L+  LI
Sbjct: 177 ----ISFLRSEMQAKFANITNSPNEIVVNTNFNLEVGNLASSFQICMPYSMIEPLRDLLI 232

Query: 213 SLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREK 272
           +  S +  ++Q        A +     V +        + + DV  L++G ++P    E 
Sbjct: 233 NPLS-DGHQDQDSTWTRRMAGEIRHSTVELVADFADLPSRIADVTALEVGDILPLELPET 291

Query: 273 TCAILSANGKEIYSCELGRVGKNYTIRI 300
             A    +G  +  CE G       +R+
Sbjct: 292 VTA--KVDGVPVMECEYGSQHGQRALRV 317


>gi|262404472|ref|ZP_06081027.1| flagellar motor switch protein FliM [Vibrio sp. RC586]
 gi|262349504|gb|EEY98642.1| flagellar motor switch protein FliM [Vibrio sp. RC586]
          Length = 349

 Score = 45.4 bits (106), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 42/211 (19%), Positives = 98/211 (46%), Gaps = 21/211 (9%)

Query: 103 LVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQES-SPNLE 161
           LV  L+EN  G       ++  R  +  E+++       I  +L    +  +E+ SP + 
Sbjct: 121 LVFILVENFFGGDGRYHARIEGREFTPTERRV-------IQLLLKIVFADYKEAWSPVMG 173

Query: 162 DFYDIDYLKKNTN-RLSN-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLS 215
              + +YL    N  ++N     E +   + ++ ++     F +++P  ++++     L 
Sbjct: 174 --VEFEYLDSEVNPSMANIVSPTEVIVVSSFHVEVDGGGGDFHMVMPY-SMMEPIRELLD 230

Query: 216 SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT--TLKDVVTLKIGQVIPFLHREKT 273
           +  +S+    D+    A +   ++V ++ R+NL +    L+D++ L++G VIP    E  
Sbjct: 231 AGVQSDKMETDVRWSTALREEIMDVPVNFRVNLLEMDIALRDLMELQVGDVIPIKMPEH- 289

Query: 274 CAILSANGKEIYSCELGRVGKNYTIRITDRI 304
            A++       Y  ++GR G+   ++++++I
Sbjct: 290 -AVMFVEELPTYRVKMGRSGEKLAVQVSEKI 319


>gi|120598257|ref|YP_962831.1| flagellar motor switch protein FliM [Shewanella sp. W3-18-1]
 gi|146293665|ref|YP_001184089.1| flagellar motor switch protein FliM [Shewanella putrefaciens CN-32]
 gi|120558350|gb|ABM24277.1| flagellar motor switch protein FliM [Shewanella sp. W3-18-1]
 gi|145565355|gb|ABP76290.1| flagellar motor switch protein FliM [Shewanella putrefaciens CN-32]
 gi|319427064|gb|ADV55138.1| flagellar motor switch protein FliM [Shewanella putrefaciens 200]
          Length = 343

 Score = 45.1 bits (105), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 48/254 (18%), Positives = 99/254 (38%), Gaps = 19/254 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S    Q  KF   +H+       +    S       I     LV  L++N  G     
Sbjct: 76  EVSINGVQMLKFGEYVHTLFVPTSLNMVRFSPLKGTALITMEARLVFILVDNFFGGDGRF 135

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E+++       +  +L       +++   + D  + DYL    N  ++
Sbjct: 136 HAKIEGREFTPTERRI-------VQLLLKIIFEDYKDAWAPVMDV-EFDYLDSEVNPAMA 187

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDL--IDP 230
           N     E V   + ++ ++     F + +P  ++++     L +  +S+ Q  D+     
Sbjct: 188 NIVSPTEVVVINSFHIEVDGGGGDFHITMPY-SMIEPIRELLDAGVQSDKQDTDMRWSQA 246

Query: 231 FARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
              +   + V  D  +   + TLKDV+  K G +IP    E    ++       Y C++G
Sbjct: 247 LHDEIMDVKVGFDACVVEHELTLKDVMNFKAGDIIPVELPEYI--MMKIEDLPTYRCKMG 304

Query: 291 RVGKNYTIRITDRI 304
           R   N  ++I ++I
Sbjct: 305 RSRDNLALKIYEKI 318


>gi|258621111|ref|ZP_05716145.1| flagellar motor switch protein [Vibrio mimicus VM573]
 gi|262170887|ref|ZP_06038565.1| flagellar motor switch protein FliM [Vibrio mimicus MB-451]
 gi|258586499|gb|EEW11214.1| flagellar motor switch protein [Vibrio mimicus VM573]
 gi|261891963|gb|EEY37949.1| flagellar motor switch protein FliM [Vibrio mimicus MB-451]
          Length = 349

 Score = 45.1 bits (105), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 42/211 (19%), Positives = 98/211 (46%), Gaps = 21/211 (9%)

Query: 103 LVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQES-SPNLE 161
           LV  L+EN  G       ++  R  +  E+++       I  +L    +  +E+ SP + 
Sbjct: 121 LVFILVENFFGGDGRYHARIEGREFTPTERRV-------IQLLLKIVFADYKEAWSPVMG 173

Query: 162 DFYDIDYLKKNTN-RLSN-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLS 215
              + +YL    N  ++N     E +   + ++ ++     F +++P  ++++     L 
Sbjct: 174 --VEFEYLDSEVNPSMANIVSPTEVIVVSSFHVEVDGGGGDFHMVMPY-SMMEPIRELLD 230

Query: 216 SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT--TLKDVVTLKIGQVIPFLHREKT 273
           +  +S+    D+    A +   ++V ++ R+NL +    L+D++ L++G VIP    E  
Sbjct: 231 AGVQSDKMETDVRWSTALREEIMDVPVNFRVNLLEMDIALRDLMELQVGDVIPIKMPEH- 289

Query: 274 CAILSANGKEIYSCELGRVGKNYTIRITDRI 304
            A++       Y  ++GR G+   ++++++I
Sbjct: 290 -AVMFVEELPTYRVKMGRSGEKLAVQVSEKI 319


>gi|258626185|ref|ZP_05721033.1| flagellar motor switch protein [Vibrio mimicus VM603]
 gi|258581540|gb|EEW06441.1| flagellar motor switch protein [Vibrio mimicus VM603]
          Length = 349

 Score = 45.1 bits (105), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 42/211 (19%), Positives = 98/211 (46%), Gaps = 21/211 (9%)

Query: 103 LVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQES-SPNLE 161
           LV  L+EN  G       ++  R  +  E+++       I  +L    +  +E+ SP + 
Sbjct: 121 LVFILVENFFGGDGRYHARIEGREFTPTERRV-------IQLLLKIVFADYKEAWSPVMG 173

Query: 162 DFYDIDYLKKNTN-RLSN-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLS 215
              + +YL    N  ++N     E +   + ++ ++     F +++P  ++++     L 
Sbjct: 174 --VEFEYLDSEVNPSMANIVSPTEVIVVSSFHVEVDGGGGDFHMVMPY-SMMEPIRELLD 230

Query: 216 SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT--TLKDVVTLKIGQVIPFLHREKT 273
           +  +S+    D+    A +   ++V ++ R+NL +    L+D++ L++G VIP    E  
Sbjct: 231 AGVQSDKMETDVRWSTALREEIMDVPVNFRVNLLEMDIALRDLMELQVGDVIPIKMPEH- 289

Query: 274 CAILSANGKEIYSCELGRVGKNYTIRITDRI 304
            A++       Y  ++GR G+   ++++++I
Sbjct: 290 -AVMFVEELPTYRVKMGRSGEKLAVQVSEKI 319


>gi|23007978|ref|ZP_00049614.1| COG1868: Flagellar motor switch protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 269

 Score = 45.1 bits (105), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 36/166 (21%), Positives = 64/166 (38%), Gaps = 3/166 (1%)

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S     SG+F   + ++  N V        W  +  +G   + + T++E L G+     P
Sbjct: 82  SLNGIASGRFGEFLDAYDANAVVGIFHAPEWDGHILVGLDRDFLYTMVEVLFGSDGSEPP 141

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
               R+ S +E ++A+    Q+   L        ++   LE   +         R SN+ 
Sbjct: 142 VEDERNFSAIELRIAQMVFEQVGKALESSFGLVSQTPFRLERM-ETRMEFAVIGRRSNKA 200

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSED 226
           V    +   + N      L+IPQ T+L     +LS     E+ + D
Sbjct: 201 VQAKFLLQAL-NRGGEMFLVIPQ-TVLNPLRPALSKVLTGESAARD 244


>gi|134095084|ref|YP_001100159.1| flagellar motor switch protein FliM [Herminiimonas arsenicoxydans]
 gi|55977142|gb|AAV68363.1| FliM [Herminiimonas arsenicoxydans]
 gi|133738987|emb|CAL62035.1| Flagellar motor switch protein FliM [Herminiimonas arsenicoxydans]
          Length = 332

 Score = 45.1 bits (105), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 41/206 (19%), Positives = 83/206 (40%), Gaps = 17/206 (8%)

Query: 102 NLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLE 161
           NLV  L++NL G       ++  R  +  E+++ +R    I  ++ +  + + E    +E
Sbjct: 120 NLVFLLVDNLFGGDGRFHTRVEGRDFTQTEQRIIQR----ILGIIFETYAKSWEPVYPVE 175

Query: 162 DFYDIDYLKKNTN------RLSNEFVTTINMNMTIENVASSFVLIIPQETLLKT-TLISL 214
                +Y++   N         NE V      + +  V+      +P   +     L++ 
Sbjct: 176 ----FEYIRSEMNTQFANIATPNEVVVATTFTIELGPVSGDLHFCVPYSMIEPIRDLLTS 231

Query: 215 SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTC 274
           S Q ++    +  I    ++     V I   +   K TL D++ +KIG +I     E+  
Sbjct: 232 SMQGETLEMDKRWIRLMTQQIQTAEVEILANMGSAKVTLGDILNMKIGDIISIAVPEQVT 291

Query: 275 AILSANGKEIYSCELGRVGKNYTIRI 300
           A    +G  +  C  G++   Y +R+
Sbjct: 292 A--EVDGVPVMECSYGKLNGQYALRV 315


>gi|229522079|ref|ZP_04411496.1| flagellar motor switch protein FliM [Vibrio cholerae TM 11079-80]
 gi|229341004|gb|EEO06009.1| flagellar motor switch protein FliM [Vibrio cholerae TM 11079-80]
          Length = 349

 Score = 44.7 bits (104), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 42/211 (19%), Positives = 98/211 (46%), Gaps = 21/211 (9%)

Query: 103 LVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQES-SPNLE 161
           LV  L+EN  G       ++  R  +  E+++       I  +L    +  +E+ SP + 
Sbjct: 121 LVFILVENFFGGDGRYHARIEGREFTPTERRV-------IQLLLKIVFADYKEAWSPVMG 173

Query: 162 DFYDIDYLKKNTN-RLSN-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLS 215
              + +YL    N  ++N     E +   + ++ ++     F +++P  ++++     L 
Sbjct: 174 --VEFEYLDSEVNPSMANIVSPTEVIVVSSFHVEVDGGGGDFHMVMPY-SMVEPIRELLD 230

Query: 216 SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT--TLKDVVTLKIGQVIPFLHREKT 273
           +  +S+    D+    A +   ++V ++ R+NL +    L+D++ L++G VIP    E  
Sbjct: 231 AGVQSDKMETDVRWSTALREEIMDVPVNFRVNLLEMDIALRDLMELQVGDVIPIKMPEH- 289

Query: 274 CAILSANGKEIYSCELGRVGKNYTIRITDRI 304
            A++       Y  ++GR G+   ++++++I
Sbjct: 290 -AVMFVEDLPTYRVKMGRSGEKLAVQVSEKI 319


>gi|120554904|ref|YP_959255.1| flagellar motor switch protein FliM [Marinobacter aquaeolei VT8]
 gi|120324753|gb|ABM19068.1| flagellar motor switch protein FliM [Marinobacter aquaeolei VT8]
          Length = 332

 Score = 44.7 bits (104), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 51/252 (20%), Positives = 96/252 (38%), Gaps = 18/252 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           D+S    Q  KF   IH+       +   +              LV  L++N  G     
Sbjct: 76  DVSTGGVQIMKFGEYIHTLYVPTSLNLCKVRPLRGTSLFVLDAKLVFKLVDNFFGGEGRH 135

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E ++       +  VLNQ     +E+   +    + +YL    N  ++
Sbjct: 136 -AKIEGREFTPTETRI-------VQMVLNQVFHDMKEAWHAVLQV-EFEYLSSEVNPAMA 186

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKT-TLISLSSQNKSENQSEDLIDPF 231
           N     E V     ++ ++         +P   +     ++    Q+  ++  E  ++  
Sbjct: 187 NIVSPSEVVVVSTFHIELDGGGGELHFALPYSMIEPIRDVLDAGVQSDIDDVDERWVNAL 246

Query: 232 ARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGR 291
                ++NV I+T +  ++ +L+D+  +K G VIP    E     ++ANG  IY   LG 
Sbjct: 247 QEDIKEVNVPINTTVCRRRISLRDIARMKAGDVIPVEIPEHLT--VTANGIPIYKATLGT 304

Query: 292 VGKNYTIRITDR 303
                 +RI DR
Sbjct: 305 RDGKLALRIHDR 316


>gi|15642125|ref|NP_231757.1| flagellar motor switch protein FliM [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121586821|ref|ZP_01676603.1| flagellar motor switch protein FliM [Vibrio cholerae 2740-80]
 gi|121727171|ref|ZP_01680338.1| flagellar motor switch protein FliM [Vibrio cholerae V52]
 gi|147675314|ref|YP_001217648.1| flagellar motor switch protein FliM [Vibrio cholerae O395]
 gi|153213269|ref|ZP_01948681.1| flagellar motor switch protein FliM [Vibrio cholerae 1587]
 gi|153803040|ref|ZP_01957626.1| flagellar motor switch protein FliM [Vibrio cholerae MZO-3]
 gi|153818973|ref|ZP_01971640.1| flagellar motor switch protein FliM [Vibrio cholerae NCTC 8457]
 gi|153822893|ref|ZP_01975560.1| flagellar motor switch protein FliM [Vibrio cholerae B33]
 gi|153825557|ref|ZP_01978224.1| flagellar motor switch protein FliM [Vibrio cholerae MZO-2]
 gi|153828607|ref|ZP_01981274.1| flagellar motor switch protein FliM [Vibrio cholerae 623-39]
 gi|227082251|ref|YP_002810802.1| flagellar motor switch protein FliM [Vibrio cholerae M66-2]
 gi|229507789|ref|ZP_04397294.1| flagellar motor switch protein FliM [Vibrio cholerae BX 330286]
 gi|229511974|ref|ZP_04401453.1| flagellar motor switch protein FliM [Vibrio cholerae B33]
 gi|229513777|ref|ZP_04403239.1| flagellar motor switch protein FliM [Vibrio cholerae TMA 21]
 gi|229519110|ref|ZP_04408553.1| flagellar motor switch protein FliM [Vibrio cholerae RC9]
 gi|229528862|ref|ZP_04418252.1| flagellar motor switch protein FliM [Vibrio cholerae 12129(1)]
 gi|229607334|ref|YP_002877982.1| flagellar motor switch protein FliM [Vibrio cholerae MJ-1236]
 gi|254226360|ref|ZP_04919949.1| flagellar motor switch protein FliM [Vibrio cholerae V51]
 gi|254291362|ref|ZP_04962155.1| flagellar motor switch protein FliM [Vibrio cholerae AM-19226]
 gi|254849211|ref|ZP_05238561.1| flagellar motor switch protein FliM [Vibrio cholerae MO10]
 gi|255745135|ref|ZP_05419084.1| flagellar motor switch protein FliM [Vibrio cholera CIRS 101]
 gi|262153475|ref|ZP_06028605.1| flagellar motor switch protein FliM [Vibrio cholerae INDRE 91/1]
 gi|262167485|ref|ZP_06035191.1| flagellar motor switch protein FliM [Vibrio cholerae RC27]
 gi|262191375|ref|ZP_06049565.1| flagellar motor switch protein FliM [Vibrio cholerae CT 5369-93]
 gi|298497852|ref|ZP_07007659.1| flagellar motor switch protein FliM [Vibrio cholerae MAK 757]
 gi|9656676|gb|AAF95271.1| flagellar motor switch protein FliM [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121548988|gb|EAX59027.1| flagellar motor switch protein FliM [Vibrio cholerae 2740-80]
 gi|121630416|gb|EAX62809.1| flagellar motor switch protein FliM [Vibrio cholerae V52]
 gi|124116069|gb|EAY34889.1| flagellar motor switch protein FliM [Vibrio cholerae 1587]
 gi|124121438|gb|EAY40181.1| flagellar motor switch protein FliM [Vibrio cholerae MZO-3]
 gi|125621110|gb|EAZ49455.1| flagellar motor switch protein FliM [Vibrio cholerae V51]
 gi|126510468|gb|EAZ73062.1| flagellar motor switch protein FliM [Vibrio cholerae NCTC 8457]
 gi|126519589|gb|EAZ76812.1| flagellar motor switch protein FliM [Vibrio cholerae B33]
 gi|146317197|gb|ABQ21736.1| flagellar motor switch protein FliM [Vibrio cholerae O395]
 gi|148875878|gb|EDL74013.1| flagellar motor switch protein FliM [Vibrio cholerae 623-39]
 gi|149740708|gb|EDM54807.1| flagellar motor switch protein FliM [Vibrio cholerae MZO-2]
 gi|150422692|gb|EDN14646.1| flagellar motor switch protein FliM [Vibrio cholerae AM-19226]
 gi|227010139|gb|ACP06351.1| flagellar motor switch protein FliM [Vibrio cholerae M66-2]
 gi|227014022|gb|ACP10232.1| flagellar motor switch protein FliM [Vibrio cholerae O395]
 gi|229332636|gb|EEN98122.1| flagellar motor switch protein FliM [Vibrio cholerae 12129(1)]
 gi|229343799|gb|EEO08774.1| flagellar motor switch protein FliM [Vibrio cholerae RC9]
 gi|229348958|gb|EEO13915.1| flagellar motor switch protein FliM [Vibrio cholerae TMA 21]
 gi|229351939|gb|EEO16880.1| flagellar motor switch protein FliM [Vibrio cholerae B33]
 gi|229355294|gb|EEO20215.1| flagellar motor switch protein FliM [Vibrio cholerae BX 330286]
 gi|229369989|gb|ACQ60412.1| flagellar motor switch protein FliM [Vibrio cholerae MJ-1236]
 gi|254844916|gb|EET23330.1| flagellar motor switch protein FliM [Vibrio cholerae MO10]
 gi|255736965|gb|EET92361.1| flagellar motor switch protein FliM [Vibrio cholera CIRS 101]
 gi|262024057|gb|EEY42752.1| flagellar motor switch protein FliM [Vibrio cholerae RC27]
 gi|262030712|gb|EEY49346.1| flagellar motor switch protein FliM [Vibrio cholerae INDRE 91/1]
 gi|262032750|gb|EEY51298.1| flagellar motor switch protein FliM [Vibrio cholerae CT 5369-93]
 gi|297542185|gb|EFH78235.1| flagellar motor switch protein FliM [Vibrio cholerae MAK 757]
 gi|327484654|gb|AEA79061.1| Flagellar motor switch protein FliM [Vibrio cholerae LMA3894-4]
          Length = 349

 Score = 44.7 bits (104), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 42/211 (19%), Positives = 98/211 (46%), Gaps = 21/211 (9%)

Query: 103 LVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQES-SPNLE 161
           LV  L+EN  G       ++  R  +  E+++       I  +L    +  +E+ SP + 
Sbjct: 121 LVFILVENFFGGDGRYHARIEGREFTPTERRV-------IQLLLKIVFADYKEAWSPVMG 173

Query: 162 DFYDIDYLKKNTN-RLSN-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLS 215
              + +YL    N  ++N     E +   + ++ ++     F +++P  ++++     L 
Sbjct: 174 --VEFEYLDSEVNPSMANIVSPTEVIVVSSFHVEVDGGGGDFHMVMPY-SMVEPIRELLD 230

Query: 216 SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT--TLKDVVTLKIGQVIPFLHREKT 273
           +  +S+    D+    A +   ++V ++ R+NL +    L+D++ L++G VIP    E  
Sbjct: 231 AGVQSDKMETDVRWSTALREEIMDVPVNFRVNLLEMDIALRDLMELQVGDVIPIKMPEH- 289

Query: 274 CAILSANGKEIYSCELGRVGKNYTIRITDRI 304
            A++       Y  ++GR G+   ++++++I
Sbjct: 290 -AVMFVEELPTYRVKMGRSGEKLAVQVSEKI 319


>gi|262166227|ref|ZP_06033964.1| flagellar motor switch protein FliM [Vibrio mimicus VM223]
 gi|262025943|gb|EEY44611.1| flagellar motor switch protein FliM [Vibrio mimicus VM223]
          Length = 300

 Score = 44.3 bits (103), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 46/255 (18%), Positives = 108/255 (42%), Gaps = 21/255 (8%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S    Q  KF    ++       +            +     LV  L+EN  G     
Sbjct: 28  EVSINGVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALVTMEARLVFILVENFFGGDGRY 87

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQES-SPNLEDFYDIDYLKKNTN-RL 176
             ++  R  +  E+++       I  +L    +  +E+ SP +    + +YL    N  +
Sbjct: 88  HARIEGREFTPTERRV-------IQLLLKIVFADYKEAWSPVMG--VEFEYLDSEVNPSM 138

Query: 177 SN-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPF 231
           +N     E +   + ++ ++     F +++P  ++++     L +  +S+    D+    
Sbjct: 139 ANIVSPTEVIVVSSFHVEVDGGGGDFHMVMPY-SMVEPIRELLDAGVQSDKMETDVRWST 197

Query: 232 ARKTYQLNVNIDTRINLKKT--TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCEL 289
           A +   ++V ++ R+NL +    L+D++ L++G VIP    E   A++       Y  ++
Sbjct: 198 ALREEIMDVPVNFRVNLLEMDIALRDLMELQVGDVIPIKMPEH--AVMFVEELPTYRVKM 255

Query: 290 GRVGKNYTIRITDRI 304
           GR G+   ++++++I
Sbjct: 256 GRSGEKLAVQVSEKI 270


>gi|261209862|ref|ZP_05924163.1| flagellar motor switch protein FliM [Vibrio sp. RC341]
 gi|260841048|gb|EEX67573.1| flagellar motor switch protein FliM [Vibrio sp. RC341]
          Length = 349

 Score = 44.3 bits (103), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 46/255 (18%), Positives = 108/255 (42%), Gaps = 21/255 (8%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S    Q  KF    ++       +            +     LV  L+EN  G     
Sbjct: 77  EVSINGVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALVTMEARLVFILVENFFGGDGRY 136

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQES-SPNLEDFYDIDYLKKNTN-RL 176
             ++  R  +  E+++       I  +L    +  +E+ SP +    + +YL    N  +
Sbjct: 137 HARIEGREFTPTERRV-------IQLLLKIVFADYKEAWSPVMG--VEFEYLDSEVNPSM 187

Query: 177 SN-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPF 231
           +N     E +   + ++ ++     F +++P  ++++     L +  +S+    D+    
Sbjct: 188 ANIVSPTEVIVVSSFHVEVDGGGGDFHMVMPY-SMVEPIRELLDAGVQSDKMETDVRWST 246

Query: 232 ARKTYQLNVNIDTRINLKKT--TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCEL 289
           A +   ++V ++ R+NL +    L+D++ L++G VIP    E   A++       Y  ++
Sbjct: 247 ALREEIMDVPVNFRVNLLEMDIALRDLMELQVGDVIPIKMPEH--AVMFVEELPTYRVKM 304

Query: 290 GRVGKNYTIRITDRI 304
           GR G+   ++++++I
Sbjct: 305 GRSGEKLAVQVSEKI 319


>gi|218663134|ref|ZP_03519064.1| flagellar C-ring protein [Rhizobium etli IE4771]
          Length = 47

 Score = 44.3 bits (103), Expect = 0.023,   Method: Composition-based stats.
 Identities = 17/40 (42%), Positives = 29/40 (72%)

Query: 277 LSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLH 316
           +SAN KE+Y CE GR G+NY +R+ D +N D + +++ ++
Sbjct: 8   VSANSKELYICEFGRSGENYMVRVKDTMNSDDELIRHLMN 47


>gi|239834451|ref|ZP_04682779.1| surface presentation of antigens (SPOA) protein [Ochrobactrum
           intermedium LMG 3301]
 gi|239822514|gb|EEQ94083.1| surface presentation of antigens (SPOA) protein [Ochrobactrum
           intermedium LMG 3301]
          Length = 321

 Score = 44.3 bits (103), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 42/224 (18%), Positives = 90/224 (40%), Gaps = 15/224 (6%)

Query: 91  WSSNFFIGCSNNLVITLLENLLGASHETIPQL----YNRSLSTVEKKLAKRTIAQISAVL 146
           W    ++     LV +++E + GA       +     +R    +E+K++      ++  L
Sbjct: 92  WGCTLYLTADATLVFSVIEAMFGAQGNIGGNVGSVDEDRPFGMLEQKISALLAGHLAKSL 151

Query: 147 NQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL 206
           +Q  +   ++     +  D     +     S  F   I++  T         L++P+ T 
Sbjct: 152 DQVFAGNGQTLFAAGECIDTAEFDRENFERSRLFACRIDV--TAAGKTGRVHLLLPRSTH 209

Query: 207 LKTTLISLSSQNKSENQSEDLIDP-FARK----TYQLNVNIDTRINLKKTTLKDVVTLKI 261
                   +   +  NQ+    DP +A+K      +  + ++  I     TL  +  L+I
Sbjct: 210 KPMQDAVAAFLRRPMNQA----DPSWAKKMRHEVSRARIELEAFIQQGSMTLDALSMLEI 265

Query: 262 GQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           GQV+           L A  ++++ C LG+ G ++T+++ D +N
Sbjct: 266 GQVLKLPADAMEQVRLRAGDQQLFKCTLGKSGIHFTVKVGDPVN 309


>gi|117919797|ref|YP_868989.1| flagellar motor switch protein FliM [Shewanella sp. ANA-3]
 gi|117612129|gb|ABK47583.1| flagellar motor switch protein FliM [Shewanella sp. ANA-3]
          Length = 343

 Score = 44.3 bits (103), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 47/254 (18%), Positives = 98/254 (38%), Gaps = 19/254 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S    Q  KF   +H+       +            I     LV  L++N  G     
Sbjct: 76  EVSINGVQMLKFGEYVHTLFVPTSLNMVRFHPLKGTALITMEARLVFILVDNFFGGDGRF 135

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E+++       +  +L       +++   + D  + DYL    N  ++
Sbjct: 136 HAKIEGREFTPTERRI-------VQLLLKIIFEDYKDAWAPVMDV-EFDYLDSEVNPAMA 187

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDL--IDP 230
           N     E V   + ++ ++     F + +P  ++++     L +  +S+ Q  D+     
Sbjct: 188 NIVSPTEVVVINSFHIEVDGGGGDFHITMPY-SMIEPIRELLDAGVQSDKQDTDMRWSQA 246

Query: 231 FARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
              +   + V  D  +   + TLKDV+  K G +IP    E    ++       Y C++G
Sbjct: 247 LHDEIMDVKVGFDASVVEHELTLKDVMNFKAGDIIPIELPE--YIMMKIEDLPTYRCKMG 304

Query: 291 RVGKNYTIRITDRI 304
           R   N  ++I ++I
Sbjct: 305 RSRDNLALKIYEKI 318


>gi|113969632|ref|YP_733425.1| flagellar motor switch protein FliM [Shewanella sp. MR-4]
 gi|114046862|ref|YP_737412.1| flagellar motor switch protein FliM [Shewanella sp. MR-7]
 gi|113884316|gb|ABI38368.1| flagellar motor switch protein FliM [Shewanella sp. MR-4]
 gi|113888304|gb|ABI42355.1| flagellar motor switch protein FliM [Shewanella sp. MR-7]
          Length = 343

 Score = 44.3 bits (103), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 47/254 (18%), Positives = 98/254 (38%), Gaps = 19/254 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S    Q  KF   +H+       +            I     LV  L++N  G     
Sbjct: 76  EVSINGVQMLKFGEYVHTLFVPTSLNMVRFHPLKGTALITMEARLVFILVDNFFGGDGRF 135

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E+++       +  +L       +++   + D  + DYL    N  ++
Sbjct: 136 HAKIEGREFTPTERRI-------VQLLLKIIFEDYKDAWAPVMDV-EFDYLDSEVNPAMA 187

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDL--IDP 230
           N     E V   + ++ ++     F + +P  ++++     L +  +S+ Q  D+     
Sbjct: 188 NIVSPTEVVVINSFHIEVDGGGGDFHITMPY-SMIEPIRELLDAGVQSDKQDTDMRWSQA 246

Query: 231 FARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
              +   + V  D  +   + TLKDV+  K G +IP    E    ++       Y C++G
Sbjct: 247 LHDEIMDVKVGFDATVVEHELTLKDVMNFKAGDIIPIELPE--YIMMKIEDLPTYRCKMG 304

Query: 291 RVGKNYTIRITDRI 304
           R   N  ++I ++I
Sbjct: 305 RSRDNLALKIYEKI 318


>gi|24374733|ref|NP_718776.1| flagellar motor switch protein FliM [Shewanella oneidensis MR-1]
 gi|24349393|gb|AAN56220.1|AE015759_12 flagellar motor switch protein FliM [Shewanella oneidensis MR-1]
          Length = 343

 Score = 44.3 bits (103), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 47/254 (18%), Positives = 98/254 (38%), Gaps = 19/254 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S    Q  KF   +H+       +            I     LV  L++N  G     
Sbjct: 76  EVSINGVQMLKFGEYVHTLFVPTSLNMVRFHPLKGTALITMEARLVFILVDNFFGGDGRF 135

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E+++       +  +L       +++   + D  + DYL    N  ++
Sbjct: 136 HAKIEGREFTPTERRI-------VQLLLKIIFEDYKDAWAPVMDV-EFDYLDSEVNPAMA 187

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDL--IDP 230
           N     E V   + ++ ++     F + +P  ++++     L +  +S+ Q  D+     
Sbjct: 188 NIVSPTEVVVINSFHIEVDGGGGDFHITMPY-SMIEPIRELLDAGVQSDKQDTDMRWSQA 246

Query: 231 FARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
              +   + V  D  +   + TLKDV+  K G +IP    E    ++       Y C++G
Sbjct: 247 LHDEIMDVKVGFDATVVEHELTLKDVMNFKAGDIIPIELPE--YIMMRIEDLPTYRCKMG 304

Query: 291 RVGKNYTIRITDRI 304
           R   N  ++I ++I
Sbjct: 305 RSRDNLALKIYEKI 318


>gi|229524128|ref|ZP_04413533.1| flagellar motor switch protein FliM [Vibrio cholerae bv. albensis
           VL426]
 gi|297582024|ref|ZP_06943943.1| flagellar motor switch protein FliM [Vibrio cholerae RC385]
 gi|229337709|gb|EEO02726.1| flagellar motor switch protein FliM [Vibrio cholerae bv. albensis
           VL426]
 gi|297533719|gb|EFH72561.1| flagellar motor switch protein FliM [Vibrio cholerae RC385]
          Length = 349

 Score = 43.9 bits (102), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 42/211 (19%), Positives = 98/211 (46%), Gaps = 21/211 (9%)

Query: 103 LVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQES-SPNLE 161
           LV  L+EN  G       ++  R  +  E+++       I  +L    +  +E+ SP + 
Sbjct: 121 LVFILVENFFGGDGRYHARIEGREFTPTERRV-------IQLLLKIVFADYKEAWSPVMG 173

Query: 162 DFYDIDYLKKNTN-RLSN-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLS 215
              + +YL    N  ++N     E +   + ++ ++     F +++P  ++++     L 
Sbjct: 174 --VEFEYLDSEVNPSMANIVSPTEVIVVSSFHVEVDGGGGDFHMVMPY-SMVEPIRELLD 230

Query: 216 SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT--TLKDVVTLKIGQVIPFLHREKT 273
           +  +S+    D+    A +   ++V ++ R+NL +    L+D++ L++G VIP    E  
Sbjct: 231 AGVQSDKMETDVRWSTALREEIMDVPVNFRVNLLEMDIALRDLMELQVGDVIPIKMPEH- 289

Query: 274 CAILSANGKEIYSCELGRVGKNYTIRITDRI 304
            A++       Y  ++GR G+   ++++++I
Sbjct: 290 -AVMFIEELPTYRVKMGRSGEKLAVQVSEKI 319


>gi|149182515|ref|ZP_01860988.1| flagellar motor switch protein M [Bacillus sp. SG-1]
 gi|148849775|gb|EDL63952.1| flagellar motor switch protein M [Bacillus sp. SG-1]
          Length = 332

 Score = 43.9 bits (102), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 53/269 (19%), Positives = 106/269 (39%), Gaps = 13/269 (4%)

Query: 42  YKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSN 101
           + + L   F  ++   V I+  S     F   + S  +  + +   +     +  +  + 
Sbjct: 63  FARILTTYFSAQLRTYVQITVVSADQVPFEEFVRSVPKMTILNIFDVPPLDGHILMEVNP 122

Query: 102 NLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLE 161
           N+   +++ ++G     I ++ N  L+ +E K+      +    L    S   E  P L 
Sbjct: 123 NIGYAMMDRVMGGKGTGINKIEN--LTEIETKIMSNLFERAFDNLRDAWSNIAEIDPMLS 180

Query: 162 DF-YDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKS 220
           +F  +  +L+  +    NE V  I+MN TI   +    +IIP   +L+  +  LS     
Sbjct: 181 EFEVNPQFLQMVS---PNETVVVISMNTTIGETSGMINIIIPH-VVLEPIIPKLSVSYWM 236

Query: 221 ENQSEDLIDP-----FARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCA 275
           + +++D IDP       ++     V I   +     T+ D + L IG VI    R     
Sbjct: 237 QTKNKD-IDPQETEMLEKRIKTAQVPIVAELGDSDITIDDFLMLDIGDVIQLNKRIDAPL 295

Query: 276 ILSANGKEIYSCELGRVGKNYTIRITDRI 304
            +       ++ + G + K   ++I D +
Sbjct: 296 TIKVGEIPKFTAQPGELNKRLAVQILDSL 324


>gi|192360300|ref|YP_001982201.1| flagellar motor switch protein FliM [Cellvibrio japonicus Ueda107]
 gi|190686465|gb|ACE84143.1| flagellar motor switch protein FliM [Cellvibrio japonicus Ueda107]
          Length = 339

 Score = 43.5 bits (101), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 47/256 (18%), Positives = 97/256 (37%), Gaps = 22/256 (8%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           D+S    Q  KF   +H+       +            I     LV  L++N  G     
Sbjct: 76  DVSVGGVQIQKFGEYVHTLYVPTSLNMVKFRPLRGTALIILDARLVFKLVDNFFGGDGRH 135

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTT---------QESSPNLEDFYDIDYL 169
             ++  R  +  E ++ +  + Q    L +               E +P+L +      +
Sbjct: 136 -AKIEGREFTPTELRVVQMVLNQAFVDLGEAWKAVFPVSFEYVHSEVNPSLANI-----V 189

Query: 170 KKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLID 229
             +   + + F   ++      ++   + +I P   +L   L     Q+ SE Q E  + 
Sbjct: 190 SPSEVVVVSTFHIELDGGGGEMHITVPYSMIEPIREVLDAGL-----QSDSEEQDERWVR 244

Query: 230 PFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCEL 289
                     V+++  +  +  TL+D+V LK G +IP    +    +++ANG  ++  +L
Sbjct: 245 ALREDVLAAKVDLECDVVRRDITLRDIVDLKEGDIIPVEFPD--YHVVTANGVPMFRTQL 302

Query: 290 GRVGKNYTIRITDRIN 305
           G+   N  ++I + I+
Sbjct: 303 GQHNDNLALKILEFID 318


>gi|90406812|ref|ZP_01215004.1| flagellar motor switch protein [Psychromonas sp. CNPT3]
 gi|90312049|gb|EAS40142.1| flagellar motor switch protein [Psychromonas sp. CNPT3]
          Length = 352

 Score = 43.5 bits (101), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 42/254 (16%), Positives = 94/254 (37%), Gaps = 17/254 (6%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
            ++S    Q  KF   +H+       +            +     LV  L+EN  G    
Sbjct: 81  AEVSINGVQMLKFGEYVHTLFVPTSLNMVRFRPLKGTALVTMEARLVFILVENFFGGDGR 140

Query: 118 TIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RL 176
              ++  R  +  E+++ +  +  I        +    +        D +YL    N  +
Sbjct: 141 YHAKIEGREFTPTERRIIQMLLKIIFEDYKDAWAPVMTA--------DFEYLDSEVNPAM 192

Query: 177 SN-----EFVTTINMNMTIENVASSFVLIIPQETLLKT-TLISLSSQNKSENQSEDLIDP 230
           +N     E +   + ++ ++     F + +P   L     L+    Q+  E+  +     
Sbjct: 193 ANIVSPTEVIVVNSFHIELDGGGGDFHIAMPYSMLEPIRELLDAGVQSDKEDTDQRWSQA 252

Query: 231 FARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
              +   ++V +  ++  K+  L+D++   +G +IP    E+   ++   G   +  +LG
Sbjct: 253 LEDEIMDVDVYLTAKLLEKQLPLRDMINWSVGDIIPVELPEEL--LVCVEGLPSFHAKLG 310

Query: 291 RVGKNYTIRITDRI 304
           +   N  ++I DRI
Sbjct: 311 KSNDNLALKIIDRI 324


>gi|296283225|ref|ZP_06861223.1| flagellar motor switch protein FliM [Citromicrobium bathyomarinum
           JL354]
          Length = 339

 Score = 43.5 bits (101), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 54/258 (20%), Positives = 99/258 (38%), Gaps = 14/258 (5%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
           +++S     S +F   ++      + +   + +W     +    NL+  +++ LLG    
Sbjct: 87  IEVSLDDIASVRFGDFMNRVPLPCMIAVFKVPAWQDYGLVTIEANLIYAVVDALLGGRKG 146

Query: 118 TIPQ-LYNRSLSTVEKKLAKRTIA----QISAVLNQCISTTQESSPNLEDFYDIDYLKKN 172
             P+ +  R+ +T+E  L  + I     + S         T E    +E       +   
Sbjct: 147 AAPRKIEGRAFTTIETTLVSKMIELVLREFSTAFEPIAPITMELE-RIETSPRFAAIAGP 205

Query: 173 TNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSED--LIDP 230
           TN  S     T  ++M  +    +F +++P  TL +     LS +   E    D    D 
Sbjct: 206 TNVAS---AATFAVDM--DGRGGNFTILLPFATL-EPVRGKLSQRFMGEKLGGDNTWRDH 259

Query: 231 FARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
              +  +  V I T +  ++  L DV +L+IGQ IPF         +   G  +   ++G
Sbjct: 260 MRNEILRTEVEIYTVLGEREMRLADVHSLEIGQTIPFDVTPDDPFEVCCGGVPLARAQIG 319

Query: 291 RVGKNYTIRITDRINFDQ 308
           R   +  I I D I   Q
Sbjct: 320 RQRNHVAIGIVDTIKQGQ 337


>gi|149377878|ref|ZP_01895607.1| flagellar motor switch protein M [Marinobacter algicola DG893]
 gi|149357820|gb|EDM46313.1| flagellar motor switch protein M [Marinobacter algicola DG893]
          Length = 332

 Score = 43.1 bits (100), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 50/252 (19%), Positives = 95/252 (37%), Gaps = 18/252 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           D+S    Q  KF   IH+       +   +              LV  L++N  G     
Sbjct: 76  DVSTGGVQIMKFGEYIHTLYVPTSLNLCKVRPLRGTSLFVLDAKLVFKLVDNFFGGEGRH 135

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E ++       +  VL+Q     +E+   +    D +YL    N  ++
Sbjct: 136 -AKIEGREFTPTETRI-------VQMVLDQVFHDMREAWHAVLKV-DFEYLSSEVNPAMA 186

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKT-TLISLSSQNKSENQSEDLIDPF 231
           N     E V     ++ ++       + +P   +     ++    Q+  ++  E  +   
Sbjct: 187 NIVSPSEVVVVSTFHIELDGGGGELHMALPYSMIEPIRDVLDAGVQSDIDDVDERWVSAL 246

Query: 232 ARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGR 291
                 +NV I+T +  ++ +L+D+  LK G +IP    E     L+ANG  +Y   +G 
Sbjct: 247 QEDIKDVNVPINTTVCRRRISLRDIAKLKEGDIIPVEIPE--LLTLTANGIPVYKATMGT 304

Query: 292 VGKNYTIRITDR 303
                 +RI DR
Sbjct: 305 RDGKLALRIHDR 316


>gi|144897829|emb|CAM74693.1| Flagellar motor switch protein fliM [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 382

 Score = 43.1 bits (100), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 50/255 (19%), Positives = 108/255 (42%), Gaps = 16/255 (6%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
           V++S  +  S +F   ++S     + +      W +   +   ++L+ ++++ LLG    
Sbjct: 134 VEVSLDNILSLRFGDYLNSIPLPAMLAVFKAEEWDNYGLLTVDSSLIYSIVDVLLGGRRG 193

Query: 118 TIP-QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNT--- 173
           T   ++  R  +T+E+ L +R    +  VL+   +     SP     +  D L+ N    
Sbjct: 194 TAAMRIEGRPYTTIERNLVER---MVHVVLSDLSAAFDPLSPVT---FRFDRLETNPRFA 247

Query: 174 --NRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLID 229
             +R SN  +    + + +E+      L++P  TL  ++  L+ +    K    S     
Sbjct: 248 TISRPSNAAIVA-KLRIDMEDRGGRLELLLPYATLEPVRELLLQMFMGEKFGRDSI-WET 305

Query: 230 PFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCEL 289
             A + +   V ++  ++ +   L+DV+  K+G  I    +  +   L      ++   +
Sbjct: 306 HLAEELWLTEVQMEAVLDEQVMGLRDVLNWKVGSKILLNAQPNSPIDLRCGDVSMFRGRM 365

Query: 290 GRVGKNYTIRITDRI 304
           GR G +  IR+ D+I
Sbjct: 366 GRKGPHIAIRVDDKI 380


>gi|23099022|ref|NP_692488.1| flagellar motor switch protein FliM [Oceanobacillus iheyensis
           HTE831]
 gi|22777250|dbj|BAC13523.1| flagellar motor switch protein [Oceanobacillus iheyensis HTE831]
          Length = 330

 Score = 42.7 bits (99), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 52/122 (42%), Gaps = 2/122 (1%)

Query: 42  YKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSN 101
           Y + L   F  ++   V+IS TS     +   I S  +  + +   +     N  +  + 
Sbjct: 62  YARMLTTFFATQLRSYVNISVTSVDQVPYEEFIRSIPKKTILNLYGMEPLDGNLIMEINP 121

Query: 102 NLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLE 161
           N+   LL+ LLG    TI +  + +L+ +EK L  +   +    L    S+  E  P LE
Sbjct: 122 NIAYALLDRLLGGKGSTITK--DGNLTEIEKTLFMQMFEKAEDALRDAWSSVVEIEPVLE 179

Query: 162 DF 163
           +F
Sbjct: 180 EF 181


>gi|83589656|ref|YP_429665.1| flagellar motor switch protein FliM [Moorella thermoacetica ATCC
           39073]
 gi|83572570|gb|ABC19122.1| flagellar motor switch protein FliM [Moorella thermoacetica ATCC
           39073]
          Length = 323

 Score = 42.7 bits (99), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 58/285 (20%), Positives = 116/285 (40%), Gaps = 22/285 (7%)

Query: 29  KTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASL 88
           +T+  I  + G L   FL    +  + + +     S +   +   I S     + +  S+
Sbjct: 52  RTLYMIHENYGRLVANFLSAYLRASIQVKI----VSVEQMTYEDFILSLPTPTLMNVFSM 107

Query: 89  SSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQ 148
                +  +  + N +  +++ L G   E + +  NR L+ +E  + +R  +++   L+ 
Sbjct: 108 EPLKGSAVLETNMNFIFPIIDLLFGGRGEMVAR--NRELTEIELHVLRRLNSRMLEQLSY 165

Query: 149 CISTTQESSPNLEDFYDIDYLKKNTNRLS-NEFVTTINMNMTIENVASSFVLIIPQETLL 207
             S  Q  +P LE   +++   + T  +S NE V  I M  T+        L +P   LL
Sbjct: 166 SWSDIQNITPKLE---NMETNPQFTQAISPNETVAVITMGTTVGKYEGLLNLCLPY-MLL 221

Query: 208 KTTLISLSSQNKSENQSEDLIDPFARKTY-----QLNVNIDTRINLKKTTLKDVVTLKIG 262
           +  +  LS+ +      E    P  R        ++ V +   I   +  ++D + L++G
Sbjct: 222 EPVISRLSASHWFATGGEREARPDYRTVVEKILAEVPVELIAYIGRTRLPVRDFIQLQVG 281

Query: 263 QVIPFLHREKTCA---ILSANGKEIYSCELGRVGKNYTIRITDRI 304
            VI     EKT      L  +G   +  + G V K   +++T+ +
Sbjct: 282 DVITL---EKTVGEDLELYVDGHHKFQVQPGIVNKKIAVQVTEVV 323


>gi|313905139|ref|ZP_07838508.1| surface presentation of antigens (SPOA) protein [Eubacterium
           cellulosolvens 6]
 gi|313470042|gb|EFR65375.1| surface presentation of antigens (SPOA) protein [Eubacterium
           cellulosolvens 6]
          Length = 368

 Score = 42.7 bits (99), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 46/226 (20%), Positives = 94/226 (41%), Gaps = 33/226 (14%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFS-----QASLSSWSSNFFIGCSNNLVITLLENLLG 113
           DI+    +  ++   ++SF EN   +           +S    I  +  L++TL+ ++LG
Sbjct: 82  DITVMELRESRYYEYVNSFHENDCMTIIDTVMPEKGKFSVPMMIYVTPGLILTLMSHMLG 141

Query: 114 ASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDY----L 169
              + I    N   S VE  L KR +  I   L    S          ++  +D+    +
Sbjct: 142 GGEQVISTEENYRYSDVEMSLYKRILEYIIHALGDGFS----------NYLTVDFRPQKV 191

Query: 170 KKNTNRLS----NEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK------ 219
           ++N + +     +E V  +++N+ +  +AS  + I    TLL+    ++ ++        
Sbjct: 192 EENPSMIQEVGLDETVVLVHLNVDVTGIASEKIRICIPGTLLEQIFRTIDNRKHIARGFT 251

Query: 220 SENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVI 265
             N SE ++       + L   + T     + T++D+  L++G VI
Sbjct: 252 YSNNSEVIMSHLKETKFPLTAQLGT----VRLTMEDLYRLQVGDVI 293


>gi|169827132|ref|YP_001697290.1| flagellar motor switch protein FliM [Lysinibacillus sphaericus
           C3-41]
 gi|168991620|gb|ACA39160.1| Flagellar motor switch protein [Lysinibacillus sphaericus C3-41]
          Length = 331

 Score = 42.7 bits (99), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 50/268 (18%), Positives = 102/268 (38%), Gaps = 15/268 (5%)

Query: 42  YKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSN 101
           + + L   F  ++   V I+  S     F   + S     + +   +     N  +  + 
Sbjct: 63  FARLLTTFFSAQLRSYVQITVASVDQIPFEEFVRSIPNMTLINVFEVPPLDGNILMEINP 122

Query: 102 NLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLE 161
           N+  ++L+ ++G S  +   + N  L+ +E K+      +    L +      E  P L 
Sbjct: 123 NIAYSMLDRIMGGSGASHSNVDN--LTEIETKIMTNLFERSFDNLREAWENVAEIDPILV 180

Query: 162 DFYDIDYLKKNTNRL----SNEFVTTINMNMTIENVASSFVLIIPQ---ETLLKTTLISL 214
           +      L+ N   L     NE V  I++N  I   +    + IP    E ++    +  
Sbjct: 181 E------LEVNPQFLQMISPNETVVVISLNTIIGETSGMINICIPHVVLEPIVPNLSVRY 234

Query: 215 SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTC 274
             Q  ++  S +       +  Q  + +   + L   T++D +T++IG VI    +    
Sbjct: 235 WMQTNTKEMSPEQTKMLETRVKQAKLPLSVELGLTDITIEDFLTMQIGDVIQLEQKINDP 294

Query: 275 AILSANGKEIYSCELGRVGKNYTIRITD 302
            +L       ++ + G+ GK   I+I D
Sbjct: 295 LLLKVGTLPKFTVQPGKQGKKLAIQIID 322


>gi|254459067|ref|ZP_05072490.1| flagellar motor switch protein FliM [Campylobacterales bacterium GD
           1]
 gi|207084338|gb|EDZ61627.1| flagellar motor switch protein FliM [Campylobacterales bacterium GD
           1]
          Length = 365

 Score = 42.4 bits (98), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 57/272 (20%), Positives = 118/272 (43%), Gaps = 28/272 (10%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
           V+I   S     +   + S      F+  S+     +  I  + ++   +L+ LLG   E
Sbjct: 80  VEIQLHSVDQMTYGEFLMSLPNPTSFNVFSVKPLEGSGVIEINPSIAFPMLDRLLGGKGE 139

Query: 118 TIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQES-SPNLEDFYDIDYLKKNTNRL 176
             P   +R  S +E  L          +L   +ST +E+  P +E +  I+  + + N +
Sbjct: 140 --PFDASREFSDIELSL-------FETILRVMMSTLKEAWGPVMEIYPTIESKESSPNVV 190

Query: 177 S----NEFVTTINMNMTIENVASSFVL---IIPQETLL-----KTTLISLSSQNKSENQS 224
                NE V  + M + I + +    +   +I  E +L     +  +++ +S  KS N  
Sbjct: 191 QIVAQNEIVVMVVMEIIIGHSSGMMNICYPVISLEPILPKLASRDLMLNETSSKKSRNTE 250

Query: 225 EDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEI 284
             ++   A+      VN++  +   + T++DV+ L+IG V+           +S +GKE 
Sbjct: 251 LQVLLGGAK------VNVEANLGDAELTMRDVLDLQIGDVVRLSSAANDIVTVSIDGKER 304

Query: 285 YSCELGRVGKNYTIRITDRINFDQKSLKNFLH 316
           +  ++G      +I+I++ I+ ++ ++K  L 
Sbjct: 305 FRGQIGLRRFRKSIQISEIIDTEKDAVKRALE 336


>gi|254470104|ref|ZP_05083508.1| flagellar motor switch protein FliM [Pseudovibrio sp. JE062]
 gi|211960415|gb|EEA95611.1| flagellar motor switch protein FliM [Pseudovibrio sp. JE062]
          Length = 409

 Score = 42.4 bits (98), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 49/270 (18%), Positives = 109/270 (40%), Gaps = 26/270 (9%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
           V++S  S  + +F   ++S     +        W     +   ++L+ ++++ LLG    
Sbjct: 142 VEVSLDSMTNVRFGDYLNSIPLPAILGVFKAKEWDGFGLVTVESSLIYSIIDVLLGGGRG 201

Query: 118 TIP-QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNT--- 173
           + P ++  R  +T+E  L +R I  I       +   Q   P     + ++ L+ N    
Sbjct: 202 SSPTRVEGRPYTTIESNLVRRMIEII------LLDAEQAFGPLSPVSFPLERLETNPRFA 255

Query: 174 --NRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLID 229
             +R +N  +  + + + +E+      +++P  TL  ++  L+ +    K         D
Sbjct: 256 AISRPANAAI-MVELRIDMEDRGGKVEIVLPYATLEPIRDLLLQMFMGEKFGR------D 308

Query: 230 P-----FARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEI 284
           P      A + Y   V +D  +      L+ V+ L++GQ + F    +    +   G ++
Sbjct: 309 PIWEEHLATEVYSSEVQVDAVLYENTIPLQRVLNLEVGQTLLFDTGPRDPVQVKCGGVQL 368

Query: 285 YSCELGRVGKNYTIRITDRINFDQKSLKNF 314
               +G V    +I I+ ++   + +L  F
Sbjct: 369 TEGLMGHVDDRISIEISKKLKQPKMTLAAF 398


>gi|332533119|ref|ZP_08408988.1| flagellar motor switch protein FliM [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332037401|gb|EGI73855.1| flagellar motor switch protein FliM [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 363

 Score = 42.0 bits (97), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 51/266 (19%), Positives = 104/266 (39%), Gaps = 20/266 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S    Q  KF   IH+       +            I     LV  L++N  G     
Sbjct: 78  EVSINGVQMIKFGEYIHTLFVPTSLNMVRFRPLKGTGLITMEARLVFILVDNFFGGDGRY 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E+++ +  +  I     +  +   + S         +YL    N  ++
Sbjct: 138 HAKIEGREFTPTERRIVQMLLKIIFEDYKEAWAPVMDVS--------FEYLDSEVNPAMA 189

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFA 232
           N     E V   + ++ ++     F + +P  ++L+     L +  +S+ +  DL    A
Sbjct: 190 NIVSPTEVVVISSFHIELDGGGGDFHIALPY-SMLEPIRELLDAGVQSDTEDTDLRWSKA 248

Query: 233 RKTYQLNVNIDTRINLKKT--TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
            +   ++V +D    L +   TLK ++ LK G +IP    E     +       +  ++G
Sbjct: 249 LRDEIMDVEVDMSTQLLEVDLTLKQIMELKAGDIIPVEMPEHITVFVEE--LPTFRAKMG 306

Query: 291 RVGKNYTIRITDRINFDQKSLKNFLH 316
           R   N  ++I+++I     S+K+ LH
Sbjct: 307 RSRDNVALQISEKIK-RPDSVKSELH 331


>gi|170722847|ref|YP_001750535.1| flagellar motor switch protein FliM [Pseudomonas putida W619]
 gi|169760850|gb|ACA74166.1| flagellar motor switch protein FliM [Pseudomonas putida W619]
          Length = 322

 Score = 42.0 bits (97), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 46/253 (18%), Positives = 95/253 (37%), Gaps = 18/253 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           D++    Q  KF   +HS       +   +              LV  L++N  G     
Sbjct: 78  DVAVGGVQVMKFGEYVHSLYVPTSLNLVKIKPLRGTSLFILDAKLVFKLVDNFFGGDGRH 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E ++ +        VL+QC    +E+   +    + +Y+    N  ++
Sbjct: 138 A-KIEGREFTPTELRVVR-------MVLDQCFIDLKEAWQAIMPV-NFEYMNSEVNPAMA 188

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKT-TLISLSSQNKSENQSEDLIDPF 231
           N     E V     ++ ++       + +P   +     ++    Q+  ++Q E  +   
Sbjct: 189 NIVGPSEAVVVSTFHIELDGGGGDLHVTMPYSMIEPVREMLDAGFQSDLDDQDERWVKAL 248

Query: 232 ARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGR 291
                 ++V +   +  ++  L+DV+ ++ G VIP    E    +L ANG   +   LG 
Sbjct: 249 REDVLDVSVPLSATVARRQLKLRDVLHMQPGDVIPVELPEHL--VLRANGVPSFKARLGS 306

Query: 292 VGKNYTIRITDRI 304
              N  ++I D I
Sbjct: 307 HKGNLALQIIDPI 319


>gi|149188092|ref|ZP_01866387.1| flagellar motor switch protein M [Vibrio shilonii AK1]
 gi|148838080|gb|EDL55022.1| flagellar motor switch protein M [Vibrio shilonii AK1]
          Length = 349

 Score = 42.0 bits (97), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 42/218 (19%), Positives = 97/218 (44%), Gaps = 21/218 (9%)

Query: 96  FIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQE 155
            I     LV  L+EN  G       ++  R  +  E+++       I  ++       +E
Sbjct: 114 LITMEARLVFILVENFFGGDGRFHAKIEGREFTPTERRI-------IQLLMKTVFEDYKE 166

Query: 156 S-SPNLEDFYDIDYLKKNTN-RLSN-----EFVTTINMNMTIENVASSFVLIIPQETLLK 208
           + SP +    + +YL    N  ++N     E +   + ++ ++     F +++P  ++++
Sbjct: 167 AWSPVMG--VEFEYLDSEVNPSMANIVSPTEVIVVSSFHIEVDGGGGDFHVVMPY-SMVE 223

Query: 209 TTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINL--KKTTLKDVVTLKIGQVIP 266
                L +  +S+    D+    A +   ++V ++ R+NL  K  +L+D++ L+ G +IP
Sbjct: 224 PIRELLDAGVQSDKMETDVRWSSALREEIMDVPVNFRVNLLEKDVSLRDLMELQAGDIIP 283

Query: 267 FLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
               E   A +       +  ++GR G+   ++I+++I
Sbjct: 284 IDMPEN--ATMFVEELPTFRVKMGRTGEKVAVQISEKI 319


>gi|74317625|ref|YP_315365.1| flagellar motor switch protein FliM [Thiobacillus denitrificans
           ATCC 25259]
 gi|74057120|gb|AAZ97560.1| flagellar motor switch protein FliM [Thiobacillus denitrificans
           ATCC 25259]
          Length = 334

 Score = 42.0 bits (97), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 52/254 (20%), Positives = 100/254 (39%), Gaps = 25/254 (9%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
           V+IS    +  K+S  I +       +            +  + +LV  +++NL G    
Sbjct: 77  VEISVGPVRVSKYSEFIRNLVVPTNLNLVQFKPLRGTALMIFNPDLVFLMVDNLFGGDGR 136

Query: 118 TIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDY--LKKNTN- 174
              ++  R  +  E ++ +R       +LN       +S    E  Y I++  ++   N 
Sbjct: 137 FHTRVEGRDFTQTEHRIIQR-------ILNIVFEAYGKS---WEPVYPIEFEFIRSEMNT 186

Query: 175 -----RLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSED--L 227
                   NE V  +   + +  ++      +P  ++++     L+S  ++EN   D   
Sbjct: 187 QFANIATPNEVVVAVTFAIELGQISGEMHFCMPY-SMIEPIKDLLTSSLQAENLEVDKRW 245

Query: 228 IDPFARKTYQL-NVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYS 286
           I    R+  QL  V I   +   + +L+D+V LK+G VIP        A    +G  +  
Sbjct: 246 IR-LMRQQIQLAEVEIVADLGTAEVSLRDIVNLKVGDVIPLDIPPTIEA--KVDGVPVME 302

Query: 287 CELGRVGKNYTIRI 300
           C  G+    YT+R+
Sbjct: 303 CAYGKFNGQYTLRV 316


>gi|330953758|gb|EGH54018.1| flagellar motor switch protein FliM [Pseudomonas syringae Cit 7]
          Length = 322

 Score = 42.0 bits (97), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 42/239 (17%), Positives = 88/239 (36%), Gaps = 18/239 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           D++    Q  KF   +HS       + A +              LV  L++N  G     
Sbjct: 78  DVAVGGVQVMKFGEYVHSLYVPTSLNLAKIKPLRGTALFILDAKLVFKLVDNFFGGDGRH 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E ++ +  + Q    L +      E         + +Y+    N  ++
Sbjct: 138 A-KIEGREFTPTELRVVRMVLDQAFVDLKEAWQAIME--------VNFEYINSEVNPAMA 188

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKT-TLISLSSQNKSENQSEDLIDPF 231
           N     E V     ++ ++       + +P   +     ++    Q+  ++Q E  ++  
Sbjct: 189 NIVGPSEAVVISTFHIELDGGGGDLHVTMPYSMIEPIREMLDAGFQSDLDDQDERWVNAL 248

Query: 232 ARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
                 +NV + T I  ++  L+D++ ++ G VIP         +L ANG   +  +LG
Sbjct: 249 KEDVLDVNVPLTTTIAQRQLPLRDILHMRPGDVIPV--ELGDSLVLRANGVPSFKVKLG 305


>gi|224419055|ref|ZP_03657061.1| flagellar motor switch protein FliM [Helicobacter canadensis MIT
           98-5491]
 gi|253827995|ref|ZP_04870880.1| flagellar motor switch protein [Helicobacter canadensis MIT
           98-5491]
 gi|313142563|ref|ZP_07804756.1| flagellar motor switch protein FliM [Helicobacter canadensis MIT
           98-5491]
 gi|253511401|gb|EES90060.1| flagellar motor switch protein [Helicobacter canadensis MIT
           98-5491]
 gi|313131594|gb|EFR49211.1| flagellar motor switch protein FliM [Helicobacter canadensis MIT
           98-5491]
          Length = 352

 Score = 42.0 bits (97), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 54/272 (19%), Positives = 113/272 (41%), Gaps = 28/272 (10%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
           V+I   S     +   + S      F+  S+        +  + ++   +++ LLG   +
Sbjct: 80  VEIQLHSVDQMTYGEFLMSLPSPTSFNVFSMKPLDGTGVLEINPSIAFPMIDRLLGGKGD 139

Query: 118 TIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQES-SPNLEDFYDIDYLKKNTNRL 176
             P    R  S +E  L       +  +L Q +   +E+ +P  E F ++D  + + N +
Sbjct: 140 --PYESTREFSDIELNL-------LDTILRQMMQNLKEAWAPITEIFPNVDVKESSPNVV 190

Query: 177 S----NEFVTTINMNMTIENVASSFVL---IIPQETLL-----KTTLISLSSQNKSENQS 224
                NE V  + M + I + +    L   +I  E++L     +  ++S +S  KS N+ 
Sbjct: 191 QIVAQNEIVIMVVMEIIIGHSSGMMNLCYPVISLESVLSRLASRDIMLSETSSKKSRNKE 250

Query: 225 EDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEI 284
              +   A+      VN+   +   K TL++++ L++G ++          I++ +G+E 
Sbjct: 251 LQALLGGAK------VNVAAILGETKLTLREILDLEVGDIMRLDRPADDTVIINVDGREK 304

Query: 285 YSCELGRVGKNYTIRITDRINFDQKSLKNFLH 316
           +   +G      TI I + I  ++  +K  L 
Sbjct: 305 FLASIGLHRYRKTIEIKEMIKTEKDQVKEILE 336


>gi|145298353|ref|YP_001141194.1| flagellar motor switch protein FliM [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142851125|gb|ABO89446.1| Flagellar motor switch protein [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 356

 Score = 42.0 bits (97), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 47/254 (18%), Positives = 102/254 (40%), Gaps = 19/254 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S    Q  KF   +H+       +            I     LV  L+EN  G     
Sbjct: 76  EVSINGVQMLKFGEYVHTLFVPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRY 135

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E+++       I  +L       +++   + D    +YL    N  ++
Sbjct: 136 HAKIEGREFTPTERRI-------IQMLLKLVFEDYKDAWAPVMDV-GFEYLDSEVNPAMA 187

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFA 232
           N     E +   + ++ ++     F + +P  ++L+     L +  +S+    D+    A
Sbjct: 188 NIVSPTEVIVVSSFHIELDGGGGDFHVAMPY-SMLEPIRELLDAGVQSDKGDTDVRWSKA 246

Query: 233 RKTYQLNVNIDTRINLKKT--TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
            +   ++V ++ R  L +T  TL++++ LK G +IP    E    ++       +  ++G
Sbjct: 247 LRDEIMDVKVELRAKLLETDLTLRELMELKPGDIIPVEMPENL--LVYVEDLPTFHAKMG 304

Query: 291 RVGKNYTIRITDRI 304
           R   N  ++ITD++
Sbjct: 305 RTKDNVALKITDKL 318


>gi|229918638|ref|YP_002887284.1| flagellar motor switch protein FliM [Exiguobacterium sp. AT1b]
 gi|229470067|gb|ACQ71839.1| flagellar motor switch protein FliM [Exiguobacterium sp. AT1b]
          Length = 329

 Score = 41.6 bits (96), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 56/289 (19%), Positives = 112/289 (38%), Gaps = 42/289 (14%)

Query: 42  YKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSN 101
           + + L   F  ++   V  S  S +   +   IHS     + +       +  F I  + 
Sbjct: 62  FTRMLTTFFSAQLRTYVQFSVNSVEQLPYDEFIHSIPSMTMINLIEAPPLNGRFIIEVNP 121

Query: 102 NLVITLLENLLGA--------------SHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           N+   +L+ LLG                   + QLY R+ ST     A  +IA+I A ++
Sbjct: 122 NISYAMLDRLLGGPGVEMDKIESFTEIEMRILTQLYKRAFSTYGD--AWESIAEIKAEMS 179

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
                  E +P                   NE V  I++ +TI  V+ +  + +P  T +
Sbjct: 180 AV-----EVNPQFLQLVS-----------PNETVVLISIGVTIGEVSGTINVCLPFVT-I 222

Query: 208 KTTLISLSS-----QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIG 262
           +  L  LSS     +    N S+   +P   +     V + + +     T  D++ L++G
Sbjct: 223 EPVLSKLSSHYWMQEANRRNASQSSKEPLKAQLMNSTVEVVSLLGETTITFGDLLHLEVG 282

Query: 263 QVIPF--LHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
             +    L +E    ++  N  +++  ++G  GK   +++  R+  +++
Sbjct: 283 DCLALDQLAKEPLSVMVGEN--KVFKGQVGVSGKRMAVQVLHRVKEEEQ 329


>gi|330876026|gb|EGH10175.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 322

 Score = 41.6 bits (96), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 41/239 (17%), Positives = 87/239 (36%), Gaps = 18/239 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           D++    Q  KF   +HS       + A +              LV  L++N  G     
Sbjct: 78  DVAVGGVQVMKFGEYVHSLYVPTSLNLAKIKPLRGTALFILDAKLVFKLVDNFFGGDGRH 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRL-- 176
             ++  R  +  E ++ +  + Q    L +      E         + +Y+    N +  
Sbjct: 138 A-KIEGREFTPTELRVVRMVLDQAFIDLKEAWQAIME--------VNFEYINSEVNPVMA 188

Query: 177 ----SNEFVTTINMNMTIENVASSFVLIIPQETLLKT-TLISLSSQNKSENQSEDLIDPF 231
                +E V     ++ ++       + +P   +     ++    Q+  ++Q E  ++  
Sbjct: 189 NIVGPSEAVVISTFHIELDGGGGDLHVTMPYSMIEPIREMLDAGFQSDLDDQDERWVNAL 248

Query: 232 ARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
                 +NV + T I  ++  L+D++ ++ G VIP         +L ANG   +  +LG
Sbjct: 249 KEDVLDVNVPLTTTIAQRQLPLRDILHMRPGDVIPV--ELSDTLVLRANGVPSFKVKLG 305


>gi|148976420|ref|ZP_01813126.1| flagellar motor switch protein M [Vibrionales bacterium SWAT-3]
 gi|145964243|gb|EDK29499.1| flagellar motor switch protein M [Vibrionales bacterium SWAT-3]
          Length = 347

 Score = 41.6 bits (96), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 44/218 (20%), Positives = 97/218 (44%), Gaps = 21/218 (9%)

Query: 96  FIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQE 155
            I     LV  L+EN  G       ++  R  +  E+++       I  +L       +E
Sbjct: 114 LITMEARLVFILVENFFGGDGRFHAKIEGREFTPTERRI-------IQLLLKIVFEDYKE 166

Query: 156 S-SPNLEDFYDIDYLKKNTN-RLSN-----EFVTTINMNMTIENVASSFVLIIPQETLLK 208
           + SP +    + +YL    N  ++N     E +   + ++ ++     F +++P  ++++
Sbjct: 167 AWSPVMG--VEFEYLDSEVNPSMANIVSPTEVIVVSSFHIEVDGGGGDFHVVMPY-SMVE 223

Query: 209 TTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINL--KKTTLKDVVTLKIGQVIP 266
                L +  +S+    D+    A +   ++V ++ R+NL  +  +L+D++ L+ G VIP
Sbjct: 224 PIRELLDAGVQSDKMETDVRWSTALRDEIMDVPVNFRVNLLEQDISLRDLMELRPGDVIP 283

Query: 267 FLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
               E   A +       Y  ++GR G+   ++I+++I
Sbjct: 284 MNMPEH--ATMFVEELPTYRVKMGRSGEKLAVQISEKI 319


>gi|71737319|ref|YP_275531.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257484906|ref|ZP_05638947.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|289629023|ref|ZP_06461977.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289651613|ref|ZP_06482956.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|298487824|ref|ZP_07005864.1| Flagellar motor switch protein fliM [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|71557872|gb|AAZ37083.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|298157549|gb|EFH98629.1| Flagellar motor switch protein fliM [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320325124|gb|EFW81193.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320329383|gb|EFW85376.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330866455|gb|EGH01164.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           aesculi str. 0893_23]
 gi|330889050|gb|EGH21711.1| flagellar motor switch protein FliM [Pseudomonas syringae pv. mori
           str. 301020]
 gi|330986499|gb|EGH84602.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331011074|gb|EGH91130.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 322

 Score = 41.6 bits (96), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 43/239 (17%), Positives = 89/239 (37%), Gaps = 18/239 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           D++    Q  KF   +HS       + A +              LV  L++N  G     
Sbjct: 78  DVAVGGVQVMKFGEYVHSLYVPTSLNLAKIKPLRGTALFILDAKLVFKLVDNFFGGDGRH 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E ++ +  + Q    L +      E         + +Y+    N  ++
Sbjct: 138 A-KIEGREFTPTELRVVRMVLDQAFIDLKEAWQAIME--------VNFEYINSEVNPAMA 188

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKT-TLISLSSQNKSENQSEDLIDPF 231
           N     E V     ++ ++       + +P   +     ++    Q+  ++Q E  I+  
Sbjct: 189 NIVGPSEAVVISTFHIELDGGGGDLHVTMPYSMIEPIREMLDAGFQSDLDDQDERWINAL 248

Query: 232 ARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
                 +NV + T I  ++  L+D++ ++ G VIP    E    ++ ANG   +  +LG
Sbjct: 249 KEDVLDVNVPLTTTIAQRQLPLRDILHMRPGDVIPVELSE--SLVMRANGVPSFKVKLG 305


>gi|323491452|ref|ZP_08096636.1| flagellar motor switch protein FliM [Vibrio brasiliensis LMG 20546]
 gi|323314321|gb|EGA67401.1| flagellar motor switch protein FliM [Vibrio brasiliensis LMG 20546]
          Length = 349

 Score = 41.6 bits (96), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 40/218 (18%), Positives = 99/218 (45%), Gaps = 21/218 (9%)

Query: 96  FIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQE 155
            I     LV  L+EN  G       ++  R  +  E+++       +  +L       +E
Sbjct: 114 LITMEARLVFILVENFFGGDGRFHARIEGREFTPTERRI-------VQLLLKIVFEDYKE 166

Query: 156 S-SPNLEDFYDIDYLKKNTN-RLSN-----EFVTTINMNMTIENVASSFVLIIPQETLLK 208
           + SP +    + +YL    N  ++N     E +   + ++ ++     F +++P  ++++
Sbjct: 167 AWSPVMG--VEFEYLDSEVNPSMANIVSPTEVIVVSSFHIEVDGGGGDFHVVMPY-SMVE 223

Query: 209 TTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINL--KKTTLKDVVTLKIGQVIP 266
                L +  +S+    D+    A +   ++V ++ R++L  +  +L+D++ L+ G +IP
Sbjct: 224 PIRELLDAGVQSDKMETDVRWSTALREEIMDVPVNFRVDLLEQDISLRDLMELQPGDIIP 283

Query: 267 FLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
               E   A++       +  ++GR G+N  ++++++I
Sbjct: 284 VTMPEH--AVMFVEELPTFRVKMGRSGENLAVQVSEKI 319


>gi|302185372|ref|ZP_07262045.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           syringae 642]
          Length = 322

 Score = 41.6 bits (96), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 42/239 (17%), Positives = 88/239 (36%), Gaps = 18/239 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           D++    Q  KF   +HS       + A +              LV  L++N  G     
Sbjct: 78  DVAVGGVQVMKFGEYVHSLYVPTSLNLAKIKPLRGTALFILDAKLVFKLVDNFFGGDGRH 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E ++ +  + Q    L +      E         + +Y+    N  ++
Sbjct: 138 A-KIEGREFTPTELRVVRMVLDQAFVDLKEAWQAIME--------VNFEYINSEVNPAMA 188

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKT-TLISLSSQNKSENQSEDLIDPF 231
           N     E V     ++ ++       + +P   +     ++    Q+  ++Q E  ++  
Sbjct: 189 NIVGPSEAVVISTFHIELDGGGGDLHVTMPYSMIEPIREMLDAGFQSDLDDQDERWVNAL 248

Query: 232 ARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
                 +NV + T I  ++  L+D++ ++ G VIP         +L ANG   +  +LG
Sbjct: 249 KEDVLDVNVPLTTTIAQRQLPLRDILHMRPGDVIPV--ELSDSLVLRANGVPSFKVKLG 305


>gi|84388118|ref|ZP_00991014.1| flagellar motor switch protein [Vibrio splendidus 12B01]
 gi|84377185|gb|EAP94055.1| flagellar motor switch protein [Vibrio splendidus 12B01]
          Length = 347

 Score = 41.6 bits (96), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 44/218 (20%), Positives = 97/218 (44%), Gaps = 21/218 (9%)

Query: 96  FIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQE 155
            I     LV  L+EN  G       ++  R  +  E+++       I  +L       +E
Sbjct: 114 LITMEARLVFILVENFFGGDGRFHAKIEGREFTPTERRI-------IQLLLKIVFEDYKE 166

Query: 156 S-SPNLEDFYDIDYLKKNTN-RLSN-----EFVTTINMNMTIENVASSFVLIIPQETLLK 208
           + SP +    + +YL    N  ++N     E +   + ++ ++     F +++P  ++++
Sbjct: 167 AWSPVMG--VEFEYLDSEVNPSMANIVSPTEVIVVSSFHIEVDGGGGDFHVVMPY-SMVE 223

Query: 209 TTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINL--KKTTLKDVVTLKIGQVIP 266
                L +  +S+    D+    A +   ++V ++ R+NL  +  +L+D++ L+ G VIP
Sbjct: 224 PIRELLDAGVQSDKMETDVRWSTALRDEIMDVPVNFRVNLLEQDISLRDLMELRPGDVIP 283

Query: 267 FLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
               E   A +       Y  ++GR G+   ++I+++I
Sbjct: 284 MNMPEH--ATMFVEELPTYRVKMGRSGEKLAVQISEKI 319


>gi|256833228|ref|YP_003161955.1| flagellar motor switch protein FliM [Jonesia denitrificans DSM
           20603]
 gi|256686759|gb|ACV09652.1| flagellar motor switch protein FliM [Jonesia denitrificans DSM
           20603]
          Length = 308

 Score = 41.6 bits (96), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 44/218 (20%), Positives = 86/218 (39%), Gaps = 16/218 (7%)

Query: 93  SNFFIGCSNNLVITLLENLLGASHETIPQLYN----RSLSTVEKKLAKRTIAQISAVLNQ 148
           S   +   +N  +  L+ LLG      P L      R L+ +E  L +  +    A +  
Sbjct: 94  STALLQIPSNTTMLWLDYLLGG-----PGLERQENPRELTEIETALFRSLLDSSLADMRY 148

Query: 149 CISTTQESSPNLEDF-YDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
             S+    +P +    Y+  +++      ++E V   N ++T+ +  S+  ++   + LL
Sbjct: 149 AFSSITPMNPKIRGLQYNPQFVQAVP---ASEAVLVANYSLTVGDRVSAATMMFAADALL 205

Query: 208 KTTLISLSSQNKSENQSEDLIDPFARKTYQLN---VNIDTRINLKKTTLKDVVTLKIGQV 264
               +     + S  Q E+    F R    +N   V++  R N      +D++ + +G V
Sbjct: 206 NPLKVGEGEADPSAAQREEQRVSFERLRLSMNDVPVDVGVRFNSITVRPRDIIDMAVGDV 265

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
           I   H       +   G+ I     G  GK   +++TD
Sbjct: 266 IELRHAASKPLRIVVEGRTIGHGVPGNNGKQLAVKVTD 303


>gi|74055041|gb|AAZ95846.1| FliM [Aeromonas hydrophila]
          Length = 356

 Score = 41.6 bits (96), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 46/254 (18%), Positives = 103/254 (40%), Gaps = 19/254 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S    Q  KF   +H+       +            I     LV  L+EN  G     
Sbjct: 76  EVSINGVQMLKFGEYVHTLFVPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRY 135

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E+++       I  +L       +++   + D    +YL    N  ++
Sbjct: 136 HAKIEGREFTPTERRI-------IQMLLKLVFEDYKDAWAPVMDV-GFEYLDSEVNPAMA 187

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFA 232
           N     E +   + ++ ++     F + +P  ++L+     L +  +S+    D+    A
Sbjct: 188 NIVSPTEVIVVSSFHIELDGGGGDFHVAMPY-SMLEPIRELLDAGVQSDKGDTDVRWSKA 246

Query: 233 RKTYQLNVNIDTRINLKKT--TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
            +   ++V ++ R  L +T  TL++++ L+ G +IP    E    ++       +  ++G
Sbjct: 247 LRDEIMDVKVELRAKLLETDLTLRELMELRPGDIIPVEMPENL--LVYVEDLPTFHAKMG 304

Query: 291 RVGKNYTIRITDRI 304
           R  +N  ++ITD++
Sbjct: 305 RTKENVALKITDKL 318


>gi|323496548|ref|ZP_08101602.1| flagellar motor switch protein FliM [Vibrio sinaloensis DSM 21326]
 gi|323318392|gb|EGA71349.1| flagellar motor switch protein FliM [Vibrio sinaloensis DSM 21326]
          Length = 349

 Score = 41.2 bits (95), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 41/218 (18%), Positives = 98/218 (44%), Gaps = 21/218 (9%)

Query: 96  FIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQE 155
            I     LV  L+EN  G       ++  R  +  E+++       +  +L       +E
Sbjct: 114 LITMEARLVFILVENFFGGDGRFHARIEGREFTPTERRI-------VQLLLKIVFEDYKE 166

Query: 156 S-SPNLEDFYDIDYLKKNTN-RLSN-----EFVTTINMNMTIENVASSFVLIIPQETLLK 208
           + SP +    + +YL    N  ++N     E +   + ++ ++     F +++P  ++++
Sbjct: 167 AWSPVMG--VEFEYLDSEVNPSMANIVSPTEVIVVSSFHIEVDGGGGDFHVVMPY-SMVE 223

Query: 209 TTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINL--KKTTLKDVVTLKIGQVIP 266
                L +  +S+    D+    A +   ++V ++ R+NL  +  +L+D++ L+ G +IP
Sbjct: 224 PIRELLDAGVQSDKMETDVRWSTALREEIMDVPVNFRVNLLEQDISLRDLMELQPGDIIP 283

Query: 267 FLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
               E   A +       +  ++GR G+N  ++++++I
Sbjct: 284 ITMPEH--ATMFVEELPTFRVKMGRSGENLAVQVSEKI 319


>gi|86146129|ref|ZP_01064455.1| flagellar motor switch protein [Vibrio sp. MED222]
 gi|218708830|ref|YP_002416451.1| flagellar motor switch protein FliM [Vibrio splendidus LGP32]
 gi|85836076|gb|EAQ54208.1| flagellar motor switch protein [Vibrio sp. MED222]
 gi|218321849|emb|CAV17824.1| Flagellar motor switch protein fliM [Vibrio splendidus LGP32]
          Length = 347

 Score = 41.2 bits (95), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 44/218 (20%), Positives = 97/218 (44%), Gaps = 21/218 (9%)

Query: 96  FIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQE 155
            I     LV  L+EN  G       ++  R  +  E+++       I  +L       +E
Sbjct: 114 LITMEARLVFILVENFFGGDGRFHAKIEGREFTPTERRI-------IQLLLKIVFEDYKE 166

Query: 156 S-SPNLEDFYDIDYLKKNTN-RLSN-----EFVTTINMNMTIENVASSFVLIIPQETLLK 208
           + SP +    + +YL    N  ++N     E +   + ++ ++     F +++P  ++++
Sbjct: 167 AWSPVMG--VEFEYLDSEVNPSMANIVSPTEVIVVSSFHIEVDGGGGDFHVVMPY-SMVE 223

Query: 209 TTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINL--KKTTLKDVVTLKIGQVIP 266
                L +  +S+    D+    A +   ++V ++ R+NL  +  +L+D++ L+ G VIP
Sbjct: 224 PIRELLDAGVQSDKMETDVRWSSALRDEIMDVPVNFRVNLLEQDISLRDLMELRPGDVIP 283

Query: 267 FLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
               E   A +       Y  ++GR G+   ++I+++I
Sbjct: 284 MNMPEH--ATMFVEELPTYRVKMGRSGEKLAVQISEKI 319


>gi|26991047|ref|NP_746472.1| flagellar motor switch protein FliM [Pseudomonas putida KT2440]
 gi|148546747|ref|YP_001266849.1| flagellar motor switch protein FliM [Pseudomonas putida F1]
 gi|24986079|gb|AAN69936.1|AE016632_7 flagellar motor switch protein FliM [Pseudomonas putida KT2440]
 gi|5921670|gb|AAD56294.1| FliM [Pseudomonas putida]
 gi|148510805|gb|ABQ77665.1| flagellar motor switch protein FliM [Pseudomonas putida F1]
 gi|313497806|gb|ADR59172.1| FliM [Pseudomonas putida BIRD-1]
          Length = 322

 Score = 41.2 bits (95), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 45/254 (17%), Positives = 93/254 (36%), Gaps = 18/254 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           D++    Q  KF   +HS       +   +              LV  L++N  G     
Sbjct: 78  DVAVGGVQVMKFGEYVHSLYVPTSLNLVKIKPLRGTSLFILDAKLVFKLVDNFFGGDGRH 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E ++ +        VL+QC    +E+   +      +Y+    N  ++
Sbjct: 138 A-KIEGREFTPTELRVVR-------MVLDQCFVDLKEAWQAIMPV-SFEYMNSEVNPAMA 188

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKT-TLISLSSQNKSENQSEDLIDPF 231
           N     E V     ++ ++       + +P   +     ++    Q+  ++Q E  +   
Sbjct: 189 NIVGPSEAVVVSTFHIELDGGGGDLHVTMPYSMIEPVREMLDAGFQSDLDDQDERWVKAL 248

Query: 232 ARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGR 291
                 + V +   +  ++  L+D++ ++ G VIP    E    +L ANG   +   LG 
Sbjct: 249 REDVLDVAVPMTATVARRQLKLRDILHMQPGDVIPVELPEHL--VLRANGVPAFKARLGS 306

Query: 292 VGKNYTIRITDRIN 305
              N  ++I D I 
Sbjct: 307 HKGNLALQIIDPIE 320


>gi|291277482|ref|YP_003517254.1| flagellar motor switch protein [Helicobacter mustelae 12198]
 gi|290964676|emb|CBG40531.1| flagellar motor switch protein [Helicobacter mustelae 12198]
          Length = 357

 Score = 41.2 bits (95), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 54/272 (19%), Positives = 112/272 (41%), Gaps = 28/272 (10%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
           V+I   S     +   + S      F+  S+        +  + ++V ++++ LLG   E
Sbjct: 79  VEIQLHSVDQMTYGEFLMSLPSPTSFNVFSMKPMDGTGVLEINPSIVFSMIDRLLGGKGE 138

Query: 118 TIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQES-SPNLEDFYDIDYLKKNTNRL 176
           T    + R  S +E  L       +  +L Q + T +++  P  E F  +D  + + N +
Sbjct: 139 TYD--HQREFSDIELNL-------LDTILRQIMQTLKDAWGPVAEIFPSVDAKESSPNVV 189

Query: 177 S----NEFVTTINMNMTIENVASSFVL---IIPQETLL-----KTTLISLSSQNKSENQS 224
                NE V  + M M I + +    L   +I  E +L     +  ++S +S  KS N+ 
Sbjct: 190 QIVAQNEVVIMVVMEMIIGHSSGMLSLCYPVISLEAVLSRLGSRDLVLSETSSKKSRNKE 249

Query: 225 EDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEI 284
              +   A       +++   +     +L++++ L+ G +I           ++ +GK+ 
Sbjct: 250 LQALIGGA------GISLSAFLGGANLSLREILELQRGDIIRLDRVADDTVFVAIDGKDK 303

Query: 285 YSCELGRVGKNYTIRITDRINFDQKSLKNFLH 316
           +  ++G      TIRI + I  ++  +K  L 
Sbjct: 304 FLADIGLQRYRKTIRIKEAIRTEKDQVKEILE 335


>gi|325273547|ref|ZP_08139778.1| flagellar motor switch protein FliM [Pseudomonas sp. TJI-51]
 gi|324101325|gb|EGB98940.1| flagellar motor switch protein FliM [Pseudomonas sp. TJI-51]
          Length = 322

 Score = 41.2 bits (95), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 45/254 (17%), Positives = 93/254 (36%), Gaps = 18/254 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           D++    Q  KF   +HS       +   +              LV  L++N  G     
Sbjct: 78  DVAVGGVQVMKFGEYVHSLYVPTSLNLVKIKPLRGTSLFILDAKLVFKLVDNFFGGDGRH 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E ++ +        VL+QC    +E+   +      +Y+    N  ++
Sbjct: 138 A-KIEGREFTPTELRVVR-------MVLDQCFVDLKEAWQAIMPV-SFEYMNSEVNPAMA 188

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKT-TLISLSSQNKSENQSEDLIDPF 231
           N     E V     ++ ++       + +P   +     ++    Q+  ++Q E  +   
Sbjct: 189 NIVGPSEAVVVSTFHIELDGGGGDLHVTMPYSMIEPVREMLDAGFQSDLDDQDERWVKAL 248

Query: 232 ARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGR 291
                 + V +   +  ++  L+D++ ++ G VIP    E    +L ANG   +   LG 
Sbjct: 249 REDVLDVAVPMTATVARRQLKLRDILHMQPGDVIPVELPEHL--VLRANGVPAFKARLGS 306

Query: 292 VGKNYTIRITDRIN 305
              N  ++I D I 
Sbjct: 307 HKGNLALQIIDPIE 320


>gi|328543159|ref|YP_004303268.1| flagellar motor switch protein FliM [polymorphum gilvum
           SL003B-26A1]
 gi|326412905|gb|ADZ69968.1| Flagellar motor switch protein FliM [Polymorphum gilvum
           SL003B-26A1]
          Length = 411

 Score = 41.2 bits (95), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 49/266 (18%), Positives = 106/266 (39%), Gaps = 16/266 (6%)

Query: 57  DVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASH 116
           +V++S  S  S +F   ++S     +        W     +   ++L+ ++++ LLG   
Sbjct: 143 NVEVSLDSISSVRFGDYLNSIPLPAILGVFKAEEWDGFGLVTVESSLIYSIIDVLLGGGR 202

Query: 117 ETIP-QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNR 175
            T   ++  R  +T+E  L +R +  I A   Q  +       NLE   + +      +R
Sbjct: 203 GTTAVRVEGRPYTTIETNLVRRMVEIILADAEQAFAPLSPVHFNLERL-ETNPRFAAISR 261

Query: 176 LSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLIDP--- 230
            +N  +  + + + +E+   +  +++P  TL  ++  L+ +    K         DP   
Sbjct: 262 PANAAI-LVELRIDMEDRGGTIEIMMPYATLEPIRDLLLQMFMGEKFGR------DPIWE 314

Query: 231 --FARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCE 288
              A + +   + +D  +      L  V++L +GQ + F         +      +    
Sbjct: 315 GHLASEIHAAEIEVDAVLYETHLPLGRVLSLDVGQTLIFDVDPHDPITIKCGNVPLTEGT 374

Query: 289 LGRVGKNYTIRITDRINFDQKSLKNF 314
           LG+V  +  IR+T  +   + +L  F
Sbjct: 375 LGKVEDSIAIRVTRGLRRPKMTLAAF 400


>gi|227873540|ref|ZP_03991785.1| flagellar motor switch protein FliM [Oribacterium sinus F0268]
 gi|227840630|gb|EEJ51015.1| flagellar motor switch protein FliM [Oribacterium sinus F0268]
          Length = 395

 Score = 41.2 bits (95), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 50/216 (23%), Positives = 93/216 (43%), Gaps = 22/216 (10%)

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           S  L +TL+ ++LG S   I    +   + VE  L KR +  I   L    S    +   
Sbjct: 138 SPGLTLTLVSHMLGGSDSVIKTEEDYRYTDVEMALYKRIMEYIVHALGDGFSNYISAE-- 195

Query: 160 LEDFYDIDYLKKNTNRLS----NEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLS 215
               + I  ++ N + +     +E V    MN+ I  +A   + I    TLL+     + 
Sbjct: 196 ----FKIAKIETNPSMVQEVGLDETVVLAVMNVDISGLAMERIRICLPGTLLEHMFKIID 251

Query: 216 SQN------KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLH 269
           ++         EN  + +++     ++ +      ++ + K  ++D+  LK+G VI  L+
Sbjct: 252 NRKHLARGFAYENNQDTIMEHLKASSFPMT----GQLGVVKLDIEDLYHLKVGDVID-LN 306

Query: 270 REKTCAI-LSANGKEIYSCELGRVGKNYTIRITDRI 304
           + K  A+ L    +  ++ ++G   KN  IRI DRI
Sbjct: 307 KAKNSAVKLYVGRQPWFTGKMGVYKKNIAIRIEDRI 342


>gi|225375335|ref|ZP_03752556.1| hypothetical protein ROSEINA2194_00960 [Roseburia inulinivorans DSM
           16841]
 gi|225212824|gb|EEG95178.1| hypothetical protein ROSEINA2194_00960 [Roseburia inulinivorans DSM
           16841]
          Length = 326

 Score = 40.8 bits (94), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 56/287 (19%), Positives = 117/287 (40%), Gaps = 19/287 (6%)

Query: 29  KTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASL 88
           +T+E I    G L    LP   ++ + ++V     + ++  +S   ++     +    ++
Sbjct: 52  RTLEIIFEHYGRLLSTNLPVYLRKTVQVEV----MNSEAVTYSEFTNALSNPVLLGLVNV 107

Query: 89  SSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQ 148
           S  S +  I  ++NL   +++ +LG     + +   R  S +E  + +R      ++L +
Sbjct: 108 SPLSGSIIIELADNLGYAIVDRMLGGLGTPLDK--PRDFSEIELLILERIYNVCVSLLPE 165

Query: 149 CISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL-- 206
             S+  E SP LE         +  +    E +  + +++ I +V     + +P  TL  
Sbjct: 166 PWSSVCEISPRLERIETNSQFAQIIS--PTEMIALVTLHIKIGDVEGLMNICLPYLTLES 223

Query: 207 ----LKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIG 262
               L T     + Q   + Q  D I+    K     + +   +     ++ D V L++G
Sbjct: 224 VMDKLNTKFWYSNLQEHDDKQYTDAIEALISKA---KIPVKAVLGNSTISVDDFVNLQVG 280

Query: 263 QVIPFLHR-EKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
            +I       +   I   N K+ ++   G VG NY +R+T  +  +Q
Sbjct: 281 DIIRLDSGVNQDLNIFVGNIKK-FTALPGAVGDNYAVRVTSVVREEQ 326


>gi|269114813|ref|YP_003302576.1| 1-acyl-SN-glycerol-3-phosphate acyltransferase [Mycoplasma hominis]
 gi|268322438|emb|CAX37173.1| 1-acyl-SN-glycerol-3-phosphate acyltransferase [Mycoplasma hominis
           ATCC 23114]
          Length = 269

 Score = 40.8 bits (94), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 67/145 (46%), Gaps = 18/145 (12%)

Query: 160 LEDFYDI----DYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLS 215
           + D+Y +    D+L++ +N + N F  ++N+    ENV +   LIIP  +     LI  S
Sbjct: 31  MPDYYKVVEKNDFLQQKSNAILNHFNISVNVE-GFENVPNGPCLIIPNHSTYLDPLIMWS 89

Query: 216 S--QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKD-------VVTLK-IGQVI 265
           +   ++  ++   L++  ARK       +    +L +T   D       + TLK  GQ  
Sbjct: 90  ALWNHRDGSKQSKLVNFVARKEITKKKMVKRIADLGQTYYIDTQNPREALATLKDFGQ-- 147

Query: 266 PFLHREKTCAILSANGKEIYSCELG 290
            F+ R K+C ++ A G      +LG
Sbjct: 148 -FIKRNKSCGVIFAEGTRTKDGKLG 171


>gi|307720638|ref|YP_003891778.1| flagellar motor switch protein FliM [Sulfurimonas autotrophica DSM
           16294]
 gi|306978731|gb|ADN08766.1| flagellar motor switch protein FliM [Sulfurimonas autotrophica DSM
           16294]
          Length = 366

 Score = 40.8 bits (94), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 57/272 (20%), Positives = 114/272 (41%), Gaps = 28/272 (10%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
           V+I   S     +   + S      F+  S+     +  I  + ++   +L+ LLG   E
Sbjct: 80  VEIQLHSVDQMTYGEFLMSLPNPTSFNVFSVKPLEGSGIIEINPSIAFPMLDRLLGGKGE 139

Query: 118 TIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQES-SPNLEDFYDIDYLKKNTNRL 176
             P   +R  S +E  L          +L   +ST +E+  P +E +  I+  + + N +
Sbjct: 140 --PFDASREFSDIELSL-------FETILRVMMSTLKEAWGPVMEIYPTIESKESSPNVV 190

Query: 177 S----NEFVTTINMNMTIENVASSFVL---IIPQETLL-----KTTLISLSSQNKSENQS 224
                NE V  + M + I + +    +   +I  E +L     +  +++ +S  KS N  
Sbjct: 191 QIVAQNEIVVMVVMEIIIGHSSGMMNICYPVISLEPVLPKLASRDLMLNETSSKKSRNTE 250

Query: 225 EDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEI 284
             ++   A+      VN++  +     ++ D++ LK+G VI           ++ +GKE 
Sbjct: 251 LKVLLGGAK------VNVEANLGDADLSMHDILELKVGDVIRLSSAANDIVTVAVDGKER 304

Query: 285 YSCELGRVGKNYTIRITDRINFDQKSLKNFLH 316
           +  E+G      +I IT+ I  ++ ++K  L 
Sbjct: 305 FRGEIGLRRFRKSISITEIIETEKDTVKRALE 336


>gi|330828806|ref|YP_004391758.1| flagellar motor switch protein FliM [Aeromonas veronii B565]
 gi|328803942|gb|AEB49141.1| Flagellar motor switch protein FliM [Aeromonas veronii B565]
          Length = 356

 Score = 40.8 bits (94), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 46/254 (18%), Positives = 101/254 (39%), Gaps = 19/254 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S    Q  KF   +H+       +            I     LV  L+EN  G     
Sbjct: 76  EVSINGVQMLKFGEYVHTLFVPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRY 135

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E+++       I  +L       +++   + D    +YL    N  ++
Sbjct: 136 HAKIEGREFTPTERRI-------IQMLLKLVFEDYKDAWAPVMD-VGFEYLDSEVNPAMA 187

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFA 232
           N     E +   + ++ ++     F + +P  ++L+     L +  +S+    D+    A
Sbjct: 188 NIVSPTEVIVVSSFHIELDGGGGDFHVAMPY-SMLEPIRELLDAGVQSDKGDTDVRWSKA 246

Query: 233 RKTYQLNVNIDTRINLKKT--TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
            +   ++V ++ R  L +T  TL++++ L+ G +IP    E     +       +  ++G
Sbjct: 247 LRDEIMDVKVELRAKLLETELTLRELMELRPGDIIPVDMPENLLVFVED--LPTFHAKMG 304

Query: 291 RVGKNYTIRITDRI 304
           R   N  ++ITD++
Sbjct: 305 RTKDNVALKITDKL 318


>gi|149908450|ref|ZP_01897113.1| Flagellar motor switch protein [Moritella sp. PE36]
 gi|149808613|gb|EDM68548.1| Flagellar motor switch protein [Moritella sp. PE36]
          Length = 350

 Score = 40.8 bits (94), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 44/253 (17%), Positives = 94/253 (37%), Gaps = 17/253 (6%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S    Q  KF   +H+       +            +     LV  L+EN  G     
Sbjct: 77  EVSINGVQMLKFGEYVHTLFVPTSLNMVRFRPLKGTALVTMEARLVFILVENFFGGDGRY 136

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E+++       I  +L        E+   + D  + +YL    N  ++
Sbjct: 137 HAKIEGREFTPTERRI-------IQMLLKIVFEDYHEAWAPVMD-AEFEYLDSEVNPAMA 188

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKT-TLISLSSQNKSENQSEDLIDPF 231
           N     E V   + ++ ++     F + +P   L     L+    Q+  E+  E      
Sbjct: 189 NIVSPTEVVVVSSFHIELDGGGGDFHITMPYSMLEPIRELLDAGVQSDKEDTDERWSSAL 248

Query: 232 ARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGR 291
             +   + V + T++   + T+  ++ L++G +IP    E+    +       Y  +LGR
Sbjct: 249 QEEILDVPVELSTKLLETELTIGQIMELRVGDIIPIEMPEELTVFIEDLPS--YKAKLGR 306

Query: 292 VGKNYTIRITDRI 304
              N  ++I+ ++
Sbjct: 307 NKDNVAVKISRKL 319


>gi|311695206|gb|ADP98079.1| flagellar motor switch protein FliM-like protein [marine bacterium
           HP15]
          Length = 332

 Score = 40.8 bits (94), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 49/257 (19%), Positives = 98/257 (38%), Gaps = 18/257 (7%)

Query: 54  MDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLG 113
           M  + D+S    Q  KF   IH+       +   +              LV  L++N  G
Sbjct: 71  MRRNADVSTGGVQIMKFGEYIHTLYVPTSLNLCKVRPLRGTSLFVLDAKLVFKLVDNFFG 130

Query: 114 ASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNT 173
                  ++  R  +  E ++       +  VL+Q     +E+   +    D +YL    
Sbjct: 131 GEGRH-AKIEGREFTPTETRI-------VQMVLDQVFHDMKEAWHAVLKV-DFEYLSSEV 181

Query: 174 N-RLSN-----EFVTTINMNMTIENVASSFVLIIPQETLLKT-TLISLSSQNKSENQSED 226
           N  ++N     E V     ++ ++         +P   +     ++    Q+  ++  E 
Sbjct: 182 NPAMANIVSPSEVVVVSTFHIELDGGGGELHFALPYSMIEPIRDVLDAGVQSDIDDVDER 241

Query: 227 LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYS 286
            ++       +++V I+T +  ++ +L+D+  +K G +IP    E     ++ANG  IY 
Sbjct: 242 WVNALQEDIKEVSVPINTTVCRRRISLRDIAKMKAGDIIPVEIPEHLT--VTANGIPIYK 299

Query: 287 CELGRVGKNYTIRITDR 303
             LG       +RI +R
Sbjct: 300 ATLGTRDGKLALRIHER 316


>gi|28869173|ref|NP_791792.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213967550|ref|ZP_03395698.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           tomato T1]
 gi|301382887|ref|ZP_07231305.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           tomato Max13]
 gi|302061097|ref|ZP_07252638.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           tomato K40]
 gi|302131287|ref|ZP_07257277.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|28852413|gb|AAO55487.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213927851|gb|EEB61398.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           tomato T1]
 gi|330964686|gb|EGH64946.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           actinidiae str. M302091]
 gi|331016994|gb|EGH97050.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 322

 Score = 40.8 bits (94), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 42/239 (17%), Positives = 88/239 (36%), Gaps = 18/239 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           D++    Q  KF   +HS       + A +              LV  L++N  G     
Sbjct: 78  DVAVGGVQVMKFGEYVHSLYVPTSLNLAKIKPLRGTALFILDAKLVFKLVDNFFGGDGRH 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E ++ +  + Q    L +      E         + +Y+    N  ++
Sbjct: 138 A-KIEGREFTPTELRVVRMVLDQAFIDLKEAWQAIME--------VNFEYINSEVNPAMA 188

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKT-TLISLSSQNKSENQSEDLIDPF 231
           N     E V     ++ ++       + +P   +     ++    Q+  ++Q E  ++  
Sbjct: 189 NIVGPSEAVVISTFHIELDGGGGDLHVTMPYSMIEPIREMLDAGFQSDLDDQDERWVNAL 248

Query: 232 ARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
                 +NV + T I  ++  L+D++ ++ G VIP         +L ANG   +  +LG
Sbjct: 249 KEDVLDVNVPLTTTIAQRQLPLRDILHMRPGDVIPV--ELSDTLVLRANGVPSFKVKLG 305


>gi|330961230|gb|EGH61490.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 252

 Score = 40.8 bits (94), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 41/239 (17%), Positives = 88/239 (36%), Gaps = 18/239 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           D++    Q  KF   +HS       + A +              LV  L++N  G     
Sbjct: 8   DVAVGGVQVMKFGEYVHSLYVPTSLNLAKIKPLRGTALFILDAKLVFKLVDNFFGGDGRH 67

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E ++ +  + Q    L +      E         + +Y+    N  ++
Sbjct: 68  A-KIEGREFTPTELRVVRMVLDQAFIDLKEAWQAIME--------VNFEYINSEVNPAMA 118

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKT-TLISLSSQNKSENQSEDLIDPF 231
           N     E V     ++ ++       + +P   +     ++    Q+  ++Q E  ++  
Sbjct: 119 NIVGPSEAVVISTFHIELDGGGGDLHVTMPYSMIEPIREMLDAGFQSDLDDQDERWVNAL 178

Query: 232 ARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
                 +NV + T I  ++  L+D++ ++ G VIP         ++ ANG   +  +LG
Sbjct: 179 KEDVLDVNVPLTTTIAQRQLPLRDILHMRPGDVIPV--ELSDSLVMRANGVPSFKVKLG 235


>gi|66046676|ref|YP_236517.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           syringae B728a]
 gi|289678975|ref|ZP_06499865.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           syringae FF5]
 gi|63257383|gb|AAY38479.1| Flagellar motor switch protein FliM [Pseudomonas syringae pv.
           syringae B728a]
 gi|330972446|gb|EGH72512.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 322

 Score = 40.8 bits (94), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 41/239 (17%), Positives = 88/239 (36%), Gaps = 18/239 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           D++    Q  KF   +HS       + A +              LV  L++N  G     
Sbjct: 78  DVAVGGVQVMKFGEYVHSLYVPTSLNLAKIKPLRGTALFILDAKLVFKLVDNFFGGDGRH 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E ++ +  + Q    L +      E         + +Y+    N  ++
Sbjct: 138 A-KIEGREFTPTELRVVRMVLDQAFVDLKEAWQAIME--------VNFEYINSEVNPAMA 188

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKT-TLISLSSQNKSENQSEDLIDPF 231
           N     E V     ++ ++       + +P   +     ++    Q+  ++Q E  ++  
Sbjct: 189 NIVGPSEAVVISTFHIELDGGGGDLHVTMPYSMIEPIREMLDAGFQSDLDDQDERWVNAL 248

Query: 232 ARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
                 +NV + T I  ++  L+D++ ++ G VIP         ++ ANG   +  +LG
Sbjct: 249 KEDVLDVNVPLTTTIAQRQLPLRDILHMRPGDVIPV--ELSDSLVMRANGVPSFKVKLG 305


>gi|34557954|ref|NP_907769.1| flagellar motor switch protein FliM [Wolinella succinogenes DSM
           1740]
 gi|34483672|emb|CAE10669.1| FLAGELLAR MOTOR SWITCH PROTEIN FLIM [Wolinella succinogenes]
          Length = 354

 Score = 40.8 bits (94), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 56/273 (20%), Positives = 111/273 (40%), Gaps = 30/273 (10%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
           V+I   S     +   + S      F+  S+        +  + ++   +++ LLG   +
Sbjct: 79  VEIQLHSVDQMTYGEFLMSLPSPTSFNVFSMKPLDGTGVLEINPSIAFPMIDRLLGGKGD 138

Query: 118 TIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQES-SPNLEDFYDIDYLKKNTNRL 176
             P    R  S +E  L       +  +L Q +   +E+ +P  E F  +D  + + N +
Sbjct: 139 --PYEATREFSDIELNL-------LDTILRQMMQNLKEAWAPVAEIFPSVDAKESSPNVV 189

Query: 177 S----NEFVTTINMNMTIENVASSFVL---IIPQETLL-----KTTLISLSSQNKSENQS 224
                NE V  + M + I + +    L   +I  E++L     +  ++S +S  KS N+ 
Sbjct: 190 QIVAQNEIVIMVVMEIIIGHSSGMMNLCYPVISLESVLSRLASRDLMLSETSSKKSRNRE 249

Query: 225 -EDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKE 283
            + L+   A       VNI   +      LK+V+ L +G ++          I++ +G+E
Sbjct: 250 LQALLGGAA-------VNISAVLGGTSLDLKEVLELGVGDIVRLDRPADDTVIVNVDGRE 302

Query: 284 IYSCELGRVGKNYTIRITDRINFDQKSLKNFLH 316
            Y   +G      T++I + I  ++  +K  L 
Sbjct: 303 KYIATIGLQRYRKTVKIKEVIKTEKDQVKEILE 335


>gi|82702481|ref|YP_412047.1| flagellar motor switch protein FliM [Nitrosospira multiformis ATCC
           25196]
 gi|82410546|gb|ABB74655.1| flagellar motor switch protein FliM [Nitrosospira multiformis ATCC
           25196]
          Length = 326

 Score = 40.8 bits (94), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 42/207 (20%), Positives = 82/207 (39%), Gaps = 21/207 (10%)

Query: 103 LVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLED 162
           LV  +++NL G     +P+   R  +  E+++ +R       +LN    +  +S      
Sbjct: 121 LVFLVVDNLFGGDGRFLPKTEGRDFTQTEQRIIQR-------LLNLVFDSYGKS---WHP 170

Query: 163 FYDID--YLKKNTN------RLSNEFVTTINMNMTIENVASSFVLIIPQETLLKT-TLIS 213
            Y I+  YL+  TN         NE V      +   +V     + +P   L     L+S
Sbjct: 171 VYPIEFEYLRAETNTQFANVATPNEVVVATTFEVNFGSVVGEMHICMPYSILEPIRDLLS 230

Query: 214 LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKT 273
            + Q ++    +  +   +++     V +   +   +  L  ++ +K+G VIP    E  
Sbjct: 231 STLQGEALEVDKRWVGRLSKQVQSAEVTLLANLTHAQVRLDQILNMKVGDVIPLDIPEFV 290

Query: 274 CAILSANGKEIYSCELGRVGKNYTIRI 300
            A  S +G  +  C+ G     Y +R+
Sbjct: 291 TA--SVDGVPVMECKYGISNGRYALRM 315


>gi|256830498|ref|YP_003159226.1| flagellar motor switch protein FliM [Desulfomicrobium baculatum DSM
           4028]
 gi|256579674|gb|ACU90810.1| flagellar motor switch protein FliM [Desulfomicrobium baculatum DSM
           4028]
          Length = 325

 Score = 40.4 bits (93), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 41/216 (18%), Positives = 86/216 (39%), Gaps = 18/216 (8%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
           VD++  S    KF   + S       +   +     N  +     LV +L+EN  G +  
Sbjct: 77  VDVNPISIDMSKFGDFMRSLPVPTSINIFKIDPLRGNALLVVDTRLVFSLVENFFGGAGS 136

Query: 118 TIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNR-- 175
             P++  R  + +E+ +  + +  I A L        E S        I+ L+   N   
Sbjct: 137 Q-PKIEGRDFTPIEQSIIVKVVKIILANLEDAWRPVHEVS--------IELLRSEINPQF 187

Query: 176 ----LSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLID 229
                 ++ V  I+  + +EN   S VL +P  T+  +++ L + + Q +        I 
Sbjct: 188 ATIVPPSDVVVVISFEVELENALGSMVLALPYATIEPIRSKLYA-AFQTERLEIDHAWIS 246

Query: 230 PFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVI 265
            F  +  +  V+++      + T + ++ +K+G ++
Sbjct: 247 RFRDRLMETPVDMNVTFGTTQITGRQLLDMKVGDIL 282


>gi|77457773|ref|YP_347278.1| flagellar motor switch protein FliM [Pseudomonas fluorescens Pf0-1]
 gi|77381776|gb|ABA73289.1| flagellar motor switch protein [Pseudomonas fluorescens Pf0-1]
          Length = 322

 Score = 40.4 bits (93), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 40/253 (15%), Positives = 94/253 (37%), Gaps = 18/253 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           D++    Q  KF   +HS       +   +              LV  L++N  G     
Sbjct: 78  DVAVGGVQVMKFGEYVHSLYVPTSLNLVKIKPLRGTALFILDAKLVFKLVDNFFGGDGRH 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E ++ +  + Q    L +      E         + +Y+    N  ++
Sbjct: 138 A-KIEGREFTPTELRVVRMVLEQAFVDLKEAWQAIME--------VNFEYINSEVNPAMA 188

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKT-TLISLSSQNKSENQSEDLIDPF 231
           N     E +     ++ ++       + +P   +     ++    Q+  ++Q E  ++  
Sbjct: 189 NIVGPSEAIVVSTFHIELDGGGGDLHVTMPYSMIEPVREMLDAGFQSDLDDQDERWVNAL 248

Query: 232 ARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGR 291
            +    ++V I   +  ++  L+D++ ++ G VIP    E    I+ ANG   +  ++G 
Sbjct: 249 RQDVLDVDVPIGATVARRQLKLRDILHMQPGDVIPVEMPEDM--IMRANGVPAFKVKMGS 306

Query: 292 VGKNYTIRITDRI 304
              N  +++ + I
Sbjct: 307 HKGNLALQVIEPI 319


>gi|117619656|ref|YP_855911.1| flagellar motor switch protein FliM [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117561063|gb|ABK38011.1| flagellar motor switch protein FliM [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 356

 Score = 40.4 bits (93), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 46/254 (18%), Positives = 101/254 (39%), Gaps = 19/254 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S    Q  KF   +H+       +            I     LV  L+EN  G     
Sbjct: 76  EVSINGVQMLKFGEYVHTLFVPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRY 135

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E+++       I  +L       +++   + D    +YL    N  ++
Sbjct: 136 HAKIEGREFTPTERRI-------IQMLLKLVFEDYKDAWAPVMD-VGFEYLDSEVNPAMA 187

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFA 232
           N     E +   + ++ ++     F + +P  ++L+     L +  +S+    D+    A
Sbjct: 188 NIVSPTEVIVVSSFHIELDGGGGDFHVAMPY-SMLEPIRELLDAGVQSDKGDTDVRWSKA 246

Query: 233 RKTYQLNVNIDTRINLKKT--TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
            +   ++V ++ R  L +T  TL++++ L+ G +IP    E     +       +  ++G
Sbjct: 247 LRDEIMDVKVELRAKLLETELTLRELMELQPGDIIPVEMPENLLVFVED--LPTFHAKMG 304

Query: 291 RVGKNYTIRITDRI 304
           R   N  ++ITD++
Sbjct: 305 RTKDNVALKITDKL 318


>gi|311992317|gb|ADQ26732.1| flagellar motor switch protein [Aeromonas hydrophila]
          Length = 356

 Score = 40.4 bits (93), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 46/254 (18%), Positives = 101/254 (39%), Gaps = 19/254 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S    Q  KF   +H+       +            I     LV  L+EN  G     
Sbjct: 76  EVSINGVQMLKFGEYVHTLFVPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRY 135

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E+++       I  +L       +++   + D    +YL    N  ++
Sbjct: 136 HAKIEGREFTPTERRI-------IQMLLKLVFEDYKDAWAPVMD-VGFEYLDSEVNPAMA 187

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFA 232
           N     E +   + ++ ++     F + +P  ++L+     L +  +S+    D+    A
Sbjct: 188 NIVSPTEVIVVSSFHIELDGGGGDFHVAMPY-SMLEPIRELLDAGVQSDKGDTDVRWSKA 246

Query: 233 RKTYQLNVNIDTRINLKKT--TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
            +   ++V ++ R  L +T  TL++++ L+ G +IP    E     +       +  ++G
Sbjct: 247 LRDEIMDVKVELRAKLLETELTLRELMELQPGDIIPVEMPENLLVFV--EDLPTFHAKMG 304

Query: 291 RVGKNYTIRITDRI 304
           R   N  ++ITD++
Sbjct: 305 RTKDNVALKITDKL 318


>gi|309779462|ref|ZP_07674223.1| flagellar motor switch protein FliM [Ralstonia sp. 5_7_47FAA]
 gi|308921703|gb|EFP67339.1| flagellar motor switch protein FliM [Ralstonia sp. 5_7_47FAA]
          Length = 336

 Score = 40.4 bits (93), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 39/208 (18%), Positives = 84/208 (40%), Gaps = 9/208 (4%)

Query: 102 NLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLE 161
           NL+  +++NL G       ++  R  + VE+++ +R    +  V        Q   P   
Sbjct: 122 NLIFLVVDNLFGGDGRFHMRVEGRDFTDVEQRIIQR---MLHLVFEHYAKAWQPVYPIDF 178

Query: 162 DFYDIDYLKKNTNRLS-NEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKS 220
           +F  ++   +  N  + NE V T + ++ + +      + +P  T+++     L+S  + 
Sbjct: 179 EFLRMEMHTEFANVATPNEVVITTSFSIELGSNGGDVHICMPY-TMIEPIRDRLTSAIQG 237

Query: 221 ENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           E    D   +   +++     V +   +   K  + D++ +K+G VIP       C    
Sbjct: 238 EALEVDKRWLRLLSQQVQTAEVELIADLATAKVQVSDILNMKVGDVIPL--ELDDCVTAK 295

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINF 306
            +G  +  C  G     Y +R+   +N 
Sbjct: 296 VDGVPVMECNYGTFNGQYALRVNRMLNM 323


>gi|242309556|ref|ZP_04808711.1| flagellar motor switch protein FliM [Helicobacter pullorum MIT
           98-5489]
 gi|239524127|gb|EEQ63993.1| flagellar motor switch protein FliM [Helicobacter pullorum MIT
           98-5489]
          Length = 352

 Score = 40.0 bits (92), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 53/272 (19%), Positives = 112/272 (41%), Gaps = 28/272 (10%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
           V+I   S     +   + S      F+  S+        +  + ++   +++ LLG   +
Sbjct: 80  VEIQLHSVDQMTYGEFLMSLPSPTSFNVFSMKPLDGTGVLEINPSIAFPMIDRLLGGKGD 139

Query: 118 TIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQES-SPNLEDFYDIDYLKKNTNRL 176
             P    R  S +E  L       +  +L Q +   +E+ +P  E F ++D  + + N +
Sbjct: 140 --PYESTREFSDIELNL-------LDTILRQMMQNLKEAWAPITEIFPNVDVKESSPNVV 190

Query: 177 S----NEFVTTINMNMTIENVASSFVL---IIPQETLL-----KTTLISLSSQNKSENQS 224
                NE V  + M + I + +    L   +I  E++L     +  ++S +S  KS N+ 
Sbjct: 191 QIVAQNEIVIMVVMEIIIGHSSGMMNLCYPVISLESVLSRLASRDIMLSETSSKKSRNKE 250

Query: 225 EDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEI 284
              +   A+      VN+   +   K TL++++ L+ G ++          I++ +G+E 
Sbjct: 251 LQALLGGAK------VNVTAMLGETKLTLREILELESGDIVRLDRPADDTVIINVDGREK 304

Query: 285 YSCELGRVGKNYTIRITDRINFDQKSLKNFLH 316
           +   +G      TI + + I  ++  +K  L 
Sbjct: 305 FLASIGLHRYRKTIEVKEMIKTEKDQVKEILE 336


>gi|237799245|ref|ZP_04587706.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331022100|gb|EGI02157.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 322

 Score = 40.0 bits (92), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 41/239 (17%), Positives = 88/239 (36%), Gaps = 18/239 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           D++    Q  KF   +HS       + A +              LV  L++N  G     
Sbjct: 78  DVAVGGVQVMKFGEYVHSLYVPTSLNLAKIKPLRGTALFILDAKLVFKLVDNFFGGDGRH 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E ++ +  + Q    L +      E         + +Y+    N  ++
Sbjct: 138 A-KIEGREFTPTELRVVRMVLDQAFIDLKEAWQAIME--------VNFEYINSEVNPAMA 188

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKT-TLISLSSQNKSENQSEDLIDPF 231
           N     E V     ++ ++       + +P   +     ++    Q+  ++Q E  ++  
Sbjct: 189 NIVGPSEAVVISTFHIELDGGGGDLHVTMPYSMIEPIREMLDAGFQSDLDDQDERWVNAL 248

Query: 232 ARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
                 +NV + T I  ++  L+D++ ++ G VIP         ++ ANG   +  +LG
Sbjct: 249 KEDVLDVNVPLTTTIAQRQLPLRDILHMRPGDVIPV--ELSDSLVMRANGVPSFKVKLG 305


>gi|326796458|ref|YP_004314278.1| flagellar motor switch protein FliM [Marinomonas mediterranea
           MMB-1]
 gi|326547222|gb|ADZ92442.1| flagellar motor switch protein FliM [Marinomonas mediterranea
           MMB-1]
          Length = 329

 Score = 40.0 bits (92), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 56/268 (20%), Positives = 109/268 (40%), Gaps = 27/268 (10%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSW----SSNFFIGCSNNLVITLLENLLG 113
            D+S    Q  KF   +H+    +V +  +L  +    S+  FI     LV  L++N  G
Sbjct: 75  ADVSSGGLQIMKFGEYVHTL---YVPTSLNLVKFRPLRSTALFI-LDAKLVFKLVDNFFG 130

Query: 114 ASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNT 173
                  ++  R  +  E ++ +  + Q+       +  T+  +P L+   +++Y+    
Sbjct: 131 GDGRH-AKIEGREFTPTEIRIVQLMLEQV------FVDLTEAWAPVLK--LELEYISSEV 181

Query: 174 N-RLSN-----EFVTTINMNMTIENVASSFVLIIPQETLLKT-TLISLSSQNKSENQSED 226
           N  ++N     E V     ++ ++       + +P   +     L+    Q+  + + + 
Sbjct: 182 NPAMANIVSPSEVVVVSTFHIELDGGGGELHITLPYSMIEPVRELLDAGVQSDVDEKDDR 241

Query: 227 LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYS 286
                 +    ++VN+   I  KK TL DV+  K G VIP    E     + AN    + 
Sbjct: 242 WGKSLEQDVQDVDVNLHVNIASKKITLGDVLKFKTGDVIPIEMPEYVT--VRANNVPTFR 299

Query: 287 CELGRVGKNYTIRITDRINFDQK-SLKN 313
            +LG     Y++++ + I    K SLKN
Sbjct: 300 GKLGSSNGKYSVQMKESIKAQMKESLKN 327


>gi|289523560|ref|ZP_06440414.1| flagellar motor switch protein FliM [Anaerobaculum hydrogeniformans
           ATCC BAA-1850]
 gi|289503252|gb|EFD24416.1| flagellar motor switch protein FliM [Anaerobaculum hydrogeniformans
           ATCC BAA-1850]
          Length = 342

 Score = 39.7 bits (91), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 41/215 (19%), Positives = 95/215 (44%), Gaps = 15/215 (6%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
           V +   S +   +   I S  +  V     +   SSN  +  +  LV  +++ +LG + +
Sbjct: 79  VSVEVASVEQLSYDEFIKSLVQPTVIVVMEMYPLSSNALLEINPRLVFAIIDRMLGGAGK 138

Query: 118 TIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLS 177
           T  +   R L+ +E+ + +R + ++  +L +  +T  +    +++     Y  +     +
Sbjct: 139 TTYK--ARELTDIERTVTERVVMRMLELLEESWATIVDLRFRIQNMESNPYFAQICP--A 194

Query: 178 NEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQ-------NKSENQSEDLIDP 230
           ++ V  I + + I +V     + IP    ++  +  LSSQ       ++ ++ S++ I  
Sbjct: 195 SDVVVVITLQVKIGDVDGFINICIPY-FAIEPVIDQLSSQRWFVSTGSREDDASQERI-- 251

Query: 231 FARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVI 265
              +  ++ V +   I      LKD++ L++G VI
Sbjct: 252 -IERLSKVKVPVTVEIGHVDVMLKDILKLRVGDVI 285


>gi|119775425|ref|YP_928165.1| flagellar motor switch protein FliM [Shewanella amazonensis SB2B]
 gi|119767925|gb|ABM00496.1| flagellar motor switch protein FliM [Shewanella amazonensis SB2B]
          Length = 342

 Score = 39.7 bits (91), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 45/254 (17%), Positives = 102/254 (40%), Gaps = 19/254 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S    Q  KF   +H+       +            I     LV  L++N  G     
Sbjct: 75  EVSINGVQMLKFGEYVHTLFVPTSLNMVRFQPLKGTALITMEARLVFILVDNFFGGDGRF 134

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E+++       +  +L       +++   + D  + DYL    N  ++
Sbjct: 135 HAKIEGREFTPTERRI-------VQLLLKIIFEDYKDAWAPVMDV-EFDYLDSEVNPAMA 186

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFA 232
           N     E V   + ++ ++     F + +P  ++++     L +  +S+ Q  D+    A
Sbjct: 187 NIVSPTEVVVVNSFHIEVDGGGGDFHITMPY-SMIEPIRELLDAGVQSDKQDTDMRWSQA 245

Query: 233 RKTYQLNVNI--DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
            K   ++V +  +  +   + +L+DV+ ++ G VIP    E    ++       Y C+LG
Sbjct: 246 LKDEIMDVEVGFEATVVEHQISLRDVMEMQAGDVIPVELPE--YVLMKIEELPTYRCKLG 303

Query: 291 RVGKNYTIRITDRI 304
           +  +   ++I ++I
Sbjct: 304 KSREQLALKICEKI 317


>gi|260767699|ref|ZP_05876634.1| flagellar motor switch protein FliM [Vibrio furnissii CIP 102972]
 gi|260617208|gb|EEX42392.1| flagellar motor switch protein FliM [Vibrio furnissii CIP 102972]
 gi|315179469|gb|ADT86383.1| flagellar motor switch protein FliM [Vibrio furnissii NCTC 11218]
          Length = 352

 Score = 39.7 bits (91), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 39/211 (18%), Positives = 96/211 (45%), Gaps = 21/211 (9%)

Query: 103 LVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQES-SPNLE 161
           LV  L+EN  G       ++  R  +  E+++       I  +L       +++ +P + 
Sbjct: 121 LVFILVENFFGGDGRYHARIEGREFTPTERRV-------IQLLLKIVFGDYKDAWAPVMG 173

Query: 162 DFYDIDYLKKNTN-RLSN-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLS 215
              + +YL    N  ++N     E +   + ++ ++     F +++P  ++++     L 
Sbjct: 174 --VEFEYLDSEVNPSMANIVSPTEVIVVSSFHIEVDGGGGDFHIVMPY-SMVEPIRELLD 230

Query: 216 SQNKSENQSEDLIDPFARKTYQLNVNIDTRINL--KKTTLKDVVTLKIGQVIPFLHREKT 273
           +  +S+    D+    A +   ++V ++ R+NL  +   L+D++ L++G +IP    E  
Sbjct: 231 AGVQSDKMETDVRWSSALREEIMDVPVNFRVNLLEQDLALRDLMELQVGDIIPIKMPEH- 289

Query: 274 CAILSANGKEIYSCELGRVGKNYTIRITDRI 304
            A +       Y  ++GR G+   ++++++I
Sbjct: 290 -ATMFVEELPTYRVKMGRSGEKLAVQVSEKI 319


>gi|90579934|ref|ZP_01235742.1| flagellar motor switch protein [Vibrio angustum S14]
 gi|90438819|gb|EAS64002.1| flagellar motor switch protein [Vibrio angustum S14]
          Length = 349

 Score = 39.7 bits (91), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 42/218 (19%), Positives = 96/218 (44%), Gaps = 21/218 (9%)

Query: 96  FIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQE 155
            I     LV  L+EN  G       ++  R  +  E+++       +  +L       +E
Sbjct: 113 LITMEARLVFILVENFFGGDGRFHAKIEGREFTPTERRI-------VQMLLKLVFEDYRE 165

Query: 156 S-SPNLEDFYDIDYLKKNTNR-LSN-----EFVTTINMNMTIENVASSFVLIIPQETLLK 208
           + SP +    + +YL    N  ++N     E +   + ++ ++     F +++P  ++++
Sbjct: 166 AWSPVMG--VEFEYLDSEVNPTMANIVSPTEVIVVSSFHIEVDGGGGDFHVVMPY-SMVE 222

Query: 209 TTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT--TLKDVVTLKIGQVIP 266
                L +  +S+    D+    A +   ++V ++ R  L     +L+D++ L++G VIP
Sbjct: 223 PIRELLDAGVQSDKMDTDVRWSKALRDEIMDVPVNLRAKLLDVDLSLRDLMELQVGDVIP 282

Query: 267 FLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
               E+  A +       Y  ++GR G N  ++I++++
Sbjct: 283 IDMPEQ--ATIFVEDLPTYHAKMGRSGDNVALKISEKL 318


>gi|89075520|ref|ZP_01161931.1| flagellar motor switch protein [Photobacterium sp. SKA34]
 gi|89048792|gb|EAR54363.1| flagellar motor switch protein [Photobacterium sp. SKA34]
          Length = 349

 Score = 39.7 bits (91), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 42/218 (19%), Positives = 96/218 (44%), Gaps = 21/218 (9%)

Query: 96  FIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQE 155
            I     LV  L+EN  G       ++  R  +  E+++       +  +L       +E
Sbjct: 113 LITMEARLVFILVENFFGGDGRFHAKIEGREFTPTERRI-------VQMLLKLVFEDYRE 165

Query: 156 S-SPNLEDFYDIDYLKKNTNR-LSN-----EFVTTINMNMTIENVASSFVLIIPQETLLK 208
           + SP +    + +YL    N  ++N     E +   + ++ ++     F +++P  ++++
Sbjct: 166 AWSPVMG--VEFEYLDSEVNPTMANIVSPTEVIVVSSFHIEVDGGGGDFHVVMPY-SMVE 222

Query: 209 TTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT--TLKDVVTLKIGQVIP 266
                L +  +S+    D+    A +   ++V ++ R  L     +L+D++ L++G VIP
Sbjct: 223 PIRELLDAGVQSDKMDTDVRWSKALRDEIMDVPVNLRAKLLDVDLSLRDLMELQVGDVIP 282

Query: 267 FLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
               E+  A +       Y  ++GR G N  ++I++++
Sbjct: 283 IDMPEQ--ATIFVEDLPTYHAKMGRSGDNVALKISEKL 318


>gi|330445373|ref|ZP_08309025.1| flagellar motor switch protein FliM [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328489564|dbj|GAA03522.1| flagellar motor switch protein FliM [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 349

 Score = 39.3 bits (90), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 42/218 (19%), Positives = 96/218 (44%), Gaps = 21/218 (9%)

Query: 96  FIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQE 155
            I     LV  L+EN  G       ++  R  +  E+++       +  +L       +E
Sbjct: 113 LITMEARLVFILVENFFGGDGRFHAKIEGREFTPTERRI-------VQMLLKLVFEDYRE 165

Query: 156 S-SPNLEDFYDIDYLKKNTNR-LSN-----EFVTTINMNMTIENVASSFVLIIPQETLLK 208
           + SP +    + +YL    N  ++N     E +   + ++ ++     F +++P  ++++
Sbjct: 166 AWSPVMG--VEFEYLDSEVNPTMANIVSPTEVIVVSSFHIEVDGGGGDFHVVMPY-SMVE 222

Query: 209 TTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT--TLKDVVTLKIGQVIP 266
                L +  +S+    D+    A +   ++V ++ R  L     +L+D++ L++G VIP
Sbjct: 223 PIRELLDAGVQSDKMDTDVRWSKALRDEIMDVPVNLRAKLLDVDLSLRDLMELQVGDVIP 282

Query: 267 FLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
               E+  A +       Y  ++GR G N  ++I++++
Sbjct: 283 IDMPEQ--ATIFIEDLPTYHAKMGRSGDNVALKISEKL 318


>gi|332305666|ref|YP_004433517.1| flagellar motor switch protein FliM [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332172995|gb|AEE22249.1| flagellar motor switch protein FliM [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 352

 Score = 39.3 bits (90), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 46/255 (18%), Positives = 99/255 (38%), Gaps = 19/255 (7%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
            ++S    Q  KF   IH+       +            I     LV  L++N  G    
Sbjct: 76  AEVSINGIQMIKFGEYIHTLFVPTSLNMVRFRPLKGTGLITMEARLVFILVDNFFGGDGR 135

Query: 118 TIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RL 176
              ++  R  +  E+++ +  +  I     +  +   + S         +YL    N  +
Sbjct: 136 YHAKIEGREFTPTERRIIQMLLKLIFEDYKEAWAPVMDVS--------FEYLDSEVNPAM 187

Query: 177 SN-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPF 231
           +N     E V   + ++ ++     F + +P  ++L+     L +  +S+ +  DL    
Sbjct: 188 ANIVSPTEVVVISSFHIELDGGGGDFHVSLPY-SMLEPIRELLDAGVQSDKEDTDLRWSK 246

Query: 232 ARKTYQLNVNIDTRINLKKTTL--KDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCEL 289
           A +   ++V ++   ++   TL  + ++ +K G +IP    E    ++       +  +L
Sbjct: 247 ALRDEIMDVKVELSTHMMDLTLSLQKIMDMKAGDIIPIDMPEHITVMIEE--LPTFRAKL 304

Query: 290 GRVGKNYTIRITDRI 304
           GR   N  ++ITD+I
Sbjct: 305 GRSRDNLALKITDKI 319


>gi|109899345|ref|YP_662600.1| flagellar motor switch protein FliM [Pseudoalteromonas atlantica
           T6c]
 gi|109701626|gb|ABG41546.1| flagellar motor switch protein FliM [Pseudoalteromonas atlantica
           T6c]
          Length = 352

 Score = 39.3 bits (90), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 46/255 (18%), Positives = 99/255 (38%), Gaps = 19/255 (7%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
            ++S    Q  KF   IH+       +            I     LV  L++N  G    
Sbjct: 76  AEVSINGIQMIKFGEYIHTLFVPTSLNMVRFRPLKGTGLITMEARLVFILVDNFFGGDGR 135

Query: 118 TIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RL 176
              ++  R  +  E+++ +  +  I     +  +   + S         +YL    N  +
Sbjct: 136 YHAKIEGREFTPTERRIIQMLLKLIFEDYKEAWAPVMDVS--------FEYLDSEVNPAM 187

Query: 177 SN-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPF 231
           +N     E V   + ++ ++     F + +P  ++L+     L +  +S+ +  DL    
Sbjct: 188 ANIVSPTEVVVISSFHIELDGGGGDFHVSLPY-SMLEPIRELLDAGVQSDKEDTDLRWSK 246

Query: 232 ARKTYQLNVNIDTRINLKKTTL--KDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCEL 289
           A +   ++V ++   ++   TL  + ++ +K G +IP    E    ++       +  +L
Sbjct: 247 ALRDEIMDVKVELSTHMMDLTLSLQKIMDMKAGDIIPIDMPEHITVMIEE--LPTFRAKL 304

Query: 290 GRVGKNYTIRITDRI 304
           GR   N  ++ITD+I
Sbjct: 305 GRSRDNLALKITDKI 319


>gi|323697919|ref|ZP_08109831.1| flagellar motor switch protein FliM [Desulfovibrio sp. ND132]
 gi|323457851|gb|EGB13716.1| flagellar motor switch protein FliM [Desulfovibrio desulfuricans
           ND132]
          Length = 325

 Score = 39.3 bits (90), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 47/255 (18%), Positives = 99/255 (38%), Gaps = 26/255 (10%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
           VDI+  S    KF   + S       S   +     N  +   + LV  L+EN  G +  
Sbjct: 77  VDINPISIDMSKFGDFMRSLPVPTSISIFKMDPLRGNALLVVDSRLVFALVENFFGGAGS 136

Query: 118 TIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNR-- 175
             P++  R  + +E+ + +R       V+   ++  +ES   + + + ++ ++   N   
Sbjct: 137 Q-PKVEGRDFTPIEQAIVER-------VVKIALANMEESWKPVHEVH-VEMVRTEVNPQF 187

Query: 176 ----LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDL---- 227
                 ++ V  +   + +EN   S ++ +P       T+  + S+  +  QSE L    
Sbjct: 188 AAIVPPSDVVIVVTFEVELENAIGSLIVCLPY-----ATMEPIRSKLHASFQSERLEVDH 242

Query: 228 --IDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIY 285
             I+ F  +  +  V +  R+     + + ++ L+ G +I     E         G   +
Sbjct: 243 VWINRFKERLMETPVEMVVRLGRTSISGRQLLYLQEGDIILLDTDEDELLEAEVEGVRKF 302

Query: 286 SCELGRVGKNYTIRI 300
               GRV  N + ++
Sbjct: 303 QGLPGRVKGNKSFKV 317


>gi|182418362|ref|ZP_02949657.1| flagellar motor switch protein FliM [Clostridium butyricum 5521]
 gi|237666950|ref|ZP_04526935.1| flagellar motor switch protein FliM [Clostridium butyricum E4 str.
           BoNT E BL5262]
 gi|182377744|gb|EDT75288.1| flagellar motor switch protein FliM [Clostridium butyricum 5521]
 gi|237658149|gb|EEP55704.1| flagellar motor switch protein FliM [Clostridium butyricum E4 str.
           BoNT E BL5262]
          Length = 332

 Score = 39.3 bits (90), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 44/250 (17%), Positives = 104/250 (41%), Gaps = 9/250 (3%)

Query: 57  DVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASH 116
           +V +   + +   +   IHS +   + +   +   + N     +    + +++ LLG + 
Sbjct: 77  NVKVKIETVEQITYEEFIHSVQNPTIITVFKMPPLAGNIIFETNPQFSLQVIDILLGGNG 136

Query: 117 ETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRL 176
           +   ++  +  S ++K + ++    + + L     +  E  P +E       +  N    
Sbjct: 137 DR--KVEAKEFSDIDKNIMRQITTGMISNLKLAWESILEVEPEVEGIETNPAI--NQTLA 192

Query: 177 SNEFVTTINMNMTIENVASSFV-LIIPQ---ETLLKTTLISLSSQNKSENQSEDLIDPFA 232
            N+ V  I  ++ + N  S+F+ + IP    E +L   ++  S +N  E+   +  +   
Sbjct: 193 PNDPVALITFSVEM-NKRSTFINMCIPYLSIEKILDKLVVQYSFKNDDESLKAESREKIE 251

Query: 233 RKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRV 292
              ++++V++   +     T++D + L +G VI    R  +   +    +E Y  + G  
Sbjct: 252 EGIHKVDVDVIAELGKTSLTVEDFLKLNVGDVIKLDTRSSSPIKVYVGNEECYCAKPGVS 311

Query: 293 GKNYTIRITD 302
           GKN  + I D
Sbjct: 312 GKNMGVMILD 321


>gi|312962266|ref|ZP_07776758.1| flagellar motor switch protein FliM [Pseudomonas fluorescens WH6]
 gi|311283603|gb|EFQ62192.1| flagellar motor switch protein FliM [Pseudomonas fluorescens WH6]
          Length = 322

 Score = 39.3 bits (90), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 42/255 (16%), Positives = 95/255 (37%), Gaps = 20/255 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           D++    Q  KF   +HS       +   +              LV  L++N  G     
Sbjct: 78  DVAVGGVQGMKFGEYVHSLYVPTSLNLVKIKPLRGTALFILDAKLVFKLVDNFFGGDGRH 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E ++ +  + Q    L +      E         + +Y+    N  ++
Sbjct: 138 A-KIEGREFTPTELRVVRMVLEQAFIDLKEAWQAIME--------VNFEYINSEVNPAMA 188

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKT-TLISLSSQNKSENQSEDLIDPF 231
           N     E +     ++ ++       + +P   +     ++    Q+  ++Q E  +   
Sbjct: 189 NIVGPSEAIVVSTFHIELDGGGGDLHVTMPYSMIEPVREMLDAGFQSDLDDQDERWVKAL 248

Query: 232 ARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPF-LHREKTCAILSANGKEIYSCELG 290
                 ++V +   +  ++  L+D++ ++ G VIP  L +E    I+ ANG   +  +LG
Sbjct: 249 REDLLDVDVPLSATVARRQLRLRDILHMQPGDVIPVELPQE---MIMRANGVPSFKVKLG 305

Query: 291 RVGKNYTIRITDRIN 305
               N  +++ + IN
Sbjct: 306 SHKGNLALQVIEPIN 320


>gi|146282919|ref|YP_001173072.1| flagellar motor switch protein FliM [Pseudomonas stutzeri A1501]
 gi|145571124|gb|ABP80230.1| flagellar motor switch protein FliM [Pseudomonas stutzeri A1501]
          Length = 342

 Score = 39.3 bits (90), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 47/258 (18%), Positives = 95/258 (36%), Gaps = 28/258 (10%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           D+S    Q  KF   +HS       +   +              LV  L++N  G     
Sbjct: 97  DVSVGGVQVMKFGEYVHSLYVPTSLNLVKMKPLRGTALFILDAKLVFKLVDNFFGGDGRH 156

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E ++ +        VL+Q  +  +E+   + D  + +Y+    N  L+
Sbjct: 157 A-KIEGREFTPTELRVVR-------MVLDQAFADLKEAWHAVLDV-NFEYVNSEVNPALA 207

Query: 178 N-----------EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSED 226
           N            F   ++      +V   + +I P   +L         Q+   +Q E 
Sbjct: 208 NIVSPSEVVVVSTFHIELDSGGGDLHVTMPYSMIEPIREMLDAGF-----QSDVSDQDER 262

Query: 227 LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYS 286
            +         +NV +   +  ++  L+D++ ++ G VIP    E    I+ ANG   + 
Sbjct: 263 WVKALREDILDVNVPLGATVVRRQLKLRDILNMQPGDVIPVEMPEDM--IMRANGMPAFK 320

Query: 287 CELGRVGKNYTIRITDRI 304
            +LG    N  +++ + +
Sbjct: 321 VKLGAHKGNLALQVLEPV 338


>gi|327481259|gb|AEA84569.1| flagellar motor switch protein FliM [Pseudomonas stutzeri DSM 4166]
          Length = 323

 Score = 38.9 bits (89), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 47/258 (18%), Positives = 95/258 (36%), Gaps = 28/258 (10%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           D+S    Q  KF   +HS       +   +              LV  L++N  G     
Sbjct: 78  DVSVGGVQVMKFGEYVHSLYVPTSLNLVKMKPLRGTALFILDAKLVFKLVDNFFGGDGRH 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E ++ +        VL+Q  +  +E+   + D  + +Y+    N  L+
Sbjct: 138 A-KIEGREFTPTELRVVR-------MVLDQAFADLKEAWHAVLDV-NFEYVNSEVNPALA 188

Query: 178 N-----------EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSED 226
           N            F   ++      +V   + +I P   +L         Q+   +Q E 
Sbjct: 189 NIVSPSEVVVVSTFHIELDSGGGDLHVTMPYSMIEPIREMLDAGF-----QSDVSDQDER 243

Query: 227 LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYS 286
            +         +NV +   +  ++  L+D++ ++ G VIP    E    I+ ANG   + 
Sbjct: 244 WVKALREDILDVNVPLGATVVRRQLKLRDILNMQPGDVIPVEMPEDM--IMRANGMPAFK 301

Query: 287 CELGRVGKNYTIRITDRI 304
            +LG    N  +++ + +
Sbjct: 302 VKLGAHKGNLALQVLEPV 319


>gi|163794148|ref|ZP_02188121.1| flagellar motor switch protein FliM [alpha proteobacterium BAL199]
 gi|159180762|gb|EDP65281.1| flagellar motor switch protein FliM [alpha proteobacterium BAL199]
          Length = 341

 Score = 38.9 bits (89), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 51/255 (20%), Positives = 107/255 (41%), Gaps = 16/255 (6%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
           V++S  +  S +F   ++S     + S      W +   +   + L+ ++++ LLG    
Sbjct: 92  VEVSLDNITSIRFGDYLNSIPLPAMLSVFKAEEWDNFGLLVVDSALIYSIVDVLLGGRRG 151

Query: 118 TIP-QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-- 174
           T   ++  R  +T+E+ L +R    ++ VL+   +     SP     +  D L+ N    
Sbjct: 152 TAAMRIEGRPYTTIERNLVER---MVTVVLSDLSAAFDPLSPVT---FRFDRLETNPRFA 205

Query: 175 ---RLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLID 229
              R +N  V    + + +E+      L++P  TL  ++  L+ +    K    S     
Sbjct: 206 TIARPANAAVLA-RLRIDMEDRGGRLELMLPYATLEPVRELLLQMFMGEKFGRDSI-WET 263

Query: 230 PFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCEL 289
             A + +  +V +D  ++     L DV+ LK G  I       +   +      ++S ++
Sbjct: 264 HLANELWNTDVELDAVLDEIVMPLHDVLNLKPGSRILLNAMPNSTIDMRCGNVSLFSGKM 323

Query: 290 GRVGKNYTIRITDRI 304
           GR   +  +RI++R+
Sbjct: 324 GRKNGSIAVRISNRL 338


>gi|119476310|ref|ZP_01616661.1| flagellar motor switch protein M [marine gamma proteobacterium
           HTCC2143]
 gi|119450174|gb|EAW31409.1| flagellar motor switch protein M [marine gamma proteobacterium
           HTCC2143]
          Length = 320

 Score = 38.9 bits (89), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 37/66 (56%), Gaps = 2/66 (3%)

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           VN+  ++  K+  L+D++ LK G VIP         ++SANG  +   +LG+   N  ++
Sbjct: 255 VNMGCKVAEKEVPLRDIIDLKEGDVIPM--EMPGDLVISANGIPMMLAKLGQSKGNLALQ 312

Query: 300 ITDRIN 305
           + ++IN
Sbjct: 313 VVEKIN 318


>gi|88858101|ref|ZP_01132743.1| flagellar motor switch protein [Pseudoalteromonas tunicata D2]
 gi|88819718|gb|EAR29531.1| flagellar motor switch protein [Pseudoalteromonas tunicata D2]
          Length = 364

 Score = 38.9 bits (89), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 47/265 (17%), Positives = 99/265 (37%), Gaps = 18/265 (6%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S    Q  KF   IH+       +            I     LV  L++N  G     
Sbjct: 79  EVSINGVQMIKFGEYIHTLFVPTSLNMVRFRPLKGTGLITMEARLVFILVDNFFGGDGRY 138

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E+++ +  +  I     +  +   + S         +YL    N  ++
Sbjct: 139 HAKIEGREFTPTERRIVQMLLKIIFEDYKEAWAPVMDVS--------FEYLDSEVNPAMA 190

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKT-TLISLSSQNKSENQSEDLIDPF 231
           N     E V   + ++ ++     F + +P   L     L+    Q+ +E+         
Sbjct: 191 NIVSPTEVVVISSFHIELDGGGGDFHIALPYSMLEPIRELLDAGVQSDTEDTDLRWSKAL 250

Query: 232 ARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGR 291
             +   + V + TR+   K +L+ ++ L+ G VIP    E     +       +  ++GR
Sbjct: 251 RDEIMDVEVGLSTRMLEVKLSLEQIMNLQAGDVIPVEMPEHITVFI--EDLPTFRAKMGR 308

Query: 292 VGKNYTIRITDRINFDQKSLKNFLH 316
              N  ++I+++I     S+K+ +H
Sbjct: 309 SRDNVALQISEKIK-RPDSVKSEMH 332


>gi|329901244|ref|ZP_08272769.1| Flagellar motor switch protein FliM [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327549176|gb|EGF33768.1| Flagellar motor switch protein FliM [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 333

 Score = 38.9 bits (89), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 38/206 (18%), Positives = 78/206 (37%), Gaps = 17/206 (8%)

Query: 102 NLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLE 161
           NLV  +++NL G       ++  R  +  E+++ +R +A    V      + +   P   
Sbjct: 120 NLVFLIVDNLFGGDGRFHTRVEGRDFTQTEQRIIQRILA---IVFENYAKSWEPVYP--- 173

Query: 162 DFYDIDYLKKNTN------RLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLS 215
              + +Y++   N         NE V      + +  V+      IP  T+     I  S
Sbjct: 174 --VEFEYIRSEMNTQFANIATPNEVVICTTFTIELGPVSGEMHFCIPYSTIEPIRDILTS 231

Query: 216 S-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTC 274
           S Q ++    +  I    ++     V I     + ++    ++ +K+G +IP    +   
Sbjct: 232 SLQGETLEVDKRWIRLMTQQIQTAEVEIIADFGVARSNFGAILNMKVGDIIPLAVPDVVL 291

Query: 275 AILSANGKEIYSCELGRVGKNYTIRI 300
           A    +G  +  C  G+    Y +R+
Sbjct: 292 A--KVDGVPVMECTYGKFNGQYALRV 315


>gi|118588708|ref|ZP_01546116.1| flagellar motor switch protein M [Stappia aggregata IAM 12614]
 gi|118438694|gb|EAV45327.1| flagellar motor switch protein M [Stappia aggregata IAM 12614]
          Length = 412

 Score = 38.9 bits (89), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 54/271 (19%), Positives = 112/271 (41%), Gaps = 28/271 (10%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
           V++S  S  S +F   ++S     +        W     I   ++L+ ++++ LLG    
Sbjct: 145 VEVSLDSISSVRFGDYLNSIPLPAILGVFKAEEWDGFGLITVESSLIYSIIDVLLGGGRG 204

Query: 118 T-IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNT--- 173
           T   ++  R  +T+E  L ++ +A I   L          SP     ++++ L+ N    
Sbjct: 205 TSAVRVEGRPYTTIETGLVQQMVALI---LQDAEHAFAPLSPV---HFNLERLETNPRFA 258

Query: 174 --NRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLID 229
             +R +N  +  + + + +E+   S  +++P  TL  ++  L+ +    K         D
Sbjct: 259 AISRPANAAI-LVELRIDMEDRGGSVEIMMPYATLEPIRDLLLQMFMGEKFGR------D 311

Query: 230 P-----FARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGK-E 283
           P      A + +   V +D  +      L  V++L +GQ + F  +E T  ++   G   
Sbjct: 312 PIWEGHLATEIHAAEVEVDAVLYETYLPLGRVLSLDVGQTLVF-DKEPTDPVMIKCGNIP 370

Query: 284 IYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
           +    LG+V  +  IR+   +   + +L  F
Sbjct: 371 LTEGTLGKVDDSIAIRVAKNLRKPKMTLAAF 401


>gi|154175307|ref|YP_001408769.1| flagellar motor switch protein FliM [Campylobacter curvus 525.92]
 gi|153793210|gb|EAT99984.2| flagellar motor switch protein FliM [Campylobacter curvus 525.92]
          Length = 366

 Score = 38.9 bits (89), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 56/273 (20%), Positives = 109/273 (39%), Gaps = 28/273 (10%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
           V+I   S     +   + S      F+  S+     N  +  + ++   +++ LLG + E
Sbjct: 81  VEIRLHSVDQMTYGEFLMSLPSPTSFNVFSIKPLDGNCILEINPSIAFPMIDRLLGGTGE 140

Query: 118 TIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFY-DIDYLKKNTNRL 176
                 NR L+ +E  L       + AVL   +   +ES   + D Y +++  + + N +
Sbjct: 141 NFET--NRELTDIEVNL-------LDAVLRMIMQRLKESWAMITDMYPNVEAKESSPNVV 191

Query: 177 S----NEFVTTINMNMTIENVASSFVLIIPQ---ETLL-----KTTLISLSSQNKSENQS 224
                NE V  + M + + N +    L  P    E +L     +  ++  +S  KS N+ 
Sbjct: 192 QIVSQNEIVIMVVMEIIVGNSSGMINLCYPVIYLEPILSRLANRDIMLGETSAKKSRNKE 251

Query: 225 EDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEI 284
              +   A   Y+        +     ++ + + LK G ++         AI+  + KE+
Sbjct: 252 LKTLIGRAEVLYE------AILGKAIVSVSEFLDLKEGDIVRLDRSADDKAIVCIDKKEV 305

Query: 285 YSCELGRVGKNYTIRITDRINFDQKSLKNFLHK 317
           +  E+G      +I+I   I  D+  +KN L K
Sbjct: 306 FLAEVGLHRFRKSIKIEQLIRSDKDEIKNILEK 338


>gi|221069291|ref|ZP_03545396.1| flagellar motor switch protein FliM [Comamonas testosteroni KF-1]
 gi|220714314|gb|EED69682.1| flagellar motor switch protein FliM [Comamonas testosteroni KF-1]
          Length = 334

 Score = 38.5 bits (88), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 45/246 (18%), Positives = 97/246 (39%), Gaps = 11/246 (4%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S  +    ++S  +        F+  ++     N  I C  +LV  +++ L G +   
Sbjct: 78  EVSVGTVTVQRYSAFLRELAVPTNFNIMAIRPLRGNGLIVCDPSLVFGVIDTLYGGTGRL 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLS- 177
             ++  R  ST E+++  R +     V+ +           LE  Y    ++     ++ 
Sbjct: 138 QTRIEGRDFSTTEQRVINRMVN----VICEEYKKAWHGIYPLELAYQRSEMQPQFANIAT 193

Query: 178 -NEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLIDPFARK 234
            +E V +    + I +++ S  + +P  TL  ++  L S S+Q  +       +    R+
Sbjct: 194 PSEIVVSTAFQLEIGDISGSIHICMPYATLEPIRDVLYS-STQGDAIEVDRRWVKVLTRE 252

Query: 235 TYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGK 294
                V +   +     T++ ++ ++ G  I  L RE      S  G  ++ C+ G    
Sbjct: 253 IQAAEVTLVAELARADATVEQLLAMRPGDFIE-LDREPLIR-ASIGGVPVFECQYGTHND 310

Query: 295 NYTIRI 300
            Y IR+
Sbjct: 311 KYAIRV 316


>gi|264676601|ref|YP_003276507.1| flagellar motor switch protein FliM [Comamonas testosteroni CNB-2]
 gi|299531254|ref|ZP_07044664.1| flagellar motor switch protein FliM [Comamonas testosteroni S44]
 gi|262207113|gb|ACY31211.1| flagellar motor switch protein FliM [Comamonas testosteroni CNB-2]
 gi|298720661|gb|EFI61608.1| flagellar motor switch protein FliM [Comamonas testosteroni S44]
          Length = 334

 Score = 38.5 bits (88), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 47/262 (17%), Positives = 101/262 (38%), Gaps = 11/262 (4%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S  +    ++S  +        F+  ++     N  I C  +LV  +++ L G +   
Sbjct: 78  EVSVGTVTVQRYSAFLRELAVPTNFNIMAIRPLRGNGLIVCDPSLVFGVIDTLYGGTGRL 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLS- 177
             ++  R  ST E+++  R +     V+ +           LE  Y    ++     ++ 
Sbjct: 138 QTRIEGRDFSTTEQRVINRMVN----VICEEYKKAWHGIYPLELAYQRSEMQPQFANIAT 193

Query: 178 -NEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLIDPFARK 234
            +E V +    + I +++ S  + +P  TL  ++  L S S+Q  +       +    R+
Sbjct: 194 PSEIVVSTAFQLEIGDISGSIHICMPYATLEPIRDVLYS-STQGDAIEVDRRWVKVLTRE 252

Query: 235 TYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGK 294
                V +   +     T++ ++ ++ G  I  L RE      S  G  ++ C+ G    
Sbjct: 253 IQAAEVTLVAELARADATVEQLLAMRPGDFIE-LDREPLIR-ASIGGVPVFECQYGTHND 310

Query: 295 NYTIRITDRINFDQKSLKNFLH 316
            Y IR+   +   + S     H
Sbjct: 311 KYAIRVERSLRGGETSWMGEKH 332


>gi|304311107|ref|YP_003810705.1| Flagellar motor switch protein [gamma proteobacterium HdN1]
 gi|301796840|emb|CBL45052.1| Flagellar motor switch protein [gamma proteobacterium HdN1]
          Length = 354

 Score = 38.1 bits (87), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 49/254 (19%), Positives = 95/254 (37%), Gaps = 20/254 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           D++    Q  KF   +HS       +   +              LV  L++N  G     
Sbjct: 78  DVAVGGVQVIKFGEYVHSLYVPTSLNMVRIKPLRGTALFILDAKLVFKLVDNFFGGDGRH 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
           + ++  R  +  E ++       +  VL Q     +E+   +      +YL    N  L+
Sbjct: 138 V-KIEGREFTPTENRV-------VQLVLKQAFKDMEEAWKAVLPV-KFEYLSSEVNPALA 188

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLIDP 230
           N     E V     ++ ++       L +P   +  L+  L S   Q+   NQ E  +  
Sbjct: 189 NIVSPSEVVVVNTFHIELDGGGGDLQLTVPYSMIEPLREVLDS-GVQSDVGNQDERWMSS 247

Query: 231 FARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
              +    NV++  ++  +K  L ++  LK G V+     E    ++ AN    Y  +LG
Sbjct: 248 LREEIMGANVHLRCKLLDRKIKLSELAALKTGDVLQVEMPEHV--MIYANEVPTYRGKLG 305

Query: 291 RVGKNYTIRITDRI 304
              + Y ++I +++
Sbjct: 306 TSREKYAVKIAEKV 319


>gi|220934501|ref|YP_002513400.1| flagellar motor switch protein FliM [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995811|gb|ACL72413.1| flagellar motor switch protein FliM [Thioalkalivibrio sp. HL-EbGR7]
          Length = 326

 Score = 38.1 bits (87), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 51/259 (19%), Positives = 101/259 (38%), Gaps = 29/259 (11%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           +IS    +  KFS  +H+       +   +              LV  L++N  G     
Sbjct: 80  EISVGGIKMTKFSEYVHTLFVPTSLNMVKIKPLRGTALFVVDPKLVFILVDNFFGGDGRY 139

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E ++ + T       L+Q  +  +++   + D  D +Y+    N + +
Sbjct: 140 HAKIEGREFTPTELRVIRMT-------LDQAFTDLKKAWAPVMDL-DFEYINSEVNPQFA 191

Query: 178 N-----EFVTTINMNMTIE------NVASSFVLIIPQETLLKTTLISLSSQNKSENQSED 226
           N     E V   + ++ ++      +V   + +I P   LL   +     Q+   +  E 
Sbjct: 192 NIVSPTEVVCVSSFHIELDGGGGDLHVTMPYSMIEPMRELLDAGI-----QSDRSDVDER 246

Query: 227 LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYS 286
            I     +     V + + +     +L+DV+ LK G +IP    E+   +L A G  +  
Sbjct: 247 WIRALRDEVKAAEVELSSMLTETTLSLEDVMRLKPGDIIPIDLPEQV--LLRAEGIPVLR 304

Query: 287 CELGRVGKNY-TIRITDRI 304
            + G V   Y  I++T+RI
Sbjct: 305 GKFG-VSDGYNAIKVTERI 322


>gi|58039165|ref|YP_191129.1| flagellar motor switch protein FliM [Gluconobacter oxydans 621H]
 gi|58001579|gb|AAW60473.1| Flagellar motor switch protein FliM [Gluconobacter oxydans 621H]
          Length = 343

 Score = 38.1 bits (87), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 52/262 (19%), Positives = 101/262 (38%), Gaps = 22/262 (8%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGA--- 114
           V+ S     S +F   + +     +F+      W +   +  S++L+ ++++ LLG    
Sbjct: 78  VEASMDRLGSQRFGDYLENVPGQAMFAVFKAEEWDNYGVVVLSSSLIYSIVDALLGGHVR 137

Query: 115 --SHETIP--QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLK 170
             S  T P  +   R  + +E+ L +  +  I   L    S      P     +  + L+
Sbjct: 138 GDSALTAPASRQTGRHHTAIERALIEPMVRIILDDLETSFS------PLCAVNFHFERLE 191

Query: 171 KNTN-----RLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSE 225
            N+      R  N  VT     + +E       +++P  TL     I L  Q   E    
Sbjct: 192 MNSRFAMICRAGNGVVTA-RFGIDMEGRGGDVDIVLPHATLEPVRDILLQ-QFMGEKFGH 249

Query: 226 DLI--DPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKE 283
           D I  +  AR+ +Q ++ +D  +  +   LKD++ L  G  +    +      L      
Sbjct: 250 DGIWENHLARELWQTDLTLDAVLEEQTMNLKDIMKLAPGDQLVLRRKPDASVSLRCGEHV 309

Query: 284 IYSCELGRVGKNYTIRITDRIN 305
           +++  +GR      ++I D +N
Sbjct: 310 LFTGRVGRKQGQVAVKIEDVLN 331


>gi|317153224|ref|YP_004121272.1| flagellar motor switch protein FliM [Desulfovibrio aespoeensis
           Aspo-2]
 gi|316943475|gb|ADU62526.1| flagellar motor switch protein FliM [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 325

 Score = 38.1 bits (87), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 47/255 (18%), Positives = 99/255 (38%), Gaps = 26/255 (10%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
           VDI+  S    KF   + S       S   +     N  +   + LV  L+EN  G +  
Sbjct: 77  VDINPISIDMSKFGDFMRSLPVPTSISIFKMDPLRGNALLVVDSRLVFALVENFFGGAGS 136

Query: 118 TIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNR-- 175
             P++  R  + +E+ + +R       V+   ++  +ES   + + + ++ ++   N   
Sbjct: 137 Q-PKVEGRDFTPIEQAIVER-------VVKIALANMEESWKPVHEVH-VELVRTEVNPQF 187

Query: 176 ----LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDL---- 227
                 ++ V  +   + +EN   S ++ +P       T+  + S+  +  QSE L    
Sbjct: 188 AAIVPPSDVVIVVTFEVELENAIGSLIVCLPY-----ATMEPIRSKLHASFQSERLEVDH 242

Query: 228 --IDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIY 285
             I+ F  +  +  V +  R+     + + ++ L+ G +I     E         G   +
Sbjct: 243 VWINRFKERLMETPVEMVIRMGRTTISGRQLLYLQEGDIILLDTDEDELLEAEVEGVRKF 302

Query: 286 SCELGRVGKNYTIRI 300
               GRV  N + ++
Sbjct: 303 QGLPGRVKGNKSFQV 317


>gi|289670556|ref|ZP_06491631.1| flagellar motor switch protein FliM [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 337

 Score = 38.1 bits (87), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 53/286 (18%), Positives = 105/286 (36%), Gaps = 27/286 (9%)

Query: 26  GDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQ 85
           G   T+E ++     L++  L  + +   DL    S       KF+  +HS       + 
Sbjct: 49  GRMPTLEMVNERFARLWRIGLFNLIRRSADL----SVRGIDLVKFNEYMHSLYVPTNLNL 104

Query: 86  ASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAV 145
                      I     LV T+++N  G       ++  R  +  E ++ +  + Q  A 
Sbjct: 105 IRFKPLRGTGLIVFEPTLVFTVVDNFFGGDGRYHTRIEGREFTATEMRVVQLMLKQTFAD 164

Query: 146 LNQCISTTQESSPNLEDFYDIDYLKKNTN-RLSN-----EFVTTINMNMTIENVASSFVL 199
           L +  +   +         D +Y+    N   +N     E+V     ++ +E       +
Sbjct: 165 LKEAWAPVMD--------VDFEYINSEINPHFANIVTPREYVVVCRFHVELEGGGGEIHI 216

Query: 200 IIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLN---VNIDTRINLKKTTLKDV 256
            +P   L     +  +      N  +D  +   R+  QL+   V + + +  K+ TL+ +
Sbjct: 217 TLPYSMLEPIRELLDAGIQSDRNDRDDSWNVMLRE--QLDTAEVTLSSVLASKRMTLRQL 274

Query: 257 VTLKIGQVIPFLHREKTCAI-LSANGKEIYSCELGRVGKNYTIRIT 301
             LK+G V+P    E    + L      +++ E G    N  ++IT
Sbjct: 275 TGLKVGDVLPI---ELPAQVPLCVEDIPLFTGEFGVSNGNNAVKIT 317


>gi|170742328|ref|YP_001770983.1| flagellar motor switch protein FliM [Methylobacterium sp. 4-46]
 gi|168196602|gb|ACA18549.1| flagellar motor switch protein FliM [Methylobacterium sp. 4-46]
          Length = 403

 Score = 37.7 bits (86), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 48/252 (19%), Positives = 101/252 (40%), Gaps = 16/252 (6%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
           V+++  +  S +F   +++     +        W ++  +   +NL    L+ LLG    
Sbjct: 137 VEVTLDNITSVRFGDYLNAIPLPTLLGVFKADLWENSGLVTVDSNLAYATLDLLLGGKRG 196

Query: 118 TIP-QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNT--- 173
           T   +L  R  +++E  L +R    +  +L    ++ Q  SP     + ID L+ N    
Sbjct: 197 TTTIRLDGRPFTSIEMSLVRR---MLEIILGDLEASFQPLSPVR---FQIDRLESNPRFA 250

Query: 174 --NRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLI--D 229
              R +N  +  I++ + +E       ++ P  T+     + L S    E    D +   
Sbjct: 251 TITRPANAAI-LIDLKLDMEGRGGLLQILFPYATIEPIRDLLLQS-FMGEKLGRDHVWEG 308

Query: 230 PFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCEL 289
             A + +Q  V ++  ++     LK V+ L++G  I F  +      L      +    +
Sbjct: 309 HLATEIWQAEVEVEAVLHQMTLPLKRVLALEVGDTILFDAKPTDLITLRCGDWALSQGRI 368

Query: 290 GRVGKNYTIRIT 301
           GR+  +  +++T
Sbjct: 369 GRLEDSIAVQVT 380


>gi|187926920|ref|YP_001893265.1| flagellar motor switch protein FliM [Ralstonia pickettii 12J]
 gi|241665249|ref|YP_002983608.1| flagellar motor switch protein FliM [Ralstonia pickettii 12D]
 gi|187728674|gb|ACD29838.1| flagellar motor switch protein FliM [Ralstonia pickettii 12J]
 gi|240867276|gb|ACS64936.1| flagellar motor switch protein FliM [Ralstonia pickettii 12D]
          Length = 335

 Score = 37.7 bits (86), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 39/208 (18%), Positives = 83/208 (39%), Gaps = 9/208 (4%)

Query: 102 NLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLE 161
           NL+  +++NL G       ++  R  + VE+++ +R    +  V        Q   P   
Sbjct: 121 NLIFLVVDNLFGGDGRFHMRVEGRDFTDVEQRIIQR---MLQLVFEHYARAWQPVYPIDF 177

Query: 162 DFYDIDYLKKNTNRLS-NEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKS 220
           +F  ++   +  N  + NE V T   ++ + N      + +P  T+++     L+S  + 
Sbjct: 178 EFLRMEMHTEFANVATPNEVVVTTTFSLELGNNGGDVHICMPY-TMIEPIRDRLTSAIQG 236

Query: 221 ENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           E    D   +   +++     V +   +      + D++ +K+G VIP    +   A   
Sbjct: 237 EALEVDKRWLRLLSQQVQTAEVELIADLATANVQVSDILNMKVGDVIPLELDDVVTA--K 294

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINF 306
            +G  +  C  G     Y +R+   +N 
Sbjct: 295 VDGVPVMECNYGTFNGQYALRVNRMLNM 322


>gi|78776906|ref|YP_393221.1| flagellar motor switch protein FliM [Sulfurimonas denitrificans DSM
           1251]
 gi|78497446|gb|ABB43986.1| Surface presentation of antigens (SPOA) protein:Flagellar motor
           switch protein FliM [Sulfurimonas denitrificans DSM
           1251]
          Length = 372

 Score = 37.7 bits (86), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 53/272 (19%), Positives = 115/272 (42%), Gaps = 28/272 (10%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
           V+I   S     +   + S      F+  S+     +  I  + ++   +L+ LLG   E
Sbjct: 83  VEIQLHSVDQMTYGEFLMSLPNPTSFNVFSMKPLEGSGVIEINPSIAFPMLDRLLGGKGE 142

Query: 118 TIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQES-SPNLEDFYDIDYLKKNTNRL 176
             P   +R  S +E  L          +L   +ST +++  P +E F +I+  + + N +
Sbjct: 143 --PFDASREFSDIELSL-------FETILRVMMSTLKDAWGPVMEIFPNIESKESSPNVV 193

Query: 177 S----NEFVTTINMNMTIENVASSFVL---IIPQETLL-----KTTLISLSSQNKSENQS 224
                NE V  + M + I   +    +   +I  E +L     +  +++ +S  KS N  
Sbjct: 194 QIVAQNEIVVMVVMEIIIGQSSGMMNICYPVIALEPVLPKLASRDLMLNETSTKKSRNTE 253

Query: 225 EDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEI 284
             ++   A+      V I+  +   + TL+DV+ L+ G ++           +  +GK+ 
Sbjct: 254 LHVLLGGAK------VGIEAMLGNAELTLRDVLDLQAGDIVRLTSPADDIVTICVDGKDR 307

Query: 285 YSCELGRVGKNYTIRITDRINFDQKSLKNFLH 316
           +  ++G      ++++T+ I+ ++ ++K  L 
Sbjct: 308 FRGKIGLRRFRKSVQVTEIIDTERDAVKRALE 339


>gi|302878292|ref|YP_003846856.1| flagellar motor switch protein FliM [Gallionella capsiferriformans
           ES-2]
 gi|302581081|gb|ADL55092.1| flagellar motor switch protein FliM [Gallionella capsiferriformans
           ES-2]
          Length = 329

 Score = 37.7 bits (86), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 41/207 (19%), Positives = 84/207 (40%), Gaps = 17/207 (8%)

Query: 102 NLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLE 161
           NLV  +++N+ G       ++  R  +  E+    R I ++ AV+ +  +   E+   LE
Sbjct: 121 NLVFLVVDNMFGGDGRFHTRVEGREFTQTEQ----RIIQKMLAVVFETYAKAWETVYPLE 176

Query: 162 DFYDIDYLKKNTN------RLSNEFVTTINMNMTIENVASSFVLIIPQETLLKT-TLISL 214
                ++++   N         NE V     ++ +     +F + +P  TL     L+  
Sbjct: 177 ----FEFVRSEMNPQFANIATPNEVVIVTTFDIELGGNGGAFHICMPYSTLEPVKDLLFN 232

Query: 215 SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTC 274
           + Q +     +  +   +R+     + +   +     TL+ V+ +++G VIP    E   
Sbjct: 233 NIQGEHLAVDKRWLQLLSRQVQCAEIELAATLGQANITLERVLKMRVGDVIPLNVDENIT 292

Query: 275 AILSANGKEIYSCELGRVGKNYTIRIT 301
           A  S +G  I  C+ G     Y ++I 
Sbjct: 293 A--SIDGVPIMECKYGVFNNQYALKIV 317


>gi|326319064|ref|YP_004236736.1| flagellar motor switch protein FliM [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|323375900|gb|ADX48169.1| flagellar motor switch protein FliM [Acidovorax avenae subsp.
           avenae ATCC 19860]
          Length = 334

 Score = 37.7 bits (86), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 46/248 (18%), Positives = 96/248 (38%), Gaps = 11/248 (4%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           +IS  +    ++S  +        F+  ++     +  I C  +LV  +++ L G   + 
Sbjct: 78  EISVGTVSVQRYSAFLRELAVPTNFNIVAIRPLRGSGLIVCEPSLVFGIIDTLYGGVGKF 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLS- 177
             ++  R  S  E+++  R +  I A   +           LE  Y    ++     ++ 
Sbjct: 138 QTRIEGRDFSPTEQRVINRLVDVICAEYKKAWHGIYP----LELEYQRSEMQPQFANIAT 193

Query: 178 -NEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLIDPFARK 234
            +E V +    + I +++ +  + +P  TL  ++  L S S+Q  S       +    R+
Sbjct: 194 PSEIVVSTAFQLEIGDLSGAIHICMPYATLEPIRDVLYS-STQGDSIEVDRRWVRVLTRE 252

Query: 235 TYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGK 294
                V +   +     T++ ++ +K G  I      +  A  S  G  I+ C+ G    
Sbjct: 253 IQAAEVTLVAELARADATVEQLLAMKPGDFIELDREPRIQA--SIGGVPIFECQYGTHNS 310

Query: 295 NYTIRITD 302
            Y IRI +
Sbjct: 311 KYAIRIEE 318


>gi|120613024|ref|YP_972702.1| flagellar motor switch protein FliM [Acidovorax citrulli AAC00-1]
 gi|120591488|gb|ABM34928.1| flagellar motor switch protein FliM [Acidovorax citrulli AAC00-1]
          Length = 334

 Score = 37.7 bits (86), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 46/248 (18%), Positives = 96/248 (38%), Gaps = 11/248 (4%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           +IS  +    ++S  +        F+  ++     +  I C  +LV  +++ L G   + 
Sbjct: 78  EISVGTVSVQRYSAFLRELAVPTNFNIVAIRPLRGSGLIVCEPSLVFGIIDTLYGGVGKF 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLS- 177
             ++  R  S  E+++  R +  I A   +           LE  Y    ++     ++ 
Sbjct: 138 QTRIEGRDFSPTEQRVINRLVDVICAEYKKAWHGIYP----LELEYQRSEMQPQFANIAT 193

Query: 178 -NEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLIDPFARK 234
            +E V +    + I +++ +  + +P  TL  ++  L S S+Q  S       +    R+
Sbjct: 194 PSEIVVSTAFQLEIGDLSGAIHICMPYATLEPIRDVLYS-STQGDSIEVDRRWVRVLTRE 252

Query: 235 TYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGK 294
                V +   +     T++ ++ +K G  I      +  A  S  G  I+ C+ G    
Sbjct: 253 IQAAEVTLVAELARADATVEQLLAMKPGDFIELDREPRIQA--SIGGVPIFECQYGTHNS 310

Query: 295 NYTIRITD 302
            Y IRI +
Sbjct: 311 KYAIRIEE 318


>gi|289666107|ref|ZP_06487688.1| flagellar motor switch protein FliM [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 337

 Score = 37.7 bits (86), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 52/286 (18%), Positives = 103/286 (36%), Gaps = 27/286 (9%)

Query: 26  GDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQ 85
           G   T+E ++     L++  L  + +   DL    S       KF+  +HS       + 
Sbjct: 49  GRMPTLEMVNERFARLWRIGLFNLIRRSADL----SVRGIDLVKFNEYMHSLYVPTNLNL 104

Query: 86  ASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAV 145
                      I     LV T+++N  G       ++  R  +  E ++ +  + Q  A 
Sbjct: 105 IRFKPLRGTGLIVFEPTLVFTVVDNFFGGDGRYHTRIEGREFTATEMRVVQLMLKQTFAD 164

Query: 146 LNQCISTTQESSPNLEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVL 199
           L +  +   +         D +Y+    N          E+V     ++ +E       +
Sbjct: 165 LKEAWAPVMD--------VDFEYINSEINPHFANIVTPREYVVVCRFHVELEGGGGEIHI 216

Query: 200 IIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLN---VNIDTRINLKKTTLKDV 256
            +P   L     +  +      N  +D  +   R+  QL+   V + + +  K+ TL+ +
Sbjct: 217 TLPYSMLEPIRELLDAGIQSDRNDRDDSWNVMLRE--QLDTAEVTLSSVLASKRMTLRQL 274

Query: 257 VTLKIGQVIPFLHREKTCAI-LSANGKEIYSCELGRVGKNYTIRIT 301
             LK+G V+P    E    + L      +++ E G    N  ++IT
Sbjct: 275 TGLKVGDVLPI---ELPAQVPLCVEDIPLFTGEFGISNGNNAVKIT 317


>gi|71906405|ref|YP_283992.1| flagellar motor switch protein FliM [Dechloromonas aromatica RCB]
 gi|71846026|gb|AAZ45522.1| Flagellar motor switch protein FliM [Dechloromonas aromatica RCB]
          Length = 338

 Score = 37.7 bits (86), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 46/212 (21%), Positives = 89/212 (41%), Gaps = 24/212 (11%)

Query: 102 NLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLE 161
           NLV  +++N+ G       ++  R  +  E+++       I  +LN   +   E S + +
Sbjct: 121 NLVFLVVDNMFGGDGRFHTRVEGRDFTPTEQRI-------IQGLLNVVFT---EYSKSWK 170

Query: 162 DFYDI--DYLKKNTN-RLSN-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
             YDI  +Y++   N + +N     E V +    +      +   +  P  ++L+     
Sbjct: 171 PVYDINFEYIRSEMNSQFANIATPSEIVVSTTFTLEFGGATADMHICFPY-SMLEPIRDL 229

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L S  +S+  S D   I    ++     V I   +   K TL  ++ LK+G VIP    +
Sbjct: 230 LYSTMQSDQLSSDKRWIGTLRKQLQGAEVEIVALLGSGKITLGQILKLKVGDVIPLHIPD 289

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
           K  A++ +    +  C  G+    Y +++ DR
Sbjct: 290 KIEALVDS--VPLMECTYGQQSGQYALKV-DR 318


>gi|317129197|ref|YP_004095479.1| flagellar motor switch protein FliM [Bacillus cellulosilyticus DSM
           2522]
 gi|315474145|gb|ADU30748.1| flagellar motor switch protein FliM [Bacillus cellulosilyticus DSM
           2522]
          Length = 332

 Score = 37.7 bits (86), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 48/271 (17%), Positives = 108/271 (39%), Gaps = 17/271 (6%)

Query: 42  YKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSN 101
           Y + L      ++   V ++  S     +   I S  +  + +          F I  + 
Sbjct: 62  YARLLTTQLSAQLRTYVQVAVASVDQLPYDEFIRSVPKMTILNVFEPFPLDGRFVIEVNP 121

Query: 102 NLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLE 161
           N+   +L+ +LG   E + ++   SL+ +E K+       +S +  + + T +E+  ++ 
Sbjct: 122 NIAYAMLDRMLGGQGEALNKV--ESLTEIETKI-------LSQLFQRSLETLREAWESVV 172

Query: 162 DFYDI-DYLKKNTNRLS----NEFVTTINMNMTIENVASSFVLIIPQ---ETLLKTTLIS 213
           D   + D ++ N   L     NE V  I+++ TI   +    + +P    E++L    I 
Sbjct: 173 DLDPVMDEIEVNPQFLQLVSPNETVVVISLSTTIGEASGMMNICLPHVVIESILPKLSIH 232

Query: 214 LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKT 273
           L  Q K +++    +    +   Q  +++   +   + ++ + + L    VI        
Sbjct: 233 LWMQQKKKDRQPGELSALEKNLKQAPLDVIVELGQSQISIAEFLQLGENDVIELNQTIDD 292

Query: 274 CAILSANGKEIYSCELGRVGKNYTIRITDRI 304
             ++    +  Y  + G+V     ++ITD I
Sbjct: 293 PLLVKLGNEPKYYSQPGKVKGKLAVQITDSI 323


>gi|224437150|ref|ZP_03658131.1| flagellar motor switch protein FliM [Helicobacter cinaedi CCUG
           18818]
 gi|313143613|ref|ZP_07805806.1| flagellar motor switch protein FliM [Helicobacter cinaedi CCUG
           18818]
 gi|313128644|gb|EFR46261.1| flagellar motor switch protein FliM [Helicobacter cinaedi CCUG
           18818]
          Length = 353

 Score = 37.4 bits (85), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 54/271 (19%), Positives = 110/271 (40%), Gaps = 26/271 (9%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
           V+I   S     +   + S      F+  S+        +  + ++   +++ LLG   +
Sbjct: 79  VEIQLHSVDQMTYGEFLMSLPSPTSFNIFSMKPLEGAAILEINPSIAFPMIDRLLGGKGD 138

Query: 118 TIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLS 177
             P   +R  S +E  L    + QI   L +  S+  E  P+      +D  + + N + 
Sbjct: 139 --PYENSREFSDIELNLLDTLLRQIMQNLKEAWSSITEIFPS------VDAKESSPNVVQ 190

Query: 178 ----NEFVTTINMNMTIENVASSFVL---IIPQETLL-----KTTLISLSSQNKSENQSE 225
               NE V  + M + I + +    +   +I  ET+L     +  ++S +S  KS N+  
Sbjct: 191 IVAQNEIVIMVVMEIIIGHSSGMMSICYPVISLETVLSRLASRDLMLSDTSSKKSRNKEL 250

Query: 226 DLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIY 285
             +   A      NV +   +     +LK+V+ L++G ++          ++S +G+E Y
Sbjct: 251 QALIAGA------NVVVSGYLGNATLSLKEVLDLQVGDIVRLDRAADDTILVSVDGREKY 304

Query: 286 SCELGRVGKNYTIRITDRINFDQKSLKNFLH 316
              +G      T++I + I  ++  +K  L 
Sbjct: 305 IASIGLQRYRKTLQIKEVIKTEKDQVKEVLE 335


>gi|241763648|ref|ZP_04761698.1| flagellar motor switch protein FliM [Acidovorax delafieldii 2AN]
 gi|241367123|gb|EER61489.1| flagellar motor switch protein FliM [Acidovorax delafieldii 2AN]
          Length = 334

 Score = 37.4 bits (85), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 46/248 (18%), Positives = 96/248 (38%), Gaps = 11/248 (4%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           +IS  +    ++S  +        F+  ++     +  I C  +LV  +++ L G   + 
Sbjct: 78  EISVGTVSVQRYSAFLRELAVPTNFNIVAIRPLRGSGLIVCEPSLVFGIIDTLYGGVGKF 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLS- 177
             ++  R  S  E+++  R +  I A   +           LE  Y    ++     ++ 
Sbjct: 138 QTRIEGRDFSPTEQRVINRLVDVICAEYKKAWHGIY----PLELEYQRSEMQPQFANIAT 193

Query: 178 -NEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLIDPFARK 234
            +E V +    + I +++ +  + +P  TL  ++  L S S+Q  S       +    R+
Sbjct: 194 PSEIVVSTAFQLEIGDLSGAIHICMPYATLEPIRDVLYS-STQGDSIEVDRRWVRVLTRE 252

Query: 235 TYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGK 294
                V +   +     T++ ++ +K G  I      +  A  S  G  I+ C+ G    
Sbjct: 253 IQAAEVTLVAELAQADATVEQLLAMKPGDFIELDREPRIRA--SIGGVPIFECQYGTHNS 310

Query: 295 NYTIRITD 302
            Y IRI +
Sbjct: 311 KYAIRIEE 318


>gi|218133674|ref|ZP_03462478.1| hypothetical protein BACPEC_01543 [Bacteroides pectinophilus ATCC
           43243]
 gi|217991049|gb|EEC57055.1| hypothetical protein BACPEC_01543 [Bacteroides pectinophilus ATCC
           43243]
          Length = 327

 Score = 37.4 bits (85), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 57/292 (19%), Positives = 115/292 (39%), Gaps = 37/292 (12%)

Query: 29  KTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASL 88
           +T+E I    G L    LP   ++ + +DV     + +   +S   ++     +    ++
Sbjct: 52  RTLEIIFEHFGRLLATNLPGYLRKTVSVDV----VNSEVVIYSEFSNALSNPVLLGVVTM 107

Query: 89  SSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQ 148
                N  +  ++NL   +++ LLG S  T+ +   R  S +E  + +R       +L +
Sbjct: 108 PPLKGNIIMEMASNLGYAIIDRLLGGSGNTMDK--ARDFSEIELTILERIFTICVNLLQE 165

Query: 149 CISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIE---------------NV 193
                 ++SP LE        +  TN   ++F   I+ + TI                N+
Sbjct: 166 PWQNVVQTSPRLE--------RIETN---SQFAQIISPSETIAIVTLSIKIGEVEGLMNI 214

Query: 194 ASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTL 253
              FV + P    L T     + Q+K +   +D I+    +     + +   +   + ++
Sbjct: 215 CLPFVTLEPVMDKLNTKYWFSTLQDKDDQSYQDAIESLIDRA---QIPMKAVLGHSRISV 271

Query: 254 KDVVTLKIGQVIPFLHR-EKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
            D V L++G +I    + +    +   N K+ ++   G     Y IRIT+ I
Sbjct: 272 GDFVNLQLGDIIRLDRKVDDELEVYVGNIKK-FAALPGYSEDKYAIRITEVI 322


>gi|222100881|ref|YP_002535449.1| Flagellar motor switch protein FliM [Thermotoga neapolitana DSM
           4359]
 gi|221573271|gb|ACM24083.1| Flagellar motor switch protein FliM [Thermotoga neapolitana DSM
           4359]
          Length = 328

 Score = 37.4 bits (85), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 56/281 (19%), Positives = 119/281 (42%), Gaps = 23/281 (8%)

Query: 29  KTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASL 88
           +T + I  + G     +L    +  +D+++ I   + +    S +I SF    V     +
Sbjct: 53  RTFQMIHENFGRALSTYLSGRLRTFVDVEISIDQLTYEEFIRSVMIPSF---IVIFTGDV 109

Query: 89  SSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQ 148
              S+ F +    +L  T+L+ ++G   +  P   NR+ + +E  + +R +  I  +L Q
Sbjct: 110 FEGSAIFEMRL--DLFYTILDIIMGGPGDNPP---NRTPTDIETSIMRREVTNILTLLAQ 164

Query: 149 CISTTQESSPNLEDFYDIDYLKKNTNRL----SNEFVTTINMNMTIENVASSFVLIIPQE 204
             S  Q   P++E+      ++ N   +     NE V  +  +++     +SF+ +    
Sbjct: 165 AWSDFQYFIPSIEN------IETNPQFVQIVPPNEIVLLVTASVSWGEF-TSFINVCWPF 217

Query: 205 TLLKTTLISLSSQ----NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLK 260
           +LL+  L  LS++     +   + E+ ++     +  + + +   I     TL++V+ L+
Sbjct: 218 SLLEPFLEKLSNRFWMMGRKPERIEERVEELKVASQSVPLTVQAVIGEAWLTLREVLNLQ 277

Query: 261 IGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
            G VI      K    +   GK  +    G+    Y ++IT
Sbjct: 278 EGDVIRLNTHYKDEIRIDVEGKPKFRGIPGKYKGKYAVKIT 318


>gi|311105953|ref|YP_003978806.1| flagellar motor switch protein FliM [Achromobacter xylosoxidans A8]
 gi|310760642|gb|ADP16091.1| flagellar motor switch protein FliM [Achromobacter xylosoxidans A8]
          Length = 335

 Score = 37.4 bits (85), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 41/223 (18%), Positives = 94/223 (42%), Gaps = 30/223 (13%)

Query: 102 NLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLE 161
           NLV  ++++L G       ++  R  +T E+++ +R       +LN  + +  +S    +
Sbjct: 122 NLVFLVIDSLFGGDGRYHTRVEGRDFTTTEQRIIRR-------LLNLTLESYGKS---WD 171

Query: 162 DFYDID--YLKKNTNRL------SNEFVTTINMNMTIE------NVASSFVLIIPQETLL 207
             Y I+  Y++   +        +NE V   + ++         N+   + +I P   LL
Sbjct: 172 PVYPIEFEYVRSEMHTKFASITGNNEVVVVTSFHIEFGATGGDLNICLPYSMIEPVRDLL 231

Query: 208 KTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPF 267
              L   + +   +  ++ L    +R+    ++++        +++++++ LK+G V+P 
Sbjct: 232 TRPLQETTLEEVDQRWAQQL----SRQVRSADIDVVAEFARIPSSIRELMRLKVGDVLPV 287

Query: 268 LHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
              E   A  S +G  +  C  G     Y +R+ +    D +S
Sbjct: 288 TVPETIVA--SVDGVPLMECGYGVFNGQYALRVQNMFTHDTES 328


>gi|77359748|ref|YP_339323.1| flagellar motor switch protein FliM [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76874659|emb|CAI85880.1| flagellar biosynthesis; component of motor switch and energizing
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 363

 Score = 37.4 bits (85), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 48/266 (18%), Positives = 104/266 (39%), Gaps = 20/266 (7%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S    Q  KF   +H+       +            I     LV  L++N  G     
Sbjct: 78  EVSINGVQMIKFGEYVHTLFVPTSLNMVRFRPLKGTGLITMEARLVFILVDNFFGGDGRY 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E+++ +  +  I     +  +   + S         +YL    N  ++
Sbjct: 138 HAKIEGREFTPTERRIVQMLLKIIFEDYKEAWAPVMDVS--------FEYLDSEVNPAMA 189

Query: 178 N-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFA 232
           N     E V   + ++ ++     F + +P  ++L+     L +  +S+ +  DL    A
Sbjct: 190 NIVSPTEVVVISSFHIELDGGGGDFHIALPY-SMLEPIRELLDAGVQSDTEDTDLRWSKA 248

Query: 233 RKTYQLNVNIDTRINLKKT--TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
            +   ++V ++    L +   TLK ++ LK G +IP    E     +       +  ++G
Sbjct: 249 LRDEIMDVEVELSTQLLEVDLTLKQIMELKAGDIIPVEMPEHITVFVEE--LPTFRAKMG 306

Query: 291 RVGKNYTIRITDRINFDQKSLKNFLH 316
           R   +  ++I+++I     S+K+ LH
Sbjct: 307 RSRDSVALQISEKIK-RPDSVKSELH 331


>gi|73539704|ref|YP_300071.1| flagellar motor switch protein FliM [Ralstonia eutropha JMP134]
 gi|72123041|gb|AAZ65227.1| Flagellar motor switch protein FliM [Ralstonia eutropha JMP134]
          Length = 337

 Score = 37.0 bits (84), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 43/210 (20%), Positives = 83/210 (39%), Gaps = 16/210 (7%)

Query: 102 NLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLE 161
           NLV  +++NL G       ++  R  +  E+++ +R +            T     P   
Sbjct: 125 NLVFLVVDNLFGGDGRFHTRVEGRDFTQTEQRIIQRMLEMTLTSYGNAWRTVY---PIET 181

Query: 162 DFYDIDYLKKNTNRLS-NEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQN 218
           ++   +   K  N  + NE V T   ++ +  V     + +P   +  LK  L++     
Sbjct: 182 EYVRSEMHTKFANVATVNEAVITTAFHIELGAVGGQLHVCLPYAMIEPLKDLLMNPLQDE 241

Query: 219 KSENQSEDLIDPFARKTYQL---NVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCA 275
           K  ++S       A+ + QL   +V +       ++T+ +V+ L+ G V+P    E    
Sbjct: 242 KEVDKSW-----LAKLSTQLRAADVEVVAEFTHVQSTVAEVLALRAGDVLPIELPEHVFG 296

Query: 276 ILSANGKEIYSCELGRVGKNYTIRITDRIN 305
               NG  +  C  G +   Y +R+   IN
Sbjct: 297 --KVNGVPVMQCGFGTINGQYALRVERMIN 324


>gi|325917742|ref|ZP_08179929.1| flagellar motor switch protein FliM [Xanthomonas vesicatoria ATCC
           35937]
 gi|325536041|gb|EGD07850.1| flagellar motor switch protein FliM [Xanthomonas vesicatoria ATCC
           35937]
          Length = 337

 Score = 37.0 bits (84), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 51/285 (17%), Positives = 102/285 (35%), Gaps = 25/285 (8%)

Query: 26  GDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQ 85
           G   T+E ++     L++  L  + +   DL    S       KF+  +HS       + 
Sbjct: 49  GRMPTLEMVNERFARLWRIGLFNLIRRSADL----SVRGIDLVKFNEYMHSLYVPTNLNL 104

Query: 86  ASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAV 145
                      I     LV T+++N  G       ++  R  +  E ++ +  + Q  A 
Sbjct: 105 IRFKPLRGTGLIVFEPTLVFTVVDNFFGGDGRFHTRIEGREFTATEMRVIQLMLKQTFAD 164

Query: 146 LNQCISTTQESSPNLEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVL 199
           L +  +   E         D +Y+    N          E+V     ++ +E       +
Sbjct: 165 LKEAWAPVME--------VDFEYINSEINPHFANIVTPREYVVVCRFHVELEGGGGEIHI 216

Query: 200 IIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLN---VNIDTRINLKKTTLKDV 256
            +P   L     +  +      N  +D  +   R+  QLN   V + + +  K+ +L+ +
Sbjct: 217 TLPYSMLEPIRELLDAGIQSDRNDRDDSWNVMLRE--QLNTAEVTLSSVLASKRMSLRQL 274

Query: 257 VTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
             LK+G ++P     +    L      +++ E G    N  ++IT
Sbjct: 275 TGLKVGDILPIDLPAQVP--LCVEEIPMFTGEFGVSNGNNAVKIT 317


>gi|152980580|ref|YP_001353124.1| flagellar motor switch protein FliM [Janthinobacterium sp.
           Marseille]
 gi|151280657|gb|ABR89067.1| FliM flagellar motor switch protein [Janthinobacterium sp.
           Marseille]
          Length = 332

 Score = 37.0 bits (84), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 38/206 (18%), Positives = 80/206 (38%), Gaps = 17/206 (8%)

Query: 102 NLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLE 161
           NLV  L++NL G       ++  R  +  E+++ +R    I  ++ +  + + E    +E
Sbjct: 120 NLVFLLVDNLFGGDGRFHTRVEGRDFTQTEQRIIQR----ILGIIFETYAKSWEPVYPVE 175

Query: 162 DFYDIDYLKKNTN------RLSNEFVTTINMNMTIENVASSFVLIIPQETLLKT-TLISL 214
                +Y++   N         NE V      + +  V+       P   +     L++ 
Sbjct: 176 ----FEYIRSEMNTQFANIATPNEVVVATTFTIELGPVSGDMHFCTPYAMIEPIRDLLTS 231

Query: 215 SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTC 274
           S Q ++    +  I    ++     V I   +   K TL D++ ++ G +IP    +   
Sbjct: 232 SMQGETLEMDKRWIRLMTQQIQTAEVEILANMGSAKVTLGDILNMQKGDIIPIAVPDTIT 291

Query: 275 AILSANGKEIYSCELGRVGKNYTIRI 300
           A    +   +  C  G++   Y +R+
Sbjct: 292 A--EVDSVPVMECSYGKLNGQYALRV 315


>gi|90411030|ref|ZP_01219044.1| flagellar motor switch protein [Photobacterium profundum 3TCK]
 gi|90328243|gb|EAS44554.1| flagellar motor switch protein [Photobacterium profundum 3TCK]
          Length = 348

 Score = 37.0 bits (84), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 41/218 (18%), Positives = 94/218 (43%), Gaps = 21/218 (9%)

Query: 96  FIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQE 155
            I     LV  L+EN  G       ++  R  +  E+++       +  +L       +E
Sbjct: 113 LITMEARLVFILVENFFGGDGRFHAKIEGREFTPTERRI-------VQMLLKLVFEDYRE 165

Query: 156 S-SPNLEDFYDIDYLKKNTNR-LSN-----EFVTTINMNMTIENVASSFVLIIPQETLLK 208
           + SP +    + +YL    N  ++N     E +   + ++ ++     F +++P  ++++
Sbjct: 166 AWSPVMG--VEFEYLDSEVNPTMANIVSPTEVIVVSSFHIEVDGGGGDFHVVMPY-SMVE 222

Query: 209 TTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT--TLKDVVTLKIGQVIP 266
                L +  +S+   +D+    A +   ++V ++ R  L     +L+D++ L+ G +IP
Sbjct: 223 PIRELLDAGVQSDKMDKDVRWSMALREEIMDVPVNLRAKLLDVDLSLRDLMELQAGDIIP 282

Query: 267 FLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
               E   A +       Y  ++G+ G N  ++IT ++
Sbjct: 283 IDVPE--SATVFVEDLPTYRAKMGKSGDNIALKITQKL 318


>gi|83647849|ref|YP_436284.1| flagellar motor switch protein FliM [Hahella chejuensis KCTC 2396]
 gi|83635892|gb|ABC31859.1| flagellar motor switch protein FliM [Hahella chejuensis KCTC 2396]
          Length = 340

 Score = 37.0 bits (84), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 46/258 (17%), Positives = 97/258 (37%), Gaps = 28/258 (10%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           D++    Q  KF   IH+       +   +              LV  L++N  G     
Sbjct: 76  DVASGGVQILKFGEYIHTLYVPTSLNLVKIRPLRGTGLFILDAKLVFKLVDNFFGGDGRH 135

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLS 177
             ++  R  +  E ++ +  + Q+   + +  +   +         D +Y+    N  ++
Sbjct: 136 -AKIEGREFTPTEIRIVQMVLEQVFHDMKEAWNAVMK--------VDFEYVNSEVNPAMA 186

Query: 178 N-----------EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSED 226
           N            F   ++      +VA  + +I P   +L   +     Q+  ++  E 
Sbjct: 187 NIVSPSEVVVVSTFHIELDGGGGDMHVAMPYSMIEPIREVLDAGV-----QSDVDDVDER 241

Query: 227 LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYS 286
            I    +   +  V ++  +  +K +L+ +  LK G VIP    E     ++ANG  I+ 
Sbjct: 242 WISALQQDILEARVPLNAAVVRQKISLRSLSRLKPGDVIPVELPETIT--VTANGVPIFI 299

Query: 287 CELGRVGKNYTIRITDRI 304
            ++G+   N  ++I D+I
Sbjct: 300 AKVGQCNGNLALKIVDKI 317


>gi|121596087|ref|YP_987983.1| flagellar motor switch protein FliM [Acidovorax sp. JS42]
 gi|222112243|ref|YP_002554507.1| flagellar motor switch protein flim [Acidovorax ebreus TPSY]
 gi|120608167|gb|ABM43907.1| flagellar motor switch protein FliM [Acidovorax sp. JS42]
 gi|221731687|gb|ACM34507.1| flagellar motor switch protein FliM [Acidovorax ebreus TPSY]
          Length = 334

 Score = 37.0 bits (84), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 48/248 (19%), Positives = 98/248 (39%), Gaps = 11/248 (4%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           +IS  +    ++S  +        F+  ++     +  + C  +LV  +++ L G   + 
Sbjct: 78  EISVGTVSVQRYSAFLRELVVPTNFNIVAIRPLRGSGLVVCEPSLVFGIIDTLYGGVGKF 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLS- 177
             ++  R  S  E+++  R +  I A   +     Q   P LE  Y    ++     ++ 
Sbjct: 138 QTRIEGRDFSATEQRVINRLVDVICAEYKK---AWQGIYP-LELAYQRSEMQPQFANIAT 193

Query: 178 -NEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLIDPFARK 234
            +E V +    + I ++A +  + +P  TL  ++  L S S Q  +       +    R+
Sbjct: 194 PSEIVVSTAFQLEIGDLAGAIHICMPYATLEPIRDVLYS-SVQGDAIEVDRRWVRVLTRE 252

Query: 235 TYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGK 294
                V +   +     T++ ++ +K G  I  L RE      S  G  ++ C+ G    
Sbjct: 253 IQAAEVTLVAELARADATVEQLLAMKPGDFIE-LEREPRIR-ASIEGVPVFECQYGTHNS 310

Query: 295 NYTIRITD 302
            Y IRI +
Sbjct: 311 KYAIRIEE 318


>gi|238920318|ref|YP_002933833.1| flagellar motor switch protein FliM [Edwardsiella ictaluri 93-146]
 gi|238869887|gb|ACR69598.1| flagellar motor switch protein FliM, putative [Edwardsiella
           ictaluri 93-146]
          Length = 337

 Score = 36.6 bits (83), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 40/213 (18%), Positives = 90/213 (42%), Gaps = 20/213 (9%)

Query: 102 NLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLE 161
           +LV   ++NL G       ++  R  +  E+++       I ++L   +   +++   + 
Sbjct: 123 SLVFMAVDNLFGGDGRFPTKVDGREFTHTEQRV-------IQSMLRLALDAYRDAWSAIF 175

Query: 162 DFYDIDYLKK-------NTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLI 212
              DI+Y++        N     N+ V T    + +  ++  F + IP   +  L+  L+
Sbjct: 176 KL-DIEYVRSEIQVKFTNITTSPNDIVVTTPFTVEVGALSGEFNICIPFSMIEPLRELLV 234

Query: 213 SLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREK 272
           +   +N S+ + +   D  +++     + +          L DV+ L+IG V+P    ++
Sbjct: 235 NPPLEN-SKQEDQHWRDTLSKQVQHSELELVADFVDIPLRLSDVLKLQIGDVLPIDRPDR 293

Query: 273 TCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
             A  + +G  + +C+ G     Y +R+   IN
Sbjct: 294 LVA--NVDGVPVLTCQYGCYHGQYALRVEKMIN 324


>gi|209963533|ref|YP_002296448.1| flagellar motor switch protein FliM [Rhodospirillum centenum SW]
 gi|7025355|gb|AAF35846.1|AF220002_3 lateral flagellar motor switch protein FliM [Rhodospirillum
           centenum]
 gi|209956999|gb|ACI97635.1| flagellar motor switch protein FliM [Rhodospirillum centenum SW]
          Length = 352

 Score = 36.6 bits (83), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 45/264 (17%), Positives = 99/264 (37%), Gaps = 9/264 (3%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
           V+++     S +F   +       + +      W ++  +   + L+ ++++ LLG    
Sbjct: 94  VEVTVQQIASVRFGDYLSGIPLPSLIAVVRAEEWDNHCLLTVDSELIYSIVDILLGGRRS 153

Query: 118 TIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLS 177
               +  R  + +E+ LA+R I  +   L    S         E           T   S
Sbjct: 154 DPAPIDGRPYTVIERALAERLIRTVLKDLGTAFSPLSAVGFACERVETTPQFAVITR--S 211

Query: 178 NEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNK--SENQSEDLIDPFAR 233
           N    +    + ++       L+IP  TL  ++  L+ +    K   ++  E  +    R
Sbjct: 212 NNACISARFQVALDGRGGCVSLLIPYATLEPIRDLLLQMFMGEKFGRDSMWETHLKNELR 271

Query: 234 KTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVG 293
           +T   +V++   +   + +L D++  K G  +    R    A+L+     ++  E+G+  
Sbjct: 272 RT---SVDLSAVLGQAQVSLTDLLAWKEGTQLVLDMRPDAQALLTCGHVPMFVGEMGQRN 328

Query: 294 KNYTIRITDRINFDQKSLKNFLHK 317
            N  IRI   +    + +   L +
Sbjct: 329 GNVAIRIDADLGAQDEVIHGLLQR 352


>gi|269139494|ref|YP_003296195.1| flagellar motor switch protein [Edwardsiella tarda EIB202]
 gi|267985155|gb|ACY84984.1| flagellar motor switch protein [Edwardsiella tarda EIB202]
 gi|304559383|gb|ADM42047.1| Flagellar motor switch protein FliM [Edwardsiella tarda FL6-60]
          Length = 337

 Score = 36.6 bits (83), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 39/213 (18%), Positives = 90/213 (42%), Gaps = 20/213 (9%)

Query: 102 NLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLE 161
           +LV   ++NL G       ++  R  +  E+++ +R       +L   +   +++   + 
Sbjct: 123 SLVFMAVDNLFGGDGRFPTKVDGREFTHTEQRVIQR-------MLRLALDAYRDAWGAIF 175

Query: 162 DFYDIDYLKK-------NTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLI 212
              D++Y++        N     N+ V T    + +  ++  F + IP   +  L+  L+
Sbjct: 176 KL-DVEYVRSEIQVKFTNITTSPNDIVVTTPFTVEVGALSGEFNICIPFSMIEPLRELLV 234

Query: 213 SLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREK 272
           +   +N S+ + +   D  +++     + +          L DV+ L+IG V+P    ++
Sbjct: 235 NPPLEN-SKQEDQHWRDTLSKQVQHSELELVANFVDVPLRLSDVLKLQIGDVLPIDRPDR 293

Query: 273 TCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
             A  + +G  + +C+ G     Y +R+   IN
Sbjct: 294 LVA--NVDGVPVLTCQYGCYHGQYALRVEKMIN 324


>gi|160901604|ref|YP_001567185.1| flagellar motor switch protein FliM [Petrotoga mobilis SJ95]
 gi|160359248|gb|ABX30862.1| flagellar motor switch protein FliM [Petrotoga mobilis SJ95]
          Length = 359

 Score = 36.6 bits (83), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 58/257 (22%), Positives = 108/257 (42%), Gaps = 25/257 (9%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
           VD+ Y S     FS    S          S  ++S +  +    +L   +++ LLG    
Sbjct: 81  VDVKYASIDQITFSEFQKSLNSPTFIVIFSSEAFSGSAILQMGLDLGYVIIDRLLGGPGN 140

Query: 118 TIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRL- 176
           T+ ++  R  + +E  + ++  A +  +L++  S  +E   NLE+      L+ N   + 
Sbjct: 141 TLEEI--RPPTEIEMNILRKESAVMLRMLSKSWSNIEEFDANLEN------LETNPQFVQ 192

Query: 177 ---SNEFVTTINMNMTIENVASSFVLIIPQETLLK-----TTLISLSSQNKSENQSEDLI 228
               NE    I +++TI+NV     L  P  +L       TT +  +S   +E   E+L 
Sbjct: 193 VAPPNEMTILITLSVTIKNVQGFVNLCFPSSSLEPLNDKLTTRMWTTSYRHTEEFKENL- 251

Query: 229 DPFARKTYQLNVNIDTRINLKKTT--LKDVVTLKIGQVIPFLHREKTCAILSANGKEIYS 286
               R++  L+    + I L KT   L D + L++G VI           L    + I+ 
Sbjct: 252 ----RQSLLLSKLNLSAI-LGKTEIYLNDFLNLEVGDVIRLDSFYDEPIDLEIEERPIFK 306

Query: 287 CELGRVGKNYTIRITDR 303
             +G+    Y+++I ++
Sbjct: 307 VNVGKSKGFYSVKIVEK 323


>gi|172057877|ref|YP_001814337.1| flagellar motor switch protein FliM [Exiguobacterium sibiricum
           255-15]
 gi|171990398|gb|ACB61320.1| flagellar motor switch protein FliM [Exiguobacterium sibiricum
           255-15]
          Length = 327

 Score = 36.6 bits (83), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 56/276 (20%), Positives = 114/276 (41%), Gaps = 26/276 (9%)

Query: 42  YKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSN 101
           + + L   F  ++   V  +  + +   +   IHS     + +  +L           + 
Sbjct: 62  FARVLTTHFSAQLRTYVQFTVNTVEQLPYDEFIHSIPNMTLINLVNLHPLDGRVIFEVNP 121

Query: 102 NLVITLLENLLGASHETIPQLYNRSLSTVEKK----LAKRTIAQISAVLNQCISTTQESS 157
           N+   +L+ LLG   E + ++ N  L+ +E +    L KR   Q  A          ES 
Sbjct: 122 NIAYAMLDRLLGGPGEGMNKIEN--LTEIETRILTQLFKRAFVQYGAAW--------ESI 171

Query: 158 PNLEDFYDIDYLKKNTNRLS----NEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
             +E  Y  D L+ N   L     NE V  +++ +T+  V+ +  + +P  T L+  +  
Sbjct: 172 AEIEAEY--DDLEINPQFLQLVSPNETVILVSIYVTVGEVSGTLNVCLPFVT-LEPIIPK 228

Query: 214 LSSQ---NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLK--DVVTLKIGQVIPFL 268
           LSS     + + +S D  +    +T  +   +D +  L +T L   +++ L++G  +   
Sbjct: 229 LSSHFWMQQEKRKSADNQESEHMQTQLMGSIVDLKAVLGQTELSFGELLHLEVGDCLSLQ 288

Query: 269 HREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
            R      L  + ++++    G  GK+  +++  RI
Sbjct: 289 TRTSDPVELFVDDRKMFKARPGLNGKHLALQVLQRI 324


>gi|330447962|ref|ZP_08311610.1| HAMP domain protein [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328492153|dbj|GAA06107.1| HAMP domain protein [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 627

 Score = 36.6 bits (83), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 53/123 (43%), Gaps = 16/123 (13%)

Query: 94  NFFIGCSNNLVITLL---ENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCI 150
           N F+G  + +V  L    E+L   SH T  Q   RS      +L +  I  ++  +N+  
Sbjct: 339 NQFVGNMHQMVTRLRHVSESLNQQSHVTASQAEERS---ARIQLQQDEINMVATAINEMA 395

Query: 151 STTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTT 210
           + TQE + N E          NT R S E VT  N   T  N +   +  + QE    TT
Sbjct: 396 AATQEIASNAE----------NTARTSEETVTASNHGATQVNQSQQSISTLAQEVETATT 445

Query: 211 LIS 213
           +IS
Sbjct: 446 VIS 448


>gi|149928155|ref|ZP_01916401.1| flagellar motor switch protein M [Limnobacter sp. MED105]
 gi|149823140|gb|EDM82378.1| flagellar motor switch protein M [Limnobacter sp. MED105]
          Length = 348

 Score = 36.6 bits (83), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 42/225 (18%), Positives = 93/225 (41%), Gaps = 23/225 (10%)

Query: 102 NLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLE 161
           +LV  +++NL G       ++  R  +  E+++  R +  I     +  +      P   
Sbjct: 120 SLVFAVIDNLFGGDGRFHTRVEGRDFTQTEQRIIARMLEVIREEFVKAWAPVFPLKP--- 176

Query: 162 DFYDIDYLKKNTN-RLSN-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLS 215
                +YL+   + + +N     E V T + ++ +     S  + IP  T+     +  S
Sbjct: 177 -----EYLRSEMHTQFANIATPSEIVVTTSFSIELGAGGGSLHICIPYSTMEPIRDLLYS 231

Query: 216 SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT--TLKDVVTLKIGQVIPFLHREKT 273
           S    + + +       +K  Q+   +D   +L  T  T+ D++ L+IG VIP     + 
Sbjct: 232 SMQGDQAEPDKRWVTMLKKQVQM-AEVDLVASLASTQLTVADIMELRIGDVIPI----EI 286

Query: 274 CAILSA--NGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLH 316
             ++ A  +   +++C  G  G  Y +++ + +    +S  + L+
Sbjct: 287 DKVIEARVDNVPVFNCSYGTSGGQYALKVEEVLAVSNESHADALN 331


>gi|119899013|ref|YP_934226.1| flagellar motor switch protein FliM [Azoarcus sp. BH72]
 gi|119671426|emb|CAL95339.1| flagellar motor switch protein FliM [Azoarcus sp. BH72]
          Length = 336

 Score = 36.6 bits (83), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 39/220 (17%), Positives = 92/220 (41%), Gaps = 29/220 (13%)

Query: 102 NLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQES-SPNL 160
           NLV  +++N+ G       ++  R  +  E+++       I  +LN   +   ++ +P  
Sbjct: 121 NLVFLVVDNMFGGDGRFHTRVEGRDFTPTEQRI-------IQGMLNVVFTEYAKAWAPVF 173

Query: 161 EDFYDIDYLKKNTN-RLSN-----EFVTTINMNMTIENVASS------FVLIIPQETLLK 208
           +   +++Y++   N + +N     E V + + ++ +    +       + ++ P   LL 
Sbjct: 174 K--LELEYVRSEMNSQFANIATPSEIVVSTSFSLELGGAQAEMHICFPYSMVEPIRDLLY 231

Query: 209 TTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFL 268
           +T+     Q+    Q    I   +R+     V +   +   + TL+D+V +++G VIP  
Sbjct: 232 STM-----QSDHLTQDRRWITLLSRQLQTAEVELTCNLGTARVTLRDIVNMRVGDVIPLQ 286

Query: 269 HREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
             E   A  + +G  +  C  G     +  ++   +  D+
Sbjct: 287 VSELLQA--TVDGVPVLECRYGTQNGQFAFKVDRFLGPDE 324


>gi|126665008|ref|ZP_01735991.1| flagellar motor switch protein M [Marinobacter sp. ELB17]
 gi|126630378|gb|EBA00993.1| flagellar motor switch protein M [Marinobacter sp. ELB17]
          Length = 331

 Score = 36.6 bits (83), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 46/259 (17%), Positives = 92/259 (35%), Gaps = 32/259 (12%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           D+S +  Q  KF   +H+       +   +              LV  L++N  G     
Sbjct: 76  DVSTSGVQIMKFGEYVHTLYVPTSLNLCKIRPLRGTSLFVLDAKLVFKLVDNFFGGQGRH 135

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSN 178
             ++  R  +  E ++       +  +LNQ     QE+   +        LK N   LS+
Sbjct: 136 -AKIEGREFTPTENRI-------VQMMLNQVFHDMQEAWQTV--------LKVNFEYLSS 179

Query: 179 EFVTTI-------------NMNMTIENVASSFVLIIPQETLLKT-TLISLSSQNKSENQS 224
           E   ++               ++ ++         +P   +     ++    Q+  ++  
Sbjct: 180 EVNPSMANIVSPSEVVVVSTFHIELDGGGGELHFALPYSMIEPIRDVLDAGVQSDIDDTD 239

Query: 225 EDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEI 284
           E  +         ++V +++ I  +  +L++V   K G +IP    E     ++ANG  I
Sbjct: 240 ERWVSALQEDIKTVSVAVNSTICRRHISLREVAKFKAGDIIPIEMAEHLT--VTANGIPI 297

Query: 285 YSCELGRVGKNYTIRITDR 303
           Y+  LG       +RI  R
Sbjct: 298 YTATLGTRDDKLALRIHGR 316


>gi|54308123|ref|YP_129143.1| flagellar motor switch protein FliM [Photobacterium profundum SS9]
 gi|46912549|emb|CAG19341.1| Putative flagellar motor switch protein FliM [Photobacterium
           profundum SS9]
          Length = 348

 Score = 36.6 bits (83), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 41/218 (18%), Positives = 94/218 (43%), Gaps = 21/218 (9%)

Query: 96  FIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQE 155
            I     LV  L+EN  G       ++  R  +  E+++       +  +L       +E
Sbjct: 113 LITMEARLVFILVENFFGGDGRFHAKIEGREFTPTERRI-------VQMLLKLVFEDYRE 165

Query: 156 S-SPNLEDFYDIDYLKKNTNR-LSN-----EFVTTINMNMTIENVASSFVLIIPQETLLK 208
           + SP +    + +YL    N  ++N     E +   + ++ ++     F +++P  ++++
Sbjct: 166 AWSPVMG--VEFEYLDSEVNPTMANIVSPTEVIVVSSFHIELDGGGGDFHVVMPY-SMVE 222

Query: 209 TTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT--TLKDVVTLKIGQVIP 266
                L +  +S+   +D+    A +   ++V ++ R  L     +L+D++ L+ G +IP
Sbjct: 223 PIRELLDAGVQSDKMDKDVRWSMALREEIMDVPVNLRAKLLDVDLSLRDLMELQAGDIIP 282

Query: 267 FLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
               E   A +       Y  ++G+ G N  ++IT ++
Sbjct: 283 IDVPE--SATVFVEDLPTYRAKMGKSGDNIALKITQKL 318


>gi|116694517|ref|YP_728728.1| flagellar motor switch protein [Ralstonia eutropha H16]
 gi|113529016|emb|CAJ95363.1| flagellar motor switch protein [Ralstonia eutropha H16]
          Length = 339

 Score = 36.6 bits (83), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 39/207 (18%), Positives = 81/207 (39%), Gaps = 10/207 (4%)

Query: 102 NLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLE 161
           NLV  +++NL G       ++  R  +  E+++ +R +    A       T     P   
Sbjct: 124 NLVFLVVDNLFGGDGRFHTRVEGRDFTQTEQRIIQRMLELTLASYGNAWRTVH---PIET 180

Query: 162 DFYDIDYLKKNTNRLS-NEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQN 218
           ++   +   K  N  + NE V T   ++ +  V     + +P   +  LK  L++     
Sbjct: 181 EYIRSEMHPKFANVATHNEAVVTTAFHIELGAVGGQLHVCLPYAMIEPLKDLLMNPLQDE 240

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           K  ++    +   + +     V +       ++T+ +V+ ++ G V+P    EK      
Sbjct: 241 KEVDKG--WVTQLSTQLRAAEVELVAEFAHLQSTVAEVLAMRAGDVLPIELPEKVFG--K 296

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRIN 305
            +G  +  C  G +   Y +R+   IN
Sbjct: 297 VDGVPVMQCGFGTMNGQYALRVERMIN 323


>gi|302387784|ref|YP_003823606.1| flagellar motor switch protein FliM [Clostridium saccharolyticum
           WM1]
 gi|302198412|gb|ADL05983.1| flagellar motor switch protein FliM [Clostridium saccharolyticum
           WM1]
          Length = 339

 Score = 36.2 bits (82), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 45/261 (17%), Positives = 111/261 (42%), Gaps = 25/261 (9%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASL----SSWSSNFFIGCSNNLVITLLENLLGA 114
           ++S  + +  ++    ++  +N V +  ++    SS +    I  S  L+++L++ +LG 
Sbjct: 79  ELSVVTVEEQRYYEFGNALSDNDVLTLVNVTLPDSSKNPPLLINASMTLMLSLIDRMLGG 138

Query: 115 SHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN 174
             +      + + + +E  L +R I  I   L    S    S  NL   +++  L++N +
Sbjct: 139 VGDDTAVDTSYTYTEIEMALYRRVIQYIIGALKDSWS----SYINLN--FELSRLEENPS 192

Query: 175 RLS----NEFVTTINMNMTIENVASSFVLIIPQETLLKTTLI-------SLSSQNKSENQ 223
                  +E +  + +++ ++  +    + IP   L+    I       ++  +  S++ 
Sbjct: 193 MFQEIGVDETIVIVVLDVDMKECSGRLNVCIPGNLLMNIFDIMDKRKHSAMGDEANSQDN 252

Query: 224 SEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKE 283
            +++++         ++ +  ++     TL DV  L +G VI     + +   L   G+ 
Sbjct: 253 KQEIMNSIKAS----DLLVRAQVGESMITLDDVYNLHVGDVINLGTPKDSDVQLYVEGQP 308

Query: 284 IYSCELGRVGKNYTIRITDRI 304
            +  +LG   +N  +RI D +
Sbjct: 309 WFRGQLGVHKRNVAVRIEDHV 329


>gi|291288740|ref|YP_003505556.1| flagellar motor switch protein FliM [Denitrovibrio acetiphilus DSM
           12809]
 gi|290885900|gb|ADD69600.1| flagellar motor switch protein FliM [Denitrovibrio acetiphilus DSM
           12809]
          Length = 336

 Score = 36.2 bits (82), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 58/266 (21%), Positives = 107/266 (40%), Gaps = 40/266 (15%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           DI+ TS     +   + S  +   F+  S+     N  +  + +LV  +++ LLG + + 
Sbjct: 81  DITLTSVDQMTYGEFLMSLPDPTSFNIISMIPMEGNAVLEINPSLVFPIVDKLLGGTGK- 139

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQI----SAVLNQCISTTQ------ESSPNLEDFYDIDY 168
            P    R L+++E+ +    +  I      V  Q I   +      E+SP++        
Sbjct: 140 -PLFQTRELTSLEQHIMDGILGLILKDLEEVWRQIIPNIRLKKELSENSPHIIQIVS--- 195

Query: 169 LKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQN-------KSE 221
                    NE V  +   +    V     L IP   +L+  L  +SS +         +
Sbjct: 196 --------QNEVVILVVCEVKFGEVLGMMNLCIPA-IVLEPVLGKISSSDWLIGAKKGLQ 246

Query: 222 NQSEDLIDPFARKTYQLN-VNIDTRINL--KKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
            + ED I       + LN   + T I L   K T++DV+ L+ G ++ F  ++     + 
Sbjct: 247 GEKEDEI------MHMLNDTEVPTSIYLGHNKLTIEDVLGLQNGDLVMFNVKQDRPVEIH 300

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRI 304
            N K+ +  E+G +G    ++IT  I
Sbjct: 301 FNNKQKFLGEVGTLGVKKAVKITQFI 326


>gi|87310525|ref|ZP_01092654.1| flagellar motor switch protein fliM [Blastopirellula marina DSM
           3645]
 gi|87286746|gb|EAQ78651.1| flagellar motor switch protein fliM [Blastopirellula marina DSM
           3645]
          Length = 376

 Score = 36.2 bits (82), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 51/240 (21%), Positives = 91/240 (37%), Gaps = 32/240 (13%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
           V++  TS     +S  I S +    F+  + S    N  +  + +++  +++ LLG   E
Sbjct: 102 VEVKLTSVDQLTYSEFIFSLENPSCFNLLTASPLEGNLILDINPSILYPIIDRLLGGGKE 161

Query: 118 TIPQLYNRSLSTVEKKLAKRT---------IAQISAVLNQCISTTQESSPNLEDFYDIDY 168
           + P +  R L+ +E  L  R          IA  + +  Q      ES+P L        
Sbjct: 162 SSP-VSRRPLTEIELTLVARITNLFLRELRIAWENVLDLQLSVVRVESNPQLVQIVP--- 217

Query: 169 LKKNTNRLSNEFVTTINMNMTIENVASSFVLIIP-------QETLLKTTLISLSSQNKSE 221
                    NE +  I+  +TI +V     L IP          L   T  +  +   SE
Sbjct: 218 --------PNEVIVLISFELTIGDVRGMMNLCIPFNSIERIGGKLTANTWFAYGTSEVSE 269

Query: 222 NQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANG 281
              + L    + +    +V +   +   K T +D++ L++G VI      +    +S NG
Sbjct: 270 ESRQAL----STQIDGASVEVGVTLAETKITTEDLLELRVGDVITTPKDSREPLKVSVNG 325


>gi|226944505|ref|YP_002799578.1| flagellar motor switch protein [Azotobacter vinelandii DJ]
 gi|226719432|gb|ACO78603.1| flagellar motor switch protein [Azotobacter vinelandii DJ]
          Length = 350

 Score = 36.2 bits (82), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 46/217 (21%), Positives = 84/217 (38%), Gaps = 28/217 (12%)

Query: 102 NLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLE 161
           +LV  +++NL G     + +   R  +  E+++ +R +      L    S  +   P   
Sbjct: 122 SLVFMVVDNLFGGDGRFLTKSEGREFTHTEQRIIRRLLG---LALEAYQSAWKSVYP--- 175

Query: 162 DFYDIDYLK-------KNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISL 214
              +IDYL+        N     NE V     ++ + N+AS F +++P   L+   L SL
Sbjct: 176 --LEIDYLRSEMQAKFANITSSPNEIVINSTFHLEVGNLASDFNIVMP--YLMIEPLRSL 231

Query: 215 ------SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFL 268
                  S    E Q    +   A +  Q  + +          +  V+ LK+G V+P  
Sbjct: 232 LNGPLNDSHPDEERQWGKRM---ASEIKQSQIELIADFAGIDLCIGQVMALKVGDVLPIE 288

Query: 269 HREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
             E   A    +G  +  CE G       +++ + I+
Sbjct: 289 LPETVVA--RVDGVPVMRCEYGSRNGQRALQVKELID 323


>gi|325920567|ref|ZP_08182489.1| flagellar motor switch protein FliM [Xanthomonas gardneri ATCC
           19865]
 gi|325548960|gb|EGD19892.1| flagellar motor switch protein FliM [Xanthomonas gardneri ATCC
           19865]
          Length = 337

 Score = 36.2 bits (82), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 50/285 (17%), Positives = 102/285 (35%), Gaps = 25/285 (8%)

Query: 26  GDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQ 85
           G   T+E ++     L++  L  + +   DL    S       KF+  +HS       + 
Sbjct: 49  GRMPTLEMVNERFARLWRIGLFNLIRRSADL----SVRGIDLVKFNEYMHSLYVPTNLNL 104

Query: 86  ASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAV 145
                      I     LV T+++N  G       ++  R  +  E ++ +  + Q  A 
Sbjct: 105 IRFKPLRGTGLIVFEPTLVFTVVDNFFGGDGRYHTRIEGREFTATEMRVVQLMLKQTFAD 164

Query: 146 LNQCISTTQESSPNLEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVL 199
           L +  +   E         D +Y+    N          E+V     ++ +E       +
Sbjct: 165 LKEAWAPVME--------VDFEYINSEINPHFANIVTPREYVVVCRFHVELEGGGGEIHI 216

Query: 200 IIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLN---VNIDTRINLKKTTLKDV 256
            +P   L     +  +      N  +D  +   R+  QL+   V + + +  K+ +L+ +
Sbjct: 217 TLPYSMLEPIRELLDAGIQSDRNDRDDSWNVMLRE--QLDTAEVTLSSVLASKRMSLRQL 274

Query: 257 VTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
             LK+G ++P     +    L      +++ E G    N  ++IT
Sbjct: 275 TGLKVGDILPIDLPAQVP--LCVEEIPLFTGEFGVSNGNNAVKIT 317


>gi|225849132|ref|YP_002729296.1| flagellar motor switch protein FliM [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225644014|gb|ACN99064.1| flagellar motor switch protein FliM [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 322

 Score = 36.2 bits (82), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 60/131 (45%), Gaps = 3/131 (2%)

Query: 179 EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQL 238
           E V  + M + IE +   F    PQ   L    I  S  +  E  + D  +   +K  ++
Sbjct: 188 EKVIVVEMILDIEGLEVPFSFAFPQMMFLPLKDIIFSETSSLEIPA-DWKENILKKLSKV 246

Query: 239 NVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAI-LSANGKEIYSCELGRVGKNYT 297
            +N    ++     +++++ L++G  I  L+ +K  +I L   GK  ++ +LGR  K Y 
Sbjct: 247 ELNFTLELSRFTMLVEELLNLEVGSDI-ILNVKKDDSINLMVEGKPKFTAKLGRYDKKYA 305

Query: 298 IRITDRINFDQ 308
             I DR+  ++
Sbjct: 306 AMIVDRVKGEE 316


>gi|223041119|ref|ZP_03611374.1| flagellar motor switch protein FliM [Campylobacter rectus RM3267]
 gi|222877613|gb|EEF12739.1| flagellar motor switch protein FliM [Campylobacter rectus RM3267]
          Length = 367

 Score = 36.2 bits (82), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 53/273 (19%), Positives = 111/273 (40%), Gaps = 28/273 (10%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
           V+I   S     +   + S      F+  S+     N  +  + ++   +++ LLG + E
Sbjct: 79  VEIRLHSVDQMTYGEFLMSLPSPTSFNVFSIKPLDGNCVLEINPSIAFPMIDRLLGGNGE 138

Query: 118 TIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFY-DIDYLKKNTNRL 176
                 +R L+ +E  L       + A+L   +   +ES   + D Y +++  + + N +
Sbjct: 139 GFEA--SRELTDIEVNL-------LDAILRMMMQRLKESWSMITDMYPNVEAKESSPNVV 189

Query: 177 S----NEFVTTINMNMTIENVASSFVLIIPQ---ETLL-----KTTLISLSSQNKSENQS 224
                NE V  + M + + N +    +  P    E +L     +  ++  +S  KS N+ 
Sbjct: 190 QIVSQNEIVIMVVMEIIVGNSSGMINICYPVIYLEPILSRLANRDIMLGETSAKKSRNKE 249

Query: 225 EDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEI 284
              +   A   Y+        +     ++ + + LK G ++         AI++ + KE+
Sbjct: 250 LKTLIGRAEVLYE------AILGKSVVSVNEFLNLKEGDILRLDRSANDKAIVTIDKKEV 303

Query: 285 YSCELGRVGKNYTIRITDRINFDQKSLKNFLHK 317
           +  E+G      +IRI + I  D+  +KN L +
Sbjct: 304 FLAEVGLHRFRKSIRIEELIRSDKDEIKNILEQ 336


>gi|307718611|ref|YP_003874143.1| hypothetical protein STHERM_c09230 [Spirochaeta thermophila DSM
           6192]
 gi|306532336|gb|ADN01870.1| hypothetical protein STHERM_c09230 [Spirochaeta thermophila DSM
           6192]
 gi|315186376|gb|EFU20136.1| flagellar motor switch protein FliM [Spirochaeta thermophila DSM
           6578]
          Length = 341

 Score = 36.2 bits (82), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 36/72 (50%)

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
           + VN+   +      ++D+++++ G VI    R K   +L    +  + C  GRVGK   
Sbjct: 259 VEVNLVVEVGSMNLKMRDILSIQKGDVIMLPTRVKEPLVLKIENRPKFYCRPGRVGKKLA 318

Query: 298 IRITDRINFDQK 309
           +++ ++I   Q+
Sbjct: 319 VQLVEKIEESQE 330


>gi|73532540|dbj|BAE19828.1| flagellar motor switch protein [Edwardsiella tarda]
          Length = 337

 Score = 35.8 bits (81), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 39/213 (18%), Positives = 89/213 (41%), Gaps = 20/213 (9%)

Query: 102 NLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLE 161
           +LV   ++NL G       ++  R  +  E+++ +R       +L   +   +++   + 
Sbjct: 123 SLVFMAVDNLFGGDGRFPTKVDGREFTHTEQRVIQR-------MLRLALDAYRDAWGAIF 175

Query: 162 DFYDIDYLKK-------NTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLI 212
              D+ Y++        N     N+ V T    + +  ++  F + IP   +  L+  L+
Sbjct: 176 KL-DVKYVRSKIQVKFTNITTSPNDIVVTTPFTVEVGALSGEFNICIPFSMIGTLRELLV 234

Query: 213 SLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREK 272
           +   +N S+ + +   D  +++     + +          L DV+ L+IG V+P    ++
Sbjct: 235 NPPLEN-SKQEDQHWRDTLSKQVQHSELELVANFVDVPLRLSDVLKLQIGDVLPIDRPDR 293

Query: 273 TCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
             A  + +G  + +C+ G     Y +R+   IN
Sbjct: 294 LVA--NVDGVPVLTCQYGCYHGQYALRVEKMIN 324


>gi|269792932|ref|YP_003317836.1| flagellar motor switch protein FliM [Thermanaerovibrio
           acidaminovorans DSM 6589]
 gi|269100567|gb|ACZ19554.1| flagellar motor switch protein FliM [Thermanaerovibrio
           acidaminovorans DSM 6589]
          Length = 335

 Score = 35.8 bits (81), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 45/240 (18%), Positives = 96/240 (40%), Gaps = 15/240 (6%)

Query: 70  FSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLST 129
           +   I S  +  V     +   S N  +  + +LV  +++ +LG   E I +   R L+ 
Sbjct: 90  YDEFIRSLVQPTVIGVLEMYPLSGNAVLEMNPHLVFAIIDRMLGGKGEPIRK--PRDLTD 147

Query: 130 VEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMT 189
           +E+ + +R + +I   L +  ST  +     E      +  +       + V  + + + 
Sbjct: 148 IERTVVERVMLKILEHLEESWSTVVDIRFRFESMESNPFFVQICP--GTDMVLLVTLKVQ 205

Query: 190 IENVASSFVLIIPQETLLKTTLISLSSQN-------KSENQSEDLIDPFARKTYQLNVNI 242
           +        L IP   +++  +  LSSQ+       K+   + ++I+    +  ++ V +
Sbjct: 206 VGEAEGIMNLCIPY-FVMEPMIDKLSSQHWFASTGRKNVEGAREIIEA---RLSKVAVPV 261

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
              +     +L DV+ L+ G VI    +      L    +  + CE G   K+Y  R+ +
Sbjct: 262 ALELGHTVLSLGDVLQLREGDVIRLDAKTSDPLGLRVGNRVKFLCEAGSFNKHYAARVLE 321


>gi|209964207|ref|YP_002297122.1| flagellar motor switch protein FliM [Rhodospirillum centenum SW]
 gi|7025351|gb|AAF35843.1|AF220001_1 polar motor switch protein FpiM [Rhodospirillum centenum]
 gi|209957673|gb|ACI98309.1| flagellar motor switch protein FliM [Rhodospirillum centenum SW]
          Length = 362

 Score = 35.8 bits (81), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 49/251 (19%), Positives = 101/251 (40%), Gaps = 16/251 (6%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
           V++S     S +F   ++S     + +      W +   +   + L+ ++++ LLG    
Sbjct: 109 VEVSLDQISSVRFGDYLNSIPLPAMLAVFKAEEWDNYGLMVIDSALIYSIVDVLLGGRRG 168

Query: 118 TIP-QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-- 174
           T   ++  R  +T+E+ L +R    +  VL+   +     SP     +  D L+ N    
Sbjct: 169 TAAMRIEGRPYTTIERNLVER---MVHVVLSDLSAAFDPLSPVT---FRFDRLETNPRFA 222

Query: 175 ---RLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLID 229
              R +N  V  + + + +E+      L+IP  TL  ++  L+ +    K    S     
Sbjct: 223 TIARQANAAV-LVKLRIDMEDRGGRLELLIPYATLEPVRELLLQMFMGEKFGRDSI-WET 280

Query: 230 PFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCEL 289
             A + +  +V++   ++    +L DV+  +IG  +           L      ++   +
Sbjct: 281 HLASELWMTDVHLSAVLDEITLSLYDVLNWRIGSRVLLNVAPDDTIELRCGDVPMFLGRM 340

Query: 290 GRVGKNYTIRI 300
           GR G N  +RI
Sbjct: 341 GRKGGNIAVRI 351


>gi|150390473|ref|YP_001320522.1| flagellar motor switch protein FliM [Alkaliphilus metalliredigens
           QYMF]
 gi|149950335|gb|ABR48863.1| flagellar motor switch protein FliM [Alkaliphilus metalliredigens
           QYMF]
          Length = 331

 Score = 35.8 bits (81), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 42/191 (21%), Positives = 79/191 (41%), Gaps = 15/191 (7%)

Query: 82  VFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQ 141
           V S  + +       +  S ++  TL+E +LG   +   ++  R  + +E  L K+ + Q
Sbjct: 102 VLSIINFTPLEGQIIVDISPSISFTLIERILGGVGKGTEEV--RPFTEIETTLIKKLMRQ 159

Query: 142 ISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRL----SNEFVTTINMNMTIENVASSF 197
           +  ++        E  P L      D ++ N+        N+ V  + +N+ I +V    
Sbjct: 160 VINLMVDPWENVIELQPKL------DKIETNSQFAQIVSPNDTVALVTLNLKIGDVEGMM 213

Query: 198 VLIIPQ---ETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLK 254
            + IP    E +L      L   N S+  +E       ++  +  VNI  ++     T+K
Sbjct: 214 NICIPHIVIEPILDKLSTKLWFSNISKPVTESDKKALQKRVEKSTVNITAQLGGTCVTVK 273

Query: 255 DVVTLKIGQVI 265
           D + L+IG VI
Sbjct: 274 DFLELQIGDVI 284


>gi|78224292|ref|YP_386039.1| flagellar motor switch protein FliM [Geobacter metallireducens
           GS-15]
 gi|78195547|gb|ABB33314.1| Flagellar motor switch protein FliM [Geobacter metallireducens
           GS-15]
          Length = 327

 Score = 35.8 bits (81), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 19/93 (20%), Positives = 41/93 (44%), Gaps = 1/93 (1%)

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
           V+I      S KF   +H+       +            I   + LV T+++ +LG +  
Sbjct: 75  VEIKKVGAASFKFDDFLHTMPSPVAMAVYKADPLKGAALIAFDSTLVFTIVDCILGGTGS 134

Query: 118 T-IPQLYNRSLSTVEKKLAKRTIAQISAVLNQC 149
           + +P + NR  +++E +L ++ +  + A L + 
Sbjct: 135 SVVPTVGNRMFTSIELRLVQKIVMDVLADLEKA 167


>gi|166712025|ref|ZP_02243232.1| flagellar motor switch protein FliM [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 337

 Score = 35.8 bits (81), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 49/285 (17%), Positives = 103/285 (36%), Gaps = 25/285 (8%)

Query: 26  GDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQ 85
           G   T+E ++     L++  L  + +   DL    S       KF+  +HS       + 
Sbjct: 49  GRMPTLEMVNERFARLWRIGLFNLIRRSADL----SVRGIDLVKFNEYMHSLYVPTNLNL 104

Query: 86  ASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAV 145
                      I     LV T+++N  G       ++  R  +  E ++ +  + Q  A 
Sbjct: 105 IRFKPLRGTGLIVFEPTLVFTVVDNFFGGDGRYHTRIEGREFTATEMRVVQLMLKQTFAD 164

Query: 146 LNQCISTTQESSPNLEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVL 199
           L +  +   +         D++Y+    N          E+V     ++ +E       +
Sbjct: 165 LKEAWAPVMD--------VDLEYINSEINPHFANIVTPREYVVVCRFHVELEGGGGEIHI 216

Query: 200 IIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLN---VNIDTRINLKKTTLKDV 256
            +P   L     +  +      N  +D  +   R+  QL+   V + + +  K+ +L+ +
Sbjct: 217 TLPYSMLEPIRELLDAGIQSDRNDRDDSWNVMLRE--QLDTAEVTLSSVLASKRMSLRQL 274

Query: 257 VTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
             LK+G ++P     +    L      +++ E G    N  ++IT
Sbjct: 275 TGLKVGDILPIDLPAQVP--LCVEEIPLFTGEFGVSNGNNAVKIT 317


Searching..................................................done


Results from round 2




>gi|254780687|ref|YP_003065100.1| flagellar C-ring protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040364|gb|ACT57160.1| flagellar C-ring protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 318

 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 318/318 (100%), Positives = 318/318 (100%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI
Sbjct: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP
Sbjct: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF
Sbjct: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNV 240
           VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNV
Sbjct: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNV 240

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
           NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI
Sbjct: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300

Query: 301 TDRINFDQKSLKNFLHKR 318
           TDRINFDQKSLKNFLHKR
Sbjct: 301 TDRINFDQKSLKNFLHKR 318


>gi|190890355|ref|YP_001976897.1| flagellar C-ring motor switch protein [Rhizobium etli CIAT 652]
 gi|190695634|gb|ACE89719.1| flagellar C-ring motor switch protein [Rhizobium etli CIAT 652]
          Length = 316

 Score =  336 bits (861), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 103/316 (32%), Positives = 169/316 (53%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           M       +   + P LLA+LTG LGD+  + KI S+ G +Y +F P + K +  LDV +
Sbjct: 1   MTMSDASHDKPAMDPALLAKLTGGLGDRGRVSKICSAFGEVYSEFFPDVIKSETGLDVTV 60

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           +Y  C+ G  +H++     N     A+L +WS N  + C N  VITL+E+LLGA+ +TI 
Sbjct: 61  NYLGCEIGYKNHLVDDLSANVTLVDATLRNWSQNITLACGNGFVITLMEHLLGATADTIE 120

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           +  +R LS +E  LA     +I+ VL   ++      P+L   +  D   +      +EF
Sbjct: 121 EPADRLLSIIELDLAVMVFDKIAKVLRSAVNAPGGFEPSLSAPHAHDARARPPEDKPDEF 180

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNV 240
              INM++T+  + S F LI+PQ  LLKT +     + ++   S +  +    +  + +V
Sbjct: 181 AAAINMSLTLAGIVSEFSLIVPQTALLKTKVTPPKPKRQAAGASPEWTEQLGDQVRRSHV 240

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            ++ RI L+  TL+ +  L +G VIPF         +SAN KE+Y CE GR G+NY +R+
Sbjct: 241 TLEARIRLQDLTLRTISKLMVGDVIPFRDSGDVRVEVSANSKELYVCEFGRSGENYMVRV 300

Query: 301 TDRINFDQKSLKNFLH 316
            D +N D + +++ ++
Sbjct: 301 KDTMNSDDELIRHLMN 316


>gi|241203098|ref|YP_002974194.1| surface presentation of antigens (SPOA) protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240856988|gb|ACS54655.1| surface presentation of antigens (SPOA) protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 316

 Score =  336 bits (861), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 104/316 (32%), Positives = 172/316 (54%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           M   +   +   + P LLA+LTG LGD+  + KI SS G +Y +F P + K +  LDV +
Sbjct: 1   MTMSNASHDKPAMDPALLAKLTGGLGDRGGVAKICSSFGEIYSEFFPDVIKSETGLDVTV 60

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           +Y  C+ G  +H+I     N     A+L +WS N  + C N  VITL+E+LLGA+ +TI 
Sbjct: 61  NYLGCEIGYKNHLIEDLSANVTLVDATLRNWSQNITLACGNGFVITLMEHLLGATADTIE 120

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           +  +R LS +E  LA     +I+ VL   ++      P+L   + +D   +      +EF
Sbjct: 121 EPADRLLSIIELDLAVMVFDKIAKVLRSAVNAPGGFEPSLSAPHALDARARPPEDRPDEF 180

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNV 240
              INM++T+  + S F LI+PQ  LLKT +     + ++  +S +  +    +  + +V
Sbjct: 181 AAAINMSITLAGIVSEFALIVPQTALLKTKVTPPKPKRQATGKSPEWTEQLGDQVRRSHV 240

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            ++ +I L+  TL+ +  L +G VIPF         +SAN KE+Y CE GR G+NY +R+
Sbjct: 241 TLEAKIRLQDLTLRTISKLMVGDVIPFRDHGDVRVEVSANSKELYVCEFGRSGENYMVRV 300

Query: 301 TDRINFDQKSLKNFLH 316
            D +N D + +++ ++
Sbjct: 301 KDTMNSDDELIRHLMN 316


>gi|116250474|ref|YP_766312.1| flagella motor switch protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115255122|emb|CAK06196.1| putative flagella motor switch protein [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 316

 Score =  336 bits (861), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 105/316 (33%), Positives = 171/316 (54%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           M   +   +   + P LLA+LTG LGD+  + KI SS G +Y +F P + K +  LDV +
Sbjct: 1   MTMSNASHDKPAMDPALLAKLTGGLGDRGRVAKICSSFGEIYSEFFPDVIKSETGLDVTV 60

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           +Y  C+ G  +H+I     N     A+L +WS N  + C N  VITL+E+LLGA+ +TI 
Sbjct: 61  NYLGCEIGYKNHLIEDLSANVTLVDATLRNWSQNITLACGNGFVITLMEHLLGATADTIE 120

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           +  +R LS +E  LA     +I+ VL   ++      P+L   Y  D   +      +EF
Sbjct: 121 EPADRLLSIIELDLAVMVFDKIAKVLRSAVNAPGGFEPSLSAPYAHDMRARPQEDRPDEF 180

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNV 240
              INM++T+  + S F LI+PQ  LLKT +     + ++ + S +  +    +  + +V
Sbjct: 181 AAAINMSITLAGIVSEFSLIVPQTALLKTKVTPPKPKRQASSNSAEWTEQLGDQVRRSHV 240

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            ++ +I L+  TL+ +  L +G VIPF         +SAN KE+Y CE GR G+NY +R+
Sbjct: 241 TLEAKIRLQDLTLRTISKLMVGDVIPFRDHGDVRVEVSANSKELYVCEFGRSGENYMVRV 300

Query: 301 TDRINFDQKSLKNFLH 316
            D +N D + +++ ++
Sbjct: 301 KDTMNSDDELIRHLMN 316


>gi|86356304|ref|YP_468196.1| flagellar C-ring protein [Rhizobium etli CFN 42]
 gi|86280406|gb|ABC89469.1| flagellar C-ring protein [Rhizobium etli CFN 42]
          Length = 316

 Score =  336 bits (861), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 106/316 (33%), Positives = 168/316 (53%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           M       +   + P LLA+LTG LGD+  + KI S+ G +Y +FLP I K +  LDV +
Sbjct: 1   MTMSDASHDKPAMDPALLAKLTGGLGDRGRVAKICSAFGDVYGEFLPDIIKSETGLDVTV 60

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           SY  C+ G  +H++     N     A+L +WS N  + C N  VITL+E+LLGA+ +TI 
Sbjct: 61  SYLGCEIGYKNHLVDDLSHNVTLVDATLRNWSQNVTLACGNGFVITLMEHLLGATADTIE 120

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           +   R LS +E  LA     +I+ VL   ++      P+L   +  D   +      +EF
Sbjct: 121 EPAERLLSVIELDLAVMVFDKIAKVLRSAVNAPGGFEPSLSAPHAHDARPRPAEDKPDEF 180

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNV 240
              INM++T+  + S F LIIPQ  LLKT +     + ++   S +  +    +  + +V
Sbjct: 181 AAAINMSITLAGIVSEFSLIIPQTALLKTKVTPPKPKRQTGGNSPEWTEQLGDQVRRSHV 240

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            ++ +I L+  TL+ +  L  G VIPF         +SAN KE+Y CE GR G+NY +R+
Sbjct: 241 TLEAKIRLQDLTLRTISKLMAGDVIPFHDSGDVRVEVSANSKELYICEFGRSGENYMVRV 300

Query: 301 TDRINFDQKSLKNFLH 316
            D +N D + +++ ++
Sbjct: 301 KDTMNSDDELIRHLMN 316


>gi|327193028|gb|EGE59940.1| flagellar C-ring motor switch protein [Rhizobium etli CNPAF512]
          Length = 314

 Score =  335 bits (859), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 103/310 (33%), Positives = 169/310 (54%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
             +   + P LLA+LTG LGD+  + KI S+ G +Y +F P + K +  LDV ++Y  C+
Sbjct: 5   SHDKPAMDPALLAKLTGGLGDRGRVSKICSAFGEVYSEFFPDVIKSETGLDVTVNYLGCE 64

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
            G  +H++     N     A+L +WS N  + C N  VITL+E+LLGA+ ETI +  +R 
Sbjct: 65  IGYKNHLVDDLSANVTLVDATLRNWSQNITLACGNGFVITLMEHLLGATAETIEEPADRL 124

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
           LS +E  LA     +I+ VL   ++      P+L   +  D   +      +EF   INM
Sbjct: 125 LSIIELDLAVMVFDKIAKVLRSAVNAPGGFEPSLSAPHAHDARPRPPEDKPDEFAAAINM 184

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRI 246
           ++T+  + S F LI+PQ  LLKT + +   + ++   S +  +    +  + +V ++ RI
Sbjct: 185 SLTLAGIVSEFSLIVPQTALLKTKVTAPKPKRQAAGASPEWSEQLGDQVRRSHVTLEARI 244

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
            L+  TL+ +  L +G VIPF         +SAN KE+Y CE GR G+NY +R+ D +N 
Sbjct: 245 RLQDLTLRTISKLMVGDVIPFRDSGDVRVEVSANSKELYVCEFGRSGENYMVRVKDTMNS 304

Query: 307 DQKSLKNFLH 316
           D + +++ ++
Sbjct: 305 DDELIRHLMN 314


>gi|222084857|ref|YP_002543386.1| flagellar C-ring protein [Agrobacterium radiobacter K84]
 gi|221722305|gb|ACM25461.1| flagellar C-ring protein [Agrobacterium radiobacter K84]
          Length = 314

 Score =  334 bits (856), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 106/316 (33%), Positives = 170/316 (53%), Gaps = 2/316 (0%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           M  QS H   + + P+L A+LTG LGD  T+ K+ ++ G +Y +FLP I K +  LDV +
Sbjct: 1   MSQQSTHPKQT-MDPVLFAKLTGGLGDPATLAKLGTAFGQVYAEFLPDIIKSETGLDVSV 59

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
            Y  C+SG  S ++     N      SL +WS NF +GC    V+TL+E+LLGA  ETI 
Sbjct: 60  GYAGCRSGLMSELVAGIGSNCALVNGSLRNWSQNFLLGCGTGFVMTLMEHLLGAQPETID 119

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
               R LS +E  L+     +I+ VL   ++ T    P L+  Y+I+         +++F
Sbjct: 120 SPAARPLSVIELDLSVMVFDKIANVLRSAVNATGGFEPYLDPPYNIEDRPTPVAGQTDDF 179

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNV 240
              I M +++    S  V+I+PQ  LL+T + +  ++N S +      +    +  +  V
Sbjct: 180 AAAIAMTISLGKTVSEIVVIVPQYELLRTVVSAPRAKNPSASTGA-WAEQLNEQVRRSQV 238

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            ++ RI L+  TL  +  L +G VIPF+        +SAN K++Y CE GR G+NYT+R+
Sbjct: 239 TLEARIRLQSLTLDTISRLAVGDVIPFMDTSDVQVEVSANSKDLYVCEFGRSGENYTVRV 298

Query: 301 TDRINFDQKSLKNFLH 316
            D +N D + L++ ++
Sbjct: 299 KDTVNSDDELLRHLMN 314


>gi|209547920|ref|YP_002279837.1| hypothetical protein Rleg2_0312 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533676|gb|ACI53611.1| surface presentation of antigens (SPOA) protein [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 316

 Score =  333 bits (853), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 102/316 (32%), Positives = 170/316 (53%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           M   +   +   + P LLA+LTG LGDK  + KI SS G +Y +F P + K +  L+V +
Sbjct: 1   MTMSNASHDKPAMDPALLAKLTGGLGDKGRVAKICSSFGEIYSEFFPDVIKSETGLEVTV 60

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           +Y  C+ G  +H+I     N      +L +WS N  I C N  VITL+E+LLGA+ +TI 
Sbjct: 61  NYLGCEIGYKNHLIDDLSSNVTLVDVTLRNWSQNITIACGNGFVITLMEHLLGATADTIE 120

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           +  +R LS +E  LA     +I+ VL   ++      P+L   + ++   +      +EF
Sbjct: 121 EPADRLLSIIEMDLAVMVFDKIAKVLRSAVNAPGGFEPSLSVPHALEMRARPPEDRPDEF 180

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNV 240
              INM++T+  + S F L++PQ  LLKT +     + ++   S +  +    +  + +V
Sbjct: 181 AAAINMSITLAGIVSEFSLMVPQTALLKTKVTPPKPKRQAGGSSAEWTEQLGDQVRRSHV 240

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            ++ +I L+  TL+ +  L +G VIPF         +SAN KE+Y CE GR G+NY +R+
Sbjct: 241 TLEAKIRLQDLTLRTISKLMVGDVIPFRDHGDVRVEVSANSKELYVCEFGRSGENYMVRV 300

Query: 301 TDRINFDQKSLKNFLH 316
            D +N D + +++ ++
Sbjct: 301 KDTMNSDDELIRHLMN 316


>gi|315121854|ref|YP_004062343.1| flagellar motor switch protein fliM [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495256|gb|ADR51855.1| flagellar motor switch protein fliM [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 318

 Score =  329 bits (844), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 208/317 (65%), Positives = 254/317 (80%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           MR +   K+ SPLHP+LLARLTGKLGDKKTIE+IS +LG LY K LPK FKE++D+D+++
Sbjct: 1   MREKRTSKDISPLHPVLLARLTGKLGDKKTIERISYNLGQLYTKLLPKSFKEELDVDLNV 60

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           SY + QSGKFSHI+HSFKE FVF + SL+  SSN FIGCSNNLVI LLE LL AS ET  
Sbjct: 61  SYGNYQSGKFSHILHSFKERFVFYKTSLNGRSSNLFIGCSNNLVIVLLETLLRASCETTQ 120

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           + +NRSLST+EKKLA   + +I+ VL+QCIST Q +   L++ Y++D+LK+NTN LSNEF
Sbjct: 121 KSHNRSLSTIEKKLAHLIVTKIATVLDQCISTAQNNRVTLDENYELDFLKQNTNLLSNEF 180

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNV 240
           VT I M +TI+N+AS F LIIPQETLLK TLISLS Q KS    ED  D     TY+++V
Sbjct: 181 VTAITMVVTIDNIASLFTLIIPQETLLKITLISLSEQGKSAIPLEDCPDQLNGNTYKIHV 240

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            I++RINL+K TLKDV+ LKIGQV+PFL +EK  AIL+ANGKEIYSCELGR+GKNYT+RI
Sbjct: 241 KIESRINLQKITLKDVLNLKIGQVMPFLDKEKVYAILNANGKEIYSCELGRIGKNYTVRI 300

Query: 301 TDRINFDQKSLKNFLHK 317
            DRINFDQ+SL+NFLHK
Sbjct: 301 QDRINFDQESLRNFLHK 317


>gi|222147563|ref|YP_002548520.1| flagellar motor switch protein [Agrobacterium vitis S4]
 gi|221734551|gb|ACM35514.1| flagellar motor switch protein [Agrobacterium vitis S4]
          Length = 319

 Score =  319 bits (818), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 106/305 (34%), Positives = 169/305 (55%)

Query: 12  PLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFS 71
           P+   LLARLTG LGD K++EK+    G LY +FLP +F  + +L +++ Y   +SG   
Sbjct: 15  PMDHALLARLTGGLGDMKSVEKLCQDFGQLYSEFLPDVFHSETNLTIEVGYLGFKSGLMR 74

Query: 72  HIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVE 131
            +I S  +NFV +  SL +WS NF + C N  VITL+E LLG   E I +   R LS +E
Sbjct: 75  DLIASLGDNFVLANTSLRNWSQNFVMACGNGFVITLMETLLGGMQEFIGEPIKRPLSNIE 134

Query: 132 KKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIE 191
             LA     +I+ VL   ++ T    P  E  ++ +   +       EF   ++M++ + 
Sbjct: 135 LDLAVMVFERIANVLRSGVNATGGFEPIFERPHNWENRLRQDGEQIEEFGALVHMSIKLG 194

Query: 192 NVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
            + S F LIIPQ+TLLKT + +  S+N+     ++  +  A +  +  V ++ RI+L+  
Sbjct: 195 KITSDFALIIPQKTLLKTNVTAPKSKNQVSKARKEWAEQLAEQVRKSQVTLEGRISLQSL 254

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSL 311
           +L  V  L  G VIPFL +      +SANG+++Y+CE GR G +YT+R+    + D + L
Sbjct: 255 SLLTVSKLAAGDVIPFLEKGDVTVDVSANGRDLYTCEFGRAGDHYTVRVKSMHSTDSELL 314

Query: 312 KNFLH 316
           ++ + 
Sbjct: 315 RHLMR 319


>gi|3894104|emb|CAA11954.1| flagellar C-ring protein [Sinorhizobium meliloti]
          Length = 315

 Score =  306 bits (783), Expect = 4e-81,   Method: Composition-based stats.
 Identities = 92/312 (29%), Positives = 158/312 (50%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   N       L+AR+TG LGD K I + +  L  ++ + LP + + +   DV I+Y  
Sbjct: 4   STASNVHAFDRRLIARMTGALGDDKVIGRTALELAQVFDELLPGVLQSETGCDVTIAYAG 63

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            ++G  + +I +  +  +    SL +W ++F +GC + ++I L+E LLGA   +I +   
Sbjct: 64  FRTGLRNDLIAALGDGVLLGDFSLRNWCADFQVGCDSPVLIALVEALLGAEPTSIEEPAP 123

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           RSLS +E  +A      I+ VL   ++      P +   Y+     K    L + F  +I
Sbjct: 124 RSLSKIEIDVALPVFHGIAEVLRTAVNAPGGFEPVVGRPYNSAERAKPDPVLEDVFAASI 183

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDT 244
           +M + +  V S+F +I+PQ TLLKT ++S     +  N   +  +    +  +  V ++ 
Sbjct: 184 DMTIGLGPVLSTFSVIVPQSTLLKTRIVSRKGAGEDRNAKTEWTEQLEEQVRRSAVALEA 243

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
           RI L+  TL  +  L+ G VIPF   +     +SANG+++Y CE GR G  YT+R+ D  
Sbjct: 244 RIRLESLTLDTLSRLQAGDVIPFHDGQDVRVEVSANGRDLYVCEFGRSGSRYTVRVKDTH 303

Query: 305 NFDQKSLKNFLH 316
             +Q  L++ + 
Sbjct: 304 GSEQDILRHIMS 315


>gi|150395476|ref|YP_001325943.1| surface presentation of antigens (SPOA) protein [Sinorhizobium
           medicae WSM419]
 gi|150026991|gb|ABR59108.1| surface presentation of antigens (SPOA) protein [Sinorhizobium
           medicae WSM419]
          Length = 315

 Score =  305 bits (780), Expect = 7e-81,   Method: Composition-based stats.
 Identities = 91/312 (29%), Positives = 157/312 (50%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           +   N       LLAR+ G LGD K I++++  L  ++ + LP + + +   DV I+Y  
Sbjct: 4   NTASNIHAFDKRLLARMIGALGDDKVIDRLALELAQIFDELLPGVLRSETGCDVTIAYAG 63

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            ++G  + ++    +  +    SL +W ++F IGC + ++I L+E LLGA    I +   
Sbjct: 64  FRAGLRNELVAGLGDGVLIGDLSLRNWCTDFQIGCDSPVLIALVEALLGAEPAGIEEPAP 123

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           RSLS +E  +A      I+ VL   ++      P +   Y+     K    L + +  +I
Sbjct: 124 RSLSKIEIDVALPVFHGIAEVLRIAVNAPGGFEPVVGRPYNSAERAKPDPALEDVYAASI 183

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDT 244
           +M + +  V S+F +I+PQ TLLKT  +S     K +N   +  +    +  +  V ++ 
Sbjct: 184 DMTIGLGPVLSTFSVIVPQSTLLKTRFVSPKGAGKDQNAKTEWTEQLEEQVRRSAVALEA 243

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
           RI L+  TL  +  L+ G VIPF   +     +SANG+++Y CE GR G  YT+R+ D  
Sbjct: 244 RIRLESLTLDTIARLQAGDVIPFHDGQDVRVEVSANGRDLYVCEFGRSGSKYTVRVKDTH 303

Query: 305 NFDQKSLKNFLH 316
             +Q  L++ + 
Sbjct: 304 GSEQDILRHIMS 315


>gi|307311548|ref|ZP_07591189.1| surface presentation of antigens (SPOA) protein [Sinorhizobium
           meliloti BL225C]
 gi|306899565|gb|EFN30194.1| surface presentation of antigens (SPOA) protein [Sinorhizobium
           meliloti BL225C]
          Length = 315

 Score =  305 bits (780), Expect = 7e-81,   Method: Composition-based stats.
 Identities = 92/312 (29%), Positives = 158/312 (50%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   N       L+AR+TG LGD K I + +  L  ++ + LP + + +   DV I+Y  
Sbjct: 4   STASNVHAFDRRLIARMTGALGDDKVIGRTALELAQVFDELLPGVLQSETGCDVTIAYAG 63

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            ++G  + +I +  +  +    SL +W ++F +GC + ++I L+E LLGA   +I +   
Sbjct: 64  FRTGLRNELIAALGDGVLLGDLSLRNWCADFQVGCDSPVLIALVEALLGAEPTSIEEPAP 123

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           RSLS +E  +A      I+ VL   ++      P +   Y+     K    L + F  +I
Sbjct: 124 RSLSKIEIDVALPVFHGIAEVLRTAVNAPGGFEPVVGRPYNSAERGKPDPVLQDVFAASI 183

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDT 244
           +M + +  V S+F +I+PQ TLLKT ++S     +  N   +  +    +  +  V ++ 
Sbjct: 184 DMTIGLGPVLSTFSVIVPQSTLLKTRVVSRKGAGEDRNAKTEWTEQLEEQVRRSAVALEA 243

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
           RI L+  TL  +  L+ G VIPF   +     +SANG+++Y CE GR G  YT+R+ D  
Sbjct: 244 RIRLESLTLDTLSRLQAGDVIPFHDGQDVRVEVSANGRDLYVCEFGRSGSRYTVRVKDTH 303

Query: 305 NFDQKSLKNFLH 316
             +Q  L++ + 
Sbjct: 304 GSEQDILRHIMS 315


>gi|15964406|ref|NP_384759.1| flagellar motor switch transmembrane protein [Sinorhizobium
           meliloti 1021]
 gi|307318903|ref|ZP_07598334.1| surface presentation of antigens (SPOA) protein [Sinorhizobium
           meliloti AK83]
 gi|17380372|sp|O54246|FLIM_RHIME RecName: Full=Flagellar motor switch protein FliM
 gi|15073583|emb|CAC45225.1| Flagellar motor switch transmembrane protein [Sinorhizobium
           meliloti 1021]
 gi|306895317|gb|EFN26072.1| surface presentation of antigens (SPOA) protein [Sinorhizobium
           meliloti AK83]
          Length = 315

 Score =  305 bits (780), Expect = 8e-81,   Method: Composition-based stats.
 Identities = 92/312 (29%), Positives = 158/312 (50%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   N       L+AR+TG LGD K I + +  L  ++ + LP + + +   DV I+Y  
Sbjct: 4   STASNVHAFDRRLIARMTGALGDDKVIGRTALELAQVFDELLPGVLQSETGCDVTIAYAG 63

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            ++G  + +I +  +  +    SL +W ++F +GC + ++I L+E LLGA   +I +   
Sbjct: 64  FRTGLRNELIAALGDGVLLGDLSLRNWCADFQVGCDSPVLIALVEALLGAEPTSIEEPAP 123

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           RSLS +E  +A      I+ VL   ++      P +   Y+     K    L + F  +I
Sbjct: 124 RSLSKIEIDVALPVFHGIAEVLRTAVNAPGGFEPVVGRPYNSAERAKPDPVLQDVFAASI 183

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDT 244
           +M + +  V S+F +I+PQ TLLKT ++S     +  N   +  +    +  +  V ++ 
Sbjct: 184 DMTIGLGPVLSTFSVIVPQSTLLKTRVVSRKGAGEDRNAKTEWTEQLEEQVRRSAVALEA 243

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
           RI L+  TL  +  L+ G VIPF   +     +SANG+++Y CE GR G  YT+R+ D  
Sbjct: 244 RIRLESLTLDTLSRLQAGDVIPFHDGQDVRVEVSANGRDLYVCEFGRSGSRYTVRVKDTH 303

Query: 305 NFDQKSLKNFLH 316
             +Q  L++ + 
Sbjct: 304 GSEQDILRHIMS 315


>gi|159184367|ref|NP_353588.2| flagellar motor switch protein [Agrobacterium tumefaciens str. C58]
 gi|159139681|gb|AAK86373.2| flagellar motor switch protein [Agrobacterium tumefaciens str. C58]
          Length = 319

 Score =  298 bits (762), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 92/305 (30%), Positives = 168/305 (55%), Gaps = 2/305 (0%)

Query: 13  LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSH 72
           +   LLA+LTG L D+KTI KI + +G+LY +FLP  F  +  + +D+ Y   +SG  + 
Sbjct: 14  IDTALLAKLTGGLTDRKTIAKIGADIGHLYSEFLPDTFHSETGIAIDVEYIGSESGLMTD 73

Query: 73  IIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEK 132
           +I +  +N   +  SL +W  NF +   N  VI L+E +LGAS ++I     R+LS +E 
Sbjct: 74  LIANVGQNVAVADCSLRNWCPNFMMAVGNGFVIALMERMLGASPDSIGDPDERNLSHIEL 133

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            LA   + +I+ VL   ++        ++  ++ +        ++  +  TI M + I  
Sbjct: 134 DLAAMVLGRIAGVLRSGVNAPGGFEATIDPPFNANGKSAFDEMIAGLYGVTIRMKIDIGK 193

Query: 193 VASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTT 252
           V+S F LI+PQ  LLKT++++  +  ++  + E+ +D  +++  +  V ++ RI L+  T
Sbjct: 194 VSSEFSLIVPQRPLLKTSIVAPKASAQALKKQEEWMDMISQQVKRSQVTLEARIKLETLT 253

Query: 253 LKDVVTLKIGQVIPFLH--REKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
           L+ +  L  G VIPF    ++     +SANG ++Y+CE G+ G  Y +R+ + ++ D + 
Sbjct: 254 LRTISRLVAGDVIPFQDLKQDDIGVEVSANGSKLYNCEFGKSGDRYMVRVKNNVSTDDEI 313

Query: 311 LKNFL 315
           L++ +
Sbjct: 314 LRHLM 318


>gi|227820849|ref|YP_002824819.1| Flagellar motor switch protein FliM [Sinorhizobium fredii NGR234]
 gi|227339848|gb|ACP24066.1| Flagellar motor switch protein FliM [Sinorhizobium fredii NGR234]
          Length = 315

 Score =  297 bits (761), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 91/312 (29%), Positives = 157/312 (50%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   N       LLAR+TG LGD KTI + +  LG+++ + LP++ K++   D+ I Y  
Sbjct: 4   STDSNVYAFDKKLLARMTGALGDDKTIGRTALELGHVFSERLPEMLKQETGRDIAIGYAG 63

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            + G  + +I    E  + S  SL +W + F IGC + ++I L+E LLGA    I +   
Sbjct: 64  VKMGFRNELIADLGEAVLLSDVSLRNWCAEFQIGCDSPVLIALVEALLGAEPIDIEEPLP 123

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R+LS +E  +A     +I+  +   +       P +   ++          L + +  +I
Sbjct: 124 RALSKIEIDVAVPVFERIAEAVRMAVDAPGGFEPVVGRPHNGAERLPPDPALEDVYAASI 183

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDT 244
           +M   +  V S+F +IIPQ  LLKT ++   +  ++E+   D  +    +  +  V ++ 
Sbjct: 184 DMTFGLGPVLSTFSVIIPQNVLLKTQIVPPGNAGRNESMKTDWSEQLEEQIRRSAVTLEA 243

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
           RI L+  TL  +  L+ G VIPF   +     ++ANG+++Y CE GR G  YT+R+ D  
Sbjct: 244 RIQLESLTLDTISRLQPGDVIPFHDGQDVRVEVNANGRDLYVCEFGRSGSRYTVRVKDTH 303

Query: 305 NFDQKSLKNFLH 316
             +Q  L++ + 
Sbjct: 304 GSEQDILRHIMS 315


>gi|20141429|sp|Q44457|FLIM_AGRT5 RecName: Full=Flagellar motor switch protein FliM
          Length = 321

 Score =  297 bits (761), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 92/305 (30%), Positives = 168/305 (55%), Gaps = 2/305 (0%)

Query: 13  LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSH 72
           +   LLA+LTG L D+KTI KI + +G+LY +FLP  F  +  + +D+ Y   +SG  + 
Sbjct: 16  IDTALLAKLTGGLTDRKTIAKIGADIGHLYSEFLPDTFHSETGIAIDVEYIGSESGLMTD 75

Query: 73  IIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEK 132
           +I +  +N   +  SL +W  NF +   N  VI L+E +LGAS ++I     R+LS +E 
Sbjct: 76  LIANVGQNVAVADCSLRNWCPNFMMAVGNGFVIALMERMLGASPDSIGDPDERNLSHIEL 135

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            LA   + +I+ VL   ++        ++  ++ +        ++  +  TI M + I  
Sbjct: 136 DLAAMVLGRIAGVLRSGVNAPGGFEATIDPPFNANGKSAFDEMIAGLYGVTIRMKIDIGK 195

Query: 193 VASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTT 252
           V+S F LI+PQ  LLKT++++  +  ++  + E+ +D  +++  +  V ++ RI L+  T
Sbjct: 196 VSSEFSLIVPQRPLLKTSIVAPKASAQALKKQEEWMDMISQQVKRSQVTLEARIKLETLT 255

Query: 253 LKDVVTLKIGQVIPFLH--REKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
           L+ +  L  G VIPF    ++     +SANG ++Y+CE G+ G  Y +R+ + ++ D + 
Sbjct: 256 LRTISRLVAGDVIPFQDLKQDDIGVEVSANGSKLYNCEFGKSGDRYMVRVKNNVSTDDEI 315

Query: 311 LKNFL 315
           L++ +
Sbjct: 316 LRHLM 320


>gi|1480838|gb|AAC45322.1| FliM [Agrobacterium tumefaciens]
 gi|2459705|gb|AAB71781.1| FliM [Agrobacterium tumefaciens]
          Length = 321

 Score =  295 bits (756), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 92/305 (30%), Positives = 168/305 (55%), Gaps = 2/305 (0%)

Query: 13  LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSH 72
           +   LLA+LTG L D+KTI KI + +G+LY +FLP  F  +  + +D+ Y   +SG  + 
Sbjct: 16  IDTALLAKLTGGLTDRKTIAKIGADIGHLYSEFLPDTFHSETGIAIDVEYIGSESGLMTD 75

Query: 73  IIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEK 132
           +I +  +N   +  SL +W  NF +   N  VI L+E +LGAS ++I     R+LS +E 
Sbjct: 76  LIANVGQNVAVADCSLRNWCPNFMMAVGNGFVIALMERMLGASPDSIGDPDERNLSHIEL 135

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            LA   + +I+ VL   ++        ++  ++ +        ++  +  TI M + I  
Sbjct: 136 DLAAMVLGRIAGVLRSGVNAPCGFVATIDPPFNANGKSAFDEMIAGLYGVTIRMKIDIGK 195

Query: 193 VASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTT 252
           V+S F LI+PQ  LLKT++++  +  ++  + E+ +D  +++  +  V ++ RI L+  T
Sbjct: 196 VSSEFSLIVPQRPLLKTSIVAPKASAQALKKQEEWMDMISQQVKRSQVTLEARIKLETLT 255

Query: 253 LKDVVTLKIGQVIPFLH--REKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
           L+ +  L  G VIPF    ++     +SANG ++Y+CE G+ G  Y +R+ + ++ D + 
Sbjct: 256 LRTISRLVAGDVIPFQDLKQDDIGVEVSANGSKLYNCEFGKSGDRYMVRVKNNVSTDDEI 315

Query: 311 LKNFL 315
           L++ +
Sbjct: 316 LRHLM 320


>gi|325291948|ref|YP_004277812.1| Flagellar motor switch protein [Agrobacterium sp. H13-3]
 gi|45479283|gb|AAS66685.1| FliM [Agrobacterium sp. H13-3]
 gi|325059801|gb|ADY63492.1| Flagellar motor switch protein [Agrobacterium sp. H13-3]
          Length = 319

 Score =  292 bits (748), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 93/305 (30%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 13  LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSH 72
           +   LLA+LTG L D+KTI K+ S +G+LY +FLP IF  +  + +D+ Y   +SG  + 
Sbjct: 14  IDTSLLAKLTGGLSDRKTIAKVGSDIGHLYSEFLPDIFHSETGIAIDVEYIGSESGLMTD 73

Query: 73  IIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEK 132
           +I +   NF  +  SL +W  NF +   N  VI L+E +LGA+ +TI +   RSLS +E 
Sbjct: 74  LIANIGGNFSVADCSLRNWCPNFMMAVGNGFVIALMERMLGAAADTIGEPDERSLSHIEL 133

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            LA   + +I  VL   ++        ++  +  +        ++  +  T+ M + I  
Sbjct: 134 DLAAMVLGRIGGVLRSGVNAPGGFEATIDLPFTANGKSAFEEMIAGLYGVTVRMKIAIGK 193

Query: 193 VASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTT 252
           V+S F LI+PQ  LLKT++ +  +  ++  +  + +D  + +  +  V ++ RI L+  T
Sbjct: 194 VSSEFALIVPQRPLLKTSIAAPKASAQALKKQAEWVDLISEQVKRSQVTLEARIKLETLT 253

Query: 253 LKDVVTLKIGQVIPFLH--REKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
           L+ +  L  G VIPF    ++     +SANG ++Y+CE G+ G  Y +R+ + ++ D + 
Sbjct: 254 LRTISRLVAGDVIPFQDLKQDDIGVEVSANGSKLYNCEFGKSGDRYMVRVKNNVSTDDEI 313

Query: 311 LKNFL 315
           L++ +
Sbjct: 314 LRHLM 318


>gi|328545470|ref|YP_004305579.1| flagellar motor switch protein FliM [polymorphum gilvum
           SL003B-26A1]
 gi|326415211|gb|ADZ72274.1| Flagellar motor switch protein FliM, putative [Polymorphum gilvum
           SL003B-26A1]
          Length = 314

 Score =  262 bits (669), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 56/315 (17%), Positives = 128/315 (40%), Gaps = 28/315 (8%)

Query: 6   IHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSC 65
           I  +  P+ P+L  R+     D                       ++K      IS +  
Sbjct: 25  ISVDRLPMLPVLFDRMARVFADA---------------------MRQKSTSPSYISVSCI 63

Query: 66  QSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNR 125
           ++ +   ++  ++ N + +      W +   +G   + + T+++ L GA     P    R
Sbjct: 64  ENERIGDVLDEYEANALVAVLYSPEWDTRMLVGFDRDFIFTMIDVLFGADGTEPPIDEER 123

Query: 126 SLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYD-IDYLKKNTNRLSNEFVTTI 184
           S S +E ++A+      +  L +  S   E++  +E     +D+      R +N  V   
Sbjct: 124 SFSNIETRIARSVFEVAAKALQESFSPIAETTLKIERVESRMDF--AVVGRRNNPAVVA- 180

Query: 185 NMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNI 242
            + +          +++P  TL  L+  L  + S   S  + +     F  +  +  V +
Sbjct: 181 RLLLQAIGRGGEIFVVMPHSTLNPLRQRLSQVLSGEMSG-RDKQWTQHFQTEIQRTEVRL 239

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
              +  ++ TL ++  L++GQ+I      ++   L  N + I++C LG++  +YT+++ D
Sbjct: 240 QAVLEERELTLGEIANLQVGQIIELQATPRSPVKLECNQQPIFNCLLGQLDGSYTLQVED 299

Query: 303 RINFDQKSLKNFLHK 317
            I+ ++  + + L +
Sbjct: 300 LIHLEKDIVDDLLSR 314


>gi|163758006|ref|ZP_02165094.1| flagellar motor switch transmembrane protein [Hoeflea phototrophica
           DFL-43]
 gi|162284295|gb|EDQ34578.1| flagellar motor switch transmembrane protein [Hoeflea phototrophica
           DFL-43]
          Length = 315

 Score =  256 bits (653), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 72/313 (23%), Positives = 128/313 (40%), Gaps = 2/313 (0%)

Query: 2   RGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDIS 61
             +    +T    P LL R+ G  GD   IE    SL       L + F+   ++ +   
Sbjct: 4   SAKDSKTDTYEFDPELLDRMIGAKGDAAVIEAKCHSLQSAMCGPLERAFEMATNVHLSAR 63

Query: 62  YTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQ 121
               Q G    ++  F ++ VF    +  WS +    C   LVI ++E LLG S      
Sbjct: 64  PGEIQQGSRRQLLSVFGQDAVFCDTWIEGWSRDISALCGTKLVIAMVECLLGGSDPEELD 123

Query: 122 LYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFV 181
           +  R LS +E  ++     Q++  L +  S    +         +D  +   +   +   
Sbjct: 124 IAARPLSGIELDMSLVVFEQLNDTLREVASKDPTAKAGAGKPM-LDIPEAEDDPKPDFHA 182

Query: 182 TTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVN 241
             I + +   +V +   LI+PQ  LLKT  I+ S +N      +D  +    +  +  +N
Sbjct: 183 AAITLELQFGSVVTPLTLILPQSILLKTKPIT-SKKNAPNAVDDDWAERLNARVSRSQIN 241

Query: 242 IDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
           +   + L    + ++  L++G +I F         LSANGK +Y+C LG+ G  Y +++ 
Sbjct: 242 LQAAVALAPLPVGEISRLQVGDLIGFAQTGDIEVTLSANGKALYTCALGKSGARYMVKVE 301

Query: 302 DRINFDQKSLKNF 314
                D+    +F
Sbjct: 302 GDAGPDENWRSDF 314


>gi|254504068|ref|ZP_05116219.1| flagellar motor switch protein FliM, putative [Labrenzia alexandrii
           DFL-11]
 gi|222440139|gb|EEE46818.1| flagellar motor switch protein FliM, putative [Labrenzia alexandrii
           DFL-11]
          Length = 319

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 56/315 (17%), Positives = 126/315 (40%), Gaps = 26/315 (8%)

Query: 6   IHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSC 65
           I  +  P+ P++  R+                        +  + ++K      IS +  
Sbjct: 29  ISVDRLPMLPVVFDRMAR---------------------LMADVMRQKSPSPSYISVSYV 67

Query: 66  QSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNR 125
           ++ +   ++  F+ N + +      W +   +G   + + TL++ L GA     P    R
Sbjct: 68  ENNRIGDVLDEFESNALVAVLYSPEWDARVLVGFDRDFIFTLVDVLFGADGTEPPIDEER 127

Query: 126 SLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTIN 185
             S +E ++A+      +  L +  +   E++  +E       +       SN       
Sbjct: 128 PFSNIETRIARTIFEIAAKSLAESFAPIAETTLKIERIES--RMDFAVVGRSNNPAVVGR 185

Query: 186 MNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNID 243
           +            +++P  TL  L+  L  + S   S  + +     F  +  +  V ++
Sbjct: 186 LLQQAIGRGGEVFVVLPHATLNPLRQALSQVLSGEMSG-RDKQWTQHFHNEIQRTEVKLE 244

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
             +  ++  L ++  LK+GQVI      ++   L+ N + I++C+LG++  +YT++I + 
Sbjct: 245 AILEEREMHLGELSNLKVGQVIELQATARSPVTLACNDQPIFTCQLGQLDGSYTLQIEEL 304

Query: 304 INFDQKSLKNFLHKR 318
           I+ ++K L + L  R
Sbjct: 305 IHEEEKDLFDDLRNR 319


>gi|118589946|ref|ZP_01547350.1| flagellar motor switch protein FliM [Stappia aggregata IAM 12614]
 gi|118437443|gb|EAV44080.1| flagellar motor switch protein FliM [Stappia aggregata IAM 12614]
          Length = 319

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 57/316 (18%), Positives = 131/316 (41%), Gaps = 28/316 (8%)

Query: 6   IHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSC 65
           I  +  P+ P++  R+                        +    ++K      IS +  
Sbjct: 29  ISVDRLPMLPVVFDRMAR---------------------LMADAMRQKSPSPSYISVSYV 67

Query: 66  QSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNR 125
           ++ +   ++  F+ N + +      W +   +G   + + TL++ L GA     P    R
Sbjct: 68  ENNRIGDVLDEFESNALVAVLYSPEWDARVLVGFDRDFIFTLVDVLFGADGTEPPIDDER 127

Query: 126 SLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYD-IDYLKKNTNRLSNEFVTTI 184
             S +E ++A+      +  L +  +   E++  +E     +D+      R +N  V   
Sbjct: 128 PFSNIETRIARTMFEVAAKALAESFAPIAETTLKIERIESRMDF--AVVGRRNNPAVVA- 184

Query: 185 NMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNI 242
            +            +++P  TL  L+  L  + S   S ++ +     F  +  +  V +
Sbjct: 185 RLLQQAIGRGGEVFIVMPHSTLNPLRQRLSQVLSGEMS-SRDKQWTQHFHNEIQRTEVKL 243

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
           +  +  ++ +L D+  L++GQVI      ++   L+ N + +++C+LG++  +YT++I +
Sbjct: 244 EAILEEREMSLGDLANLRVGQVIELQATARSPVTLACNDQPVFTCQLGQLNGSYTLQIDE 303

Query: 303 RINFDQKSLKNFLHKR 318
            I+ ++K L + L  R
Sbjct: 304 LIHEEEKDLFDDLRNR 319


>gi|163850084|ref|YP_001638127.1| flagellar motor switch protein FliM [Methylobacterium extorquens
           PA1]
 gi|163661689|gb|ABY29056.1| flagellar motor switch protein FliM [Methylobacterium extorquens
           PA1]
          Length = 344

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 60/309 (19%), Positives = 116/309 (37%), Gaps = 26/309 (8%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +  P+  ++  RL     D       S++                       S +  +SG
Sbjct: 59  DRLPMLSVVFDRLATACSDAAKHLAASTTF---------------------YSLSGVESG 97

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           +F   + ++  N V        W  +  +G   + + T++E L G+     P    R+ S
Sbjct: 98  RFGEFLDAYDANAVVGIFQAPEWDGHVLVGLDRDFLYTMVEVLFGSDGAEPPVEDERTFS 157

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
            +E ++A+    Q+   L        +++  LE   +         R SN+ V      +
Sbjct: 158 AIELRIAQMVFEQVGKALESSFGLVSQTAFRLER-METRMEFAVIGRRSNKAVQA-KFLL 215

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSED--LIDPFARKTYQLNVNIDTRI 246
              N      LIIPQ T+L     +L      E+ + D    +  A +  +  V +   +
Sbjct: 216 QALNRGGEMFLIIPQ-TVLNPLRPALGKVLTGESAARDPRWAEQIAAEVQKTTVRLRAVL 274

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
             +  TL ++  LK+GQV+       T   L  N + ++ C  G+   +Y +R+ + IN 
Sbjct: 275 EERHLTLGEIAGLKVGQVLTLDATPATRIKLEGNDRPLFWCRAGQSQGSYVLRVEESINP 334

Query: 307 DQKSLKNFL 315
           +++     L
Sbjct: 335 EKEGGHGLL 343


>gi|188579889|ref|YP_001923334.1| flagellar motor switch protein FliM [Methylobacterium populi BJ001]
 gi|179343387|gb|ACB78799.1| flagellar motor switch protein FliM [Methylobacterium populi BJ001]
          Length = 335

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 62/309 (20%), Positives = 116/309 (37%), Gaps = 26/309 (8%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +  P+  ++  RL     D       SS+                       S +  +SG
Sbjct: 50  DRLPMLSVVFDRLATACSDAAKHFAASSTF---------------------YSLSGVESG 88

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           +F   + ++  N V      + W  +  +G   + + T++E L G+     P    R+ S
Sbjct: 89  RFGEFLDAYDANAVVGIFHAAEWDGHVLVGLDRDFLYTMVEVLFGSDGSEPPVEDERTFS 148

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
            +E ++A+    Q+   L        +++  LE   +         R SN+ V      +
Sbjct: 149 AIELRIAQMVFEQVGKALESSFGLVSQTAFRLER-TETRMEFAVIGRRSNKAVQA-KFLL 206

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSED--LIDPFARKTYQLNVNIDTRI 246
              N      LIIPQ T+L     +L+     E+ + D       A +  +  V +   +
Sbjct: 207 QALNRGGEMFLIIPQ-TVLNPLRPALAKVLTGESAARDPRWAQQIAAEVQKTTVRLRAVL 265

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
             +  TL ++  LK+GQV+       T   L  N + ++ C  G+    Y +R+ D IN 
Sbjct: 266 EERHLTLGEIAGLKVGQVLTLDATPATRIKLEGNDRPLFWCRAGQSQGAYVLRVEDAINP 325

Query: 307 DQKSLKNFL 315
           +++     L
Sbjct: 326 EKEGGHGLL 334


>gi|240137217|ref|YP_002961686.1| Flagellar motor switch protein FliM [Methylobacterium extorquens
           AM1]
 gi|240007183|gb|ACS38409.1| Flagellar motor switch protein FliM [Methylobacterium extorquens
           AM1]
          Length = 344

 Score =  252 bits (643), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 60/309 (19%), Positives = 116/309 (37%), Gaps = 26/309 (8%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +  P+  ++  RL     D       S++                       S +  +SG
Sbjct: 59  DRLPMLSVVFDRLATACSDAAKHLAASTTF---------------------YSLSGVESG 97

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           +F   + ++  N V        W  +  +G   + + T++E L G+     P    R+ S
Sbjct: 98  RFGEFLDAYDANAVVGIFQAPEWDGHVLVGLDRDFLYTMVEVLFGSDGAEPPVEDERTFS 157

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
            +E ++A+    Q+   L        +++  LE   +         R SN+ V      +
Sbjct: 158 AIELRIAQMVFEQVGKALESSFGLVSQTAFRLER-METRMEFAVIGRRSNKAVQA-KFLL 215

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSED--LIDPFARKTYQLNVNIDTRI 246
              N      LIIPQ T+L     +L      E+ + D    +  A +  +  V +   +
Sbjct: 216 QALNRGGEMFLIIPQ-TVLNPLRPALGKVLTGESAARDPRWAEQIAAEVQKTTVRLRAVL 274

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
             +  TL ++  LK+GQV+       T   L  N + ++ C  G+   +Y +R+ + IN 
Sbjct: 275 EERHLTLGEIAGLKVGQVLTLDATPATRIKLEGNDRPLFWCRAGQSQGSYVLRVEESINP 334

Query: 307 DQKSLKNFL 315
           +++     L
Sbjct: 335 EKEGGHGLL 343


>gi|218528687|ref|YP_002419503.1| surface presentation of antigens (SPOA) protein [Methylobacterium
           chloromethanicum CM4]
 gi|254559229|ref|YP_003066324.1| flagellar motor switch protein FliM [Methylobacterium extorquens
           DM4]
 gi|218520990|gb|ACK81575.1| surface presentation of antigens (SPOA) protein [Methylobacterium
           chloromethanicum CM4]
 gi|254266507|emb|CAX22271.1| Flagellar motor switch protein FliM [Methylobacterium extorquens
           DM4]
          Length = 340

 Score =  251 bits (642), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 60/309 (19%), Positives = 116/309 (37%), Gaps = 26/309 (8%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +  P+  ++  RL     D       S++                       S +  +SG
Sbjct: 55  DRLPMLSVVFDRLATACSDAAKHLAASTTF---------------------YSLSGVESG 93

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           +F   + ++  N V        W  +  +G   + + T++E L G+     P    R+ S
Sbjct: 94  RFGEFLDAYDANAVVGIFQAPEWDGHVLVGLDRDFLYTMVEVLFGSDGAEPPVEDERTFS 153

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
            +E ++A+    Q+   L        +++  LE   +         R SN+ V      +
Sbjct: 154 AIELRIAQMVFEQVGKALESSFGLVSQTAFRLER-METRMEFAVIGRRSNKAVQA-KFLL 211

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSED--LIDPFARKTYQLNVNIDTRI 246
              N      LIIPQ T+L     +L      E+ + D    +  A +  +  V +   +
Sbjct: 212 QALNRGGEMFLIIPQ-TVLNPLRPALGKVLTGESAARDPRWAEQIAAEVQKTTVRLRAVL 270

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
             +  TL ++  LK+GQV+       T   L  N + ++ C  G+   +Y +R+ + IN 
Sbjct: 271 EERHLTLGEIAGLKVGQVLTLDATPATRIKLEGNDRPLFWCRAGQSQGSYVLRVEESINP 330

Query: 307 DQKSLKNFL 315
           +++     L
Sbjct: 331 EKEGGHGLL 339


>gi|170741398|ref|YP_001770053.1| flagellar motor switch protein FliM [Methylobacterium sp. 4-46]
 gi|168195672|gb|ACA17619.1| flagellar motor switch protein FliM [Methylobacterium sp. 4-46]
          Length = 303

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 69/314 (21%), Positives = 127/314 (40%), Gaps = 28/314 (8%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
             +  P+  ++  RL     D         +L +L                +  S  S +
Sbjct: 15  SPDRLPMLNVIFDRLATACAD---------NLKHLAV------------SPIFYSLMSVE 53

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
           SG F  ++  ++ N V        W  +  +G   + V T++E LLGA     P    R+
Sbjct: 54  SGLFGDLLEPYEANAVVGIFYSPQWDGHLLVGLDRDFVFTMVEVLLGADGSEPPVEEARN 113

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYD-IDYLKKNTNRLSNEFVTTIN 185
            S++E ++A+ T  QI   L    +    ++  LE     +D+      R SN+ V    
Sbjct: 114 FSSIELRIAQMTFEQIGKALEAAFALVSVATLKLERTETRMDF--AIIGRRSNKAVAA-K 170

Query: 186 MNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSED--LIDPFARKTYQLNVNID 243
             +   N      LIIPQ  +L     SLS     E+ S D       + +  +  V + 
Sbjct: 171 FLLQALNRGGEMFLIIPQA-VLNPMRQSLSKVLTGESTSRDPRWEKQISTEVRKTEVTLR 229

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
             +  +  TL ++  LK+GQV+      ++   L  N + ++ C++G+    Y +R+ D+
Sbjct: 230 AVLEERTLTLGEIADLKVGQVLTLDATPRSRVKLQGNDQALFWCQVGQANGAYVLRVEDQ 289

Query: 304 INFDQKSLKNFLHK 317
           I+ D++ +   L +
Sbjct: 290 IDQDKEFMDGVLAR 303


>gi|13472567|ref|NP_104134.1| flagellar motor switch protein FliM [Mesorhizobium loti MAFF303099]
 gi|14023313|dbj|BAB49920.1| flagellar motor switch protein; FliM [Mesorhizobium loti
           MAFF303099]
          Length = 315

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 60/312 (19%), Positives = 128/312 (41%), Gaps = 9/312 (2%)

Query: 10  TSPLHP-----ILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           TSP  P     +++ RL G  G+   +      +       L K    ++ + V +   +
Sbjct: 2   TSPGSPAQARSLIIERLVGDSGEAAQVIGTGRGMAERAAPLLQKSLTSELGVPVTVDLRA 61

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +  + +       + F  +  + S+ S    +      +  ++  L G   ET      
Sbjct: 62  VEVSRVAEARSRAGDTFAMTIVASSTSSDAMTLVIDAPAIAIMVCTLFGGDPETPASPIE 121

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R LS +E  ++     Q++  LN     + +    L     +   +   + L +     I
Sbjct: 122 RDLSQIEVDVSTMLFQQVAQALNGSGRRSLD--LRLPVPRAMSGTEAKRHVLRDGAALRI 179

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDT 244
            + ++    + +  + +PQ  +L +   + S+       S    + F+ +  +  V ++ 
Sbjct: 180 VLGISTPADSGTVTVTMPQRIVLASRDSAASTAGDDHGPS--WRERFSEEVMRSTVALEA 237

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
            + L + TL D+ +L++GQVI F    ++ A LSA G+ ++ CE G++G+NYT+RI    
Sbjct: 238 TMPLARLTLGDLASLEVGQVIDFDETAQSRARLSARGQTLFVCEFGKLGQNYTVRIRHPF 297

Query: 305 NFDQKSLKNFLH 316
           +  Q  +   + 
Sbjct: 298 DAGQDFIDGLMP 309


>gi|158422267|ref|YP_001523559.1| flagellar motor switch protein [Azorhizobium caulinodans ORS 571]
 gi|158329156|dbj|BAF86641.1| flagellar motor switch protein [Azorhizobium caulinodans ORS 571]
          Length = 309

 Score =  246 bits (628), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 52/311 (16%), Positives = 113/311 (36%), Gaps = 26/311 (8%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +  P+  ++  RL                          +  ++        S +S ++G
Sbjct: 23  DRMPMLHVIFDRL---------------------GTLCAEGLRQLAASQAFYSLSSIETG 61

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           +   ++  ++   V     +  W S+  +G   + V T++E L GA     P    RS S
Sbjct: 62  RIGDVLEMYEGMAVAGVFHVPMWDSHIIVGFDRDFVFTMIEALFGADGSEPPVDDERSFS 121

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
            +E ++++    Q+   L+   +   ++    E       +        N    T    +
Sbjct: 122 NIELRISQAIFEQMQKALHNAFTMVSDTQFKFERQET--RMDFAVIGRRNNLAVTAKFLL 179

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSED--LIDPFARKTYQLNVNIDTRI 246
              N      +IIPQ  L      +L+    +E    D         +  +  V +   +
Sbjct: 180 QALNRGGEMFVIIPQSALTPM-RQALARTTPAETSGRDPIWTKQIRDEVNRTQVKVRAIL 238

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
             +   L ++   K+GQV+      +T   L +  + ++ C LG+    Y +R+ ++IN 
Sbjct: 239 EERHYPLGEIADFKVGQVLHLQATPRTLVKLESADQPLFWCHLGQAEGAYVLRVEEQINL 298

Query: 307 DQKSLKNFLHK 317
           +Q+ + + L +
Sbjct: 299 NQEFVDDILPR 309


>gi|90422602|ref|YP_530972.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           BisB18]
 gi|90104616|gb|ABD86653.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           BisB18]
          Length = 311

 Score =  246 bits (627), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 56/309 (18%), Positives = 113/309 (36%), Gaps = 28/309 (9%)

Query: 12  PLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFS 71
           P+  ++  ++T                         +  +         S +   S + S
Sbjct: 28  PMLHVIFDQMT---------------------NLCAEALRSMSPSQSYFSLSGVGSDRLS 66

Query: 72  HIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVE 131
            I+  ++   + +     +W +   IG   + + T++E L GA     P    R  S VE
Sbjct: 67  DIVDRYEGEAIAAVFYAQAWDARVLIGFDRDFIYTMIELLFGADGAEPPLDMPRVFSNVE 126

Query: 132 KKLAKRTIAQISAVLNQCISTTQESSPNLEDFYD-IDYLKKNTNRLSNEFVTTINMNMTI 190
             +A+    +    L    S   + +  LE     +DYL     RL+N  V   N+ +  
Sbjct: 127 MHVAQALFERFGKALQSSFSRASDVNFTLERVETRMDYLA--VGRLNNMAVCA-NILLQG 183

Query: 191 ENVASSFVLIIPQETLLKTTLISLSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINL 248
            +      ++IP    L     +LS     E+ S D         +  +  V +   +  
Sbjct: 184 LDRGGEMFIVIPHAA-LNPIRQALSQIVTGESASTDPNWSRQLHSEIKRTEVVLKAVLEE 242

Query: 249 KKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
           +  TL +V    +GQVI       T   L  N + ++ C+LG++   Y++++ +  +  +
Sbjct: 243 RPFTLGEVAGFHVGQVIKLNATPNTMVRLECNNQRLFWCQLGQLNGVYSLQVKESADQKR 302

Query: 309 KSLKNFLHK 317
           + +   L +
Sbjct: 303 EFIDGILSR 311


>gi|115523171|ref|YP_780082.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           BisA53]
 gi|115517118|gb|ABJ05102.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           BisA53]
          Length = 275

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 50/279 (17%), Positives = 105/279 (37%), Gaps = 7/279 (2%)

Query: 42  YKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSN 101
                 +  +         S +   S + S I+  ++   + +     +W +   IG   
Sbjct: 1   MTNLCAESLRSMSPSQSYFSLSGVGSDRLSEILDRYEGEAIAAVFYAQAWDARVLIGFDR 60

Query: 102 NLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLE 161
           + + T++E L GA     P    R  S VE  +A+    +    L    S   + +  L+
Sbjct: 61  DFIYTMIELLFGADGAEPPLDMPRVFSNVELHVAEALFERFGKALQSSFSMASDVTFTLD 120

Query: 162 DFYD-IDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKS 220
                +DYL     R +N  V+   +   + +      ++IP    L     +LS     
Sbjct: 121 RVETRMDYLA--IGRPNNMAVSAQILLQGL-DRGGEMFIVIPHAA-LNPIRTALSQIVTG 176

Query: 221 ENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           E+ S D         +  +  V +   +  +  TL +V    +GQVI       T   L 
Sbjct: 177 ESASTDPNWSRQLHSEIQRTEVVLRAVLEERPFTLGEVAKFHVGQVIKLNATPNTMVRLE 236

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLHK 317
            N + ++ C++G++   Y++++ +  +  ++ +   L +
Sbjct: 237 CNNQRLFWCQMGQLNGAYSLQVKESADQKREFIDGILSR 275


>gi|319781690|ref|YP_004141166.1| surface presentation of antigens (SPOA) protein [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317167578|gb|ADV11116.1| surface presentation of antigens (SPOA) protein [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 315

 Score =  239 bits (609), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 53/301 (17%), Positives = 116/301 (38%), Gaps = 4/301 (1%)

Query: 16  ILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIH 75
           +++ RL G  G+   +     ++       L K    +  + V +   + +  +      
Sbjct: 13  LIIERLVGDSGEAAQVIDAGRAMAERAVPLLQKTLTSEFGVPVVVDLKAIEVSRVPEARS 72

Query: 76  SFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLA 135
              + F  +    S+ S    +      +  ++  L G   +       R LS +E  ++
Sbjct: 73  RAGDTFAMTVIGSSASSDAMTLVIDAPAIAIMVCTLFGGDPDLPASPIERDLSQIEIDVS 132

Query: 136 KRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVAS 195
                Q++  LN     + +    L     +   +     L +     I + ++    + 
Sbjct: 133 TMVFQQVAQALNGSGKRSLD--LRLPAPRAMSGTEAKRYVLRDGAAIRIVLGISTPADSG 190

Query: 196 SFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKD 255
           +  + +PQ  +L +   ++   +     S      F+ +  +  V ++  + L + TL D
Sbjct: 191 TVTVTMPQRVVLASRDGAVPVSDDDHGPS--WRARFSEEVMRSTVALEATMPLARLTLGD 248

Query: 256 VVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFL 315
           +   +IG VI F    ++ A LSA GK ++ CE G++G+NYT+RI    +  Q  +   +
Sbjct: 249 LAGFEIGDVIEFEETAQSQARLSARGKTLFVCEFGKLGQNYTVRIRQPYDAGQDFIDGLM 308

Query: 316 H 316
            
Sbjct: 309 P 309


>gi|170748130|ref|YP_001754390.1| flagellar motor switch protein FliM [Methylobacterium radiotolerans
           JCM 2831]
 gi|170654652|gb|ACB23707.1| flagellar motor switch protein FliM [Methylobacterium radiotolerans
           JCM 2831]
          Length = 309

 Score =  236 bits (603), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 54/279 (19%), Positives = 113/279 (40%), Gaps = 5/279 (1%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
               F     +      V  S ++ +S +F  I+  ++ N +        W S+  +G  
Sbjct: 34  RVATFCADQLRHFAASPVYFSLSNVESQRFGDILEPYESNAIAGIFQAPEWDSHILVGFD 93

Query: 101 NNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNL 160
            + + T++E LLG+     P    RS S +E ++A+R   Q+   +    +   ++   L
Sbjct: 94  RDFIFTMVEVLLGSDGSEPPLDEERSFSNIEMRIAQRLFEQVGRAVQSAFALVADTPFKL 153

Query: 161 EDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKS 220
           E   ++        R +N+ V      +   N      ++IPQ  +L     SL+     
Sbjct: 154 ER-TELRMDFAVIGRRNNQAVAA-KFLLQALNRGGEMFIVIPQS-VLNPMRQSLARILVG 210

Query: 221 ENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           E  + D       A +  +  V +   +  K   L ++  L +GQV+      ++   L 
Sbjct: 211 ETSARDSRWTRQIAGEVQKTPVTLKAILEEKPLALGEIADLAVGQVLELRATPRSRVKLV 270

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLHK 317
            N ++++ C++G+      +R+   I+ DQ+ + + L +
Sbjct: 271 GNDRDLFWCDVGQEDGAIVLRVDHFIDQDQEFIDDVLAR 309


>gi|260466628|ref|ZP_05812816.1| surface presentation of antigens (SPOA) protein [Mesorhizobium
           opportunistum WSM2075]
 gi|259029634|gb|EEW30922.1| surface presentation of antigens (SPOA) protein [Mesorhizobium
           opportunistum WSM2075]
          Length = 315

 Score =  236 bits (602), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 57/312 (18%), Positives = 122/312 (39%), Gaps = 9/312 (2%)

Query: 10  TSPLHP-----ILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           TSP  P     +++ RL G  G+   +     ++       L K     + + V +   +
Sbjct: 2   TSPGSPAQARSLIIERLVGDSGEADQVIDAGRAMAERAVPLLQKGLSSGLGVPVIVDLKA 61

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +  + +       +NF  +     + S    +      +  ++  L G   +       
Sbjct: 62  VEVSRVTEARSRAGDNFAMTVVGSPASSDAMTLVIDAAAIAIMVSTLFGGDPDMPVSPIE 121

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R LS +E  ++     +++  LN     +      L     +  ++   + L +     I
Sbjct: 122 RDLSPLEADVSTMVFQEVAQALNGSGQRS--LELRLPAPRAMSGIEARRHVLRDGAAIRI 179

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDT 244
            + ++    + S  +++PQ  +L       S+       S      F+ +  +  V ++ 
Sbjct: 180 VLGISTPVDSGSITVMMPQRIVLAGRDGIASASEADPGTS--WRARFSEEVMRSTVALEA 237

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
            + L + TL D+  L++GQVI F    ++ A L A G+ ++ CE G++G+NYT+RI    
Sbjct: 238 TMPLARLTLGDLAKLEVGQVIDFEETAQSRARLGARGQTLFVCEFGKLGQNYTVRIRHPF 297

Query: 305 NFDQKSLKNFLH 316
           +  Q  +   + 
Sbjct: 298 DAGQDFIDGLMP 309


>gi|27381992|ref|NP_773521.1| hypothetical protein bll6881 [Bradyrhizobium japonicum USDA 110]
 gi|27355162|dbj|BAC52146.1| bll6881 [Bradyrhizobium japonicum USDA 110]
          Length = 313

 Score =  235 bits (599), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 51/279 (18%), Positives = 105/279 (37%), Gaps = 5/279 (1%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
                     +         S     + +   II  ++ N V +      W S   I   
Sbjct: 38  RMAASCTDSLQPMAGTPCYFSVNGITNDRVGDIIKDYEANAVAAVLYAEQWDSRIIIMLD 97

Query: 101 NNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNL 160
            + V T++E + G+     P    RS S +E +L +    + +  L    + T   +  +
Sbjct: 98  RDFVFTMVEAMFGSDGAEPPLDVERSFSNIEIRLVQALFERFAKALQSAFAGTSNVTFRV 157

Query: 161 EDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKS 220
           E             R  N  +    M +          LIIP    L      L+    S
Sbjct: 158 ERVET-AMASLAIGRSGNMSICANIM-LQALYRGGQMFLIIPHSA-LNPLRQKLAHVVVS 214

Query: 221 ENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           + ++ D    +    + ++  V +   ++ K  TL DVV  ++GQV+      +T A L 
Sbjct: 215 DGRASDPRWREQMESEVHRTEVTLSAVLDEKMVTLGDVVKFQVGQVLELEATPRTLARLE 274

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLHK 317
           +N + ++ C++G++   Y +++ D ++  ++ + + L +
Sbjct: 275 SNNQVLFWCQIGQLDGYYAMQVADPVDQKREFVDDILSR 313


>gi|182679717|ref|YP_001833863.1| flagellar motor switch protein FliM [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182635600|gb|ACB96374.1| flagellar motor switch protein FliM [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 313

 Score =  232 bits (591), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 58/307 (18%), Positives = 111/307 (36%), Gaps = 24/307 (7%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +  P+  ++  R+  +  +                       ++        + +S  + 
Sbjct: 27  DRMPMLHVIFDRMVAQCSE---------------------SLRQYSAAPAVFTVSSIGTE 65

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           +   I+ +++ N V +   + +W S   +G     + TL+E   G      P +  R LS
Sbjct: 66  RIGDILDAYENNTVVAIIHVQAWDSRILVGFDRAFISTLIETFYGGDGSEPPNIEKRPLS 125

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
            +E KLA+     +   L    ST  E+    E       L        N F     +N+
Sbjct: 126 NIEIKLAQTIFDLLPKALQTSFSTISETVFKFERLET--KLDFAVIAPRNTFGFITRINL 183

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            I        ++IPQ +L            N +  +          +  +  V +   I 
Sbjct: 184 RILGRHGEMFVVIPQSSLNSIRQELGRDLANDAVVRDPRWTKQIQNEISRTEVEVRAIIE 243

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
                L D   LKIGQV+P     K+ A L  N + ++ C++G+    YT+R+ D I+ +
Sbjct: 244 DSHFVLGDFTELKIGQVLPLQATTKSRAKLECNAEPLFWCQVGQEDGFYTLRVEDFIDQE 303

Query: 308 QKSLKNF 314
           +  ++  
Sbjct: 304 KDFIEGI 310


>gi|1870714|gb|AAB48838.1| FliM [Sinorhizobium meliloti]
          Length = 258

 Score =  229 bits (583), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 69/254 (27%), Positives = 125/254 (49%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   N       L+AR+TG LGD K I + +  L  ++ + LP + + +   DV I+Y  
Sbjct: 4   STASNVHAFDRRLIARMTGALGDDKVIGRTALELAQVFDELLPGVLQSETGCDVTIAYAG 63

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            ++G  + +I +  +  +    SL +W ++F +GC   ++I L+E LLG +  +I +   
Sbjct: 64  FRTGLRNELIAALGDGVLLGDLSLRNWCADFQVGCDTPVLIALVEALLGPNPTSIEEPPP 123

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           RSLS +E  +A    ++I+ VL   ++      P +   Y+     K    L + F  +I
Sbjct: 124 RSLSKIEIDVALPVFSRIAEVLRTAVNAPGGFEPVVGRPYNSAERAKPDPVLQDVFAASI 183

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDT 244
           +M + +  V S+F +I+PQ TLLKT ++S     +  N   +  +    +  +  V ++ 
Sbjct: 184 DMTIGLGPVLSTFSVIVPQSTLLKTRVVSRKGAGEDRNAKTEWTEQLEEQVRRSAVALEA 243

Query: 245 RINLKKTTLKDVVT 258
           RI L+  TL  +  
Sbjct: 244 RIRLESLTLDTLSR 257


>gi|254473349|ref|ZP_05086746.1| flagellar motor switch protein FliM [Pseudovibrio sp. JE062]
 gi|211957465|gb|EEA92668.1| flagellar motor switch protein FliM [Pseudovibrio sp. JE062]
          Length = 321

 Score =  226 bits (575), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 64/311 (20%), Positives = 127/311 (40%), Gaps = 26/311 (8%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +  P+  ++  R+  +  D  T+ +++++  YL                      S  + 
Sbjct: 35  DRLPMLHVVFDRMARQYID--TLRQMAATAPYLA-------------------VQSVSNE 73

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           +    +  +++  V +      W +   +G     + +++E LLG   E  P L +RSL+
Sbjct: 74  RIGDALEQYEDRAVVAVLHAQEWDARILLGFDRTFIFSMVEVLLGGDGEEEPFLEDRSLT 133

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
            VE++LA R   + +  L        ++S  +E   +       T R SN  V    M  
Sbjct: 134 NVEQRLAYRMFEEAATALETAFEAIADTSLKVERLEN-RMEFAQTGRKSNPCVLA-KMTA 191

Query: 189 TIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRI 246
            I        +IIPQ  L  L+  L  + S      +       F ++  +  V +   +
Sbjct: 192 EIIGREGEIFIIIPQSVLNPLRENLTQVLSGE-VAGRDTRWTKQFQQEVQRTEVKLTAIL 250

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
             ++ TL++V   ++G V+      KT   L  N + +++C LG+V  +YT+R+ + I  
Sbjct: 251 EEQRMTLEEVAQFEVGLVLELNATPKTAVQLECNSQPLFNCRLGQVAGSYTVRVEELIEQ 310

Query: 307 DQKSLKNFLHK 317
           + + L + L  
Sbjct: 311 EGELLDDILSN 321


>gi|157961196|ref|YP_001501230.1| flagellar motor switch protein FliM [Shewanella pealeana ATCC
           700345]
 gi|157846196|gb|ABV86695.1| flagellar motor switch protein FliM [Shewanella pealeana ATCC
           700345]
          Length = 342

 Score =  225 bits (574), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 52/283 (18%), Positives = 98/283 (34%), Gaps = 19/283 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       M    ++S    Q  KF   +H+       +    S       I  
Sbjct: 56  ERFARHLRISMFNMMRRAAEVSINGVQMLKFGEYVHTLFVPTSLNMVRFSPLKGTALITM 115

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E+++ +  +  I     +  +   E    
Sbjct: 116 EARLVFILVDNFFGGDGRFHAKIEGREFTPTERRIVQLLLKIIFEDYKEAWAPVMEVQ-- 173

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  DYL    N          E V   + ++ ++     F + +P   +++     
Sbjct: 174 ------FDYLDSEVNPAMANIVSPTEVVVVSSFHIEVDGGGGDFHITMPYS-MIEPIREL 226

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+ Q  D         +   ++V ID  I   K TL++V+  K G VIP    E
Sbjct: 227 LDAGVQSDTQDTDMRWSQALRDEIMDVDVGIDATIVEHKLTLREVLEFKAGDVIPVELPE 286

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
               IL       Y C++G+   N  ++I ++I   +      
Sbjct: 287 H--IILKVEDLPTYRCKMGKAKDNLALKICEKIPRPETVKTEL 327


>gi|294140210|ref|YP_003556188.1| flagellar motor switch protein FliM [Shewanella violacea DSS12]
 gi|293326679|dbj|BAJ01410.1| flagellar motor switch protein FliM [Shewanella violacea DSS12]
          Length = 343

 Score =  224 bits (572), Expect = 9e-57,   Method: Composition-based stats.
 Identities = 53/283 (18%), Positives = 101/283 (35%), Gaps = 19/283 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       M    ++S    Q  KF   +H+       +    S       I  
Sbjct: 57  ERFARHLRISMFNMMRRAAEVSINGVQMLKFGEYVHTLFVPTSLNMVRFSPLKGTGLITM 116

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E+++ +  +  I        +   +    
Sbjct: 117 EARLVFILVDNFFGGDGRFHAKIEGREFTPTERRIVQLLLKIIFEDYKDAWAPVMDVE-- 174

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E V   + ++ ++     F + +P   +++     
Sbjct: 175 ------FEYLDSEVNPAMANIVSPTEVVVVSSFHIEVDGGGGDFHITMPYS-MIEPIREL 227

Query: 214 LSSQNKSENQSEDLIDPFA--RKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+ Q  D+    A   +   ++V ID  I  ++ TLKDV+  K G +IP    E
Sbjct: 228 LDAGVQSDTQDTDMRWSLALKDEIMDIDVGIDATIVEQQITLKDVMEFKAGDIIPVELPE 287

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
               +L       Y C+LG+   N  +RIT++I   +      
Sbjct: 288 H--IVLRVEDLPTYRCKLGKTRDNLALRITEKIPRPETVKSEL 328


>gi|212634374|ref|YP_002310899.1| flagellar motor switch protein FliM [Shewanella piezotolerans WP3]
 gi|212555858|gb|ACJ28312.1| Flagellar motor switch protein FliM [Shewanella piezotolerans WP3]
          Length = 342

 Score =  224 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 50/283 (17%), Positives = 99/283 (34%), Gaps = 19/283 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       M    ++S    Q  KF   +H+       +    S       I  
Sbjct: 56  ERFARHLRISMFNMMRRAAEVSINGVQMLKFGEYVHTLFVPTSLNMVRFSPLKGTALITM 115

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E+++ +  +  I     +  +   +    
Sbjct: 116 EARLVFILVDNFFGGDGRFHAKIEGREFTPTERRIVQLLLKIIFEDYKEAWAPVMDVE-- 173

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  DYL    N          E V   + ++ ++     F + +P   +++     
Sbjct: 174 ------FDYLDSEVNPAMANIVSPTEVVVVSSFHIEVDGGGGDFHITMPYS-MIEPIREL 226

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+ Q  D         +   ++V ID  +   + TL+DV+  K G VIP    E
Sbjct: 227 LDAGVQSDTQDTDMRWSQALRDEIMDVDVGIDATVVEHQVTLRDVLEFKAGDVIPVELPE 286

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
               IL       Y C++G+  +N  ++I ++I   +      
Sbjct: 287 H--IILKVEDLPTYRCKMGKTKENLALKICEQIQRPETVKSEL 327


>gi|170725980|ref|YP_001760006.1| flagellar motor switch protein FliM [Shewanella woodyi ATCC 51908]
 gi|169811327|gb|ACA85911.1| flagellar motor switch protein FliM [Shewanella woodyi ATCC 51908]
          Length = 342

 Score =  223 bits (568), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 50/283 (17%), Positives = 98/283 (34%), Gaps = 19/283 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       M    ++S    Q  KF   +H+       +    +       I  
Sbjct: 56  ERFARHLRISMFNMMRRAAEVSINGVQMLKFGEYVHTLFVPTSLNMVRFNPLKGTALITM 115

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E+++ +  +  I        +   +    
Sbjct: 116 EARLVFILVDNFFGGDGRFHAKIEGREFTPTERRIVQLLLKIIFEDYKDAWAPVMDVE-- 173

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  DYL    N          E V   + ++ ++     F + +P   +++     
Sbjct: 174 ------FDYLDSEVNPAMANIVSPTEVVVISSFHIEVDGGGGDFHITMPYS-MIEPIREL 226

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+ Q  D         +   +NV +D  +   + TLKDV+ LK G +IP    E
Sbjct: 227 LDAGVQSDTQDTDMRWSQALKDEIMDVNVGLDATVVEHQITLKDVMELKQGDIIPVELPE 286

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
               IL       + C+LG+   N  +R+  +I   + +    
Sbjct: 287 H--IILRVEDLPTFRCKLGKARDNLALRVIQKIPRPETAKSEL 327


>gi|160876170|ref|YP_001555486.1| flagellar motor switch protein FliM [Shewanella baltica OS195]
 gi|160861692|gb|ABX50226.1| flagellar motor switch protein FliM [Shewanella baltica OS195]
 gi|315268366|gb|ADT95219.1| flagellar motor switch protein FliM [Shewanella baltica OS678]
          Length = 342

 Score =  222 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 49/283 (17%), Positives = 95/283 (33%), Gaps = 19/283 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       M    ++S    Q  KF   +H+       +    S       I  
Sbjct: 56  ERFARHLRISMFNMMRRAAEVSINGVQMLKFGEYVHTLFVPTSLNMVRFSPLKGTALITM 115

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E+++ +  +  I        +   +    
Sbjct: 116 EARLVFILVDNFFGGDGRFHAKIEGREFTPTERRIVQLLLKIIFEDYKDAWAPVMDVE-- 173

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  DYL    N          E V   + ++ ++     F + +P   +++     
Sbjct: 174 ------FDYLDSEVNPAMANIVSPTEVVVINSFHIEVDGGGGDFHITMPYS-MIEPIREL 226

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+ Q  D         +   + V  D  I   + TLKDV+  K G +IP    E
Sbjct: 227 LDAGVQSDKQDTDMRWSQALHDEIMDVKVGFDANIVEHELTLKDVMNFKAGDIIPIELPE 286

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
               ++       Y C++GR   N  ++I ++I   +      
Sbjct: 287 --YIMMKIEDLPTYRCKMGRSRDNLALKIHEKIPRPETVKSEL 327


>gi|167623386|ref|YP_001673680.1| flagellar motor switch protein FliM [Shewanella halifaxensis
           HAW-EB4]
 gi|167353408|gb|ABZ76021.1| flagellar motor switch protein FliM [Shewanella halifaxensis
           HAW-EB4]
          Length = 342

 Score =  222 bits (567), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 53/283 (18%), Positives = 97/283 (34%), Gaps = 19/283 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       M    ++S    Q  KF   +H+       +    S       I  
Sbjct: 56  ERFARHLRISMFNMMRRAAEVSINGVQMLKFGEYVHTLFVPTSLNMVRFSPLKGTALITM 115

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E+++ +  +  I        +   +    
Sbjct: 116 EARLVFILVDNFFGGDGRFHAKIEGREFTPTERRIVQLLLKIIFEDYKDAWAPVMDVQ-- 173

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  DYL    N          E V   + ++ ++     F + +P   +++     
Sbjct: 174 ------FDYLDSEVNPAMANIVSPTEVVVVSSFHIEVDGGGGDFHITMPYS-MIEPIREL 226

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+ Q  D         +   ++V ID  I   K TLK V+  K G VIP    E
Sbjct: 227 LDAGVQSDTQDTDMRWSQALRDEIMDVDVGIDATIVEHKVTLKQVLEFKAGDVIPVELPE 286

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
               IL       Y C++GR  +N  ++I ++I   +      
Sbjct: 287 --YIILKVEDLPTYRCKMGRTKENLALKICEQIPRPETVKTEL 327


>gi|217972623|ref|YP_002357374.1| flagellar motor switch protein FliM [Shewanella baltica OS223]
 gi|217497758|gb|ACK45951.1| flagellar motor switch protein FliM [Shewanella baltica OS223]
          Length = 342

 Score =  222 bits (566), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 49/283 (17%), Positives = 95/283 (33%), Gaps = 19/283 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       M    ++S    Q  KF   +H+       +    S       I  
Sbjct: 56  ERFARHLRISMFNMMRRAAEVSINGVQMLKFGEYVHTLFVPTSLNMVRFSPLKGTALITM 115

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E+++ +  +  I        +   +    
Sbjct: 116 EARLVFILVDNFFGGDGRFHAKIEGREFTPTERRIVQLLLKIIFEDYKDAWAPVMDVE-- 173

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  DYL    N          E V   + ++ ++     F + +P   +++     
Sbjct: 174 ------FDYLDSEVNPAMANIVSPTEVVVINSFHIEVDGGGGDFHITMPYS-MIEPIREL 226

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+ Q  D         +   + V  D  I   + TLKDV+  K G +IP    E
Sbjct: 227 LDAGVQSDKQDTDMRWSQALHDEIMDVKVGFDANIVEHELTLKDVMNFKAGDIIPIELPE 286

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
               ++       Y C++GR   N  ++I ++I   +      
Sbjct: 287 --YIMMKIEDLPTYRCKMGRSRDNLALKIHEKIPRPETVKSEL 327


>gi|126175121|ref|YP_001051270.1| flagellar motor switch protein FliM [Shewanella baltica OS155]
 gi|153001445|ref|YP_001367126.1| flagellar motor switch protein FliM [Shewanella baltica OS185]
 gi|304409952|ref|ZP_07391571.1| flagellar motor switch protein FliM [Shewanella baltica OS183]
 gi|307302335|ref|ZP_07582093.1| flagellar motor switch protein FliM [Shewanella baltica BA175]
 gi|125998326|gb|ABN62401.1| flagellar motor switch protein FliM [Shewanella baltica OS155]
 gi|151366063|gb|ABS09063.1| flagellar motor switch protein FliM [Shewanella baltica OS185]
 gi|304351361|gb|EFM15760.1| flagellar motor switch protein FliM [Shewanella baltica OS183]
 gi|306914373|gb|EFN44794.1| flagellar motor switch protein FliM [Shewanella baltica BA175]
          Length = 342

 Score =  222 bits (566), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 49/283 (17%), Positives = 95/283 (33%), Gaps = 19/283 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       M    ++S    Q  KF   +H+       +    S       I  
Sbjct: 56  ERFARHLRISMFNMMRRAAEVSINGVQMLKFGEYVHTLFVPTSLNMVRFSPLKGTALITM 115

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E+++ +  +  I        +   +    
Sbjct: 116 EARLVFILVDNFFGGDGRFHAKIEGREFTPTERRIVQLLLKIIFEDYKDAWAPVMDVE-- 173

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  DYL    N          E V   + ++ ++     F + +P   +++     
Sbjct: 174 ------FDYLDSEVNPAMANIVSPTEVVVINSFHIEVDGGGGDFHITMPYS-MIEPIREL 226

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+ Q  D         +   + V  D  I   + TLKDV+  K G +IP    E
Sbjct: 227 LDAGVQSDKQDTDMRWSQALHDEIMDVKVGFDANIVEHELTLKDVMNFKAGDIIPIELPE 286

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
               ++       Y C++GR   N  ++I ++I   +      
Sbjct: 287 --YIMMKIEDLPTYRCKMGRSRDNLALKIYEKIPRPETVKSEL 327


>gi|114562367|ref|YP_749880.1| flagellar motor switch protein FliM [Shewanella frigidimarina NCIMB
           400]
 gi|114333660|gb|ABI71042.1| flagellar motor switch protein FliM [Shewanella frigidimarina NCIMB
           400]
          Length = 342

 Score =  222 bits (565), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 46/283 (16%), Positives = 98/283 (34%), Gaps = 19/283 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       M    ++S    Q  KF   +H+       +    S       I  
Sbjct: 56  ERFARHLRISMFNMMRRAAEVSINGVQMLKFGEYVHTLFVPTSLNMVRFSPLKGTALITM 115

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E+++ +  +  I     +  +   +    
Sbjct: 116 EARLVFILVDNFFGGDGRFHAKIEGREFTPTERRIVQLLLKIIFEDYKEAWAPVMDVE-- 173

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E V   + ++ ++     F + +P   +++     
Sbjct: 174 ------FEYLDSEVNPAMANIVSPTEVVVINSFHIEVDGGGGDFHITMPYS-MIEPIREL 226

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+ Q  D         +   + V  D  +   + TL+DV+  K G +IP    E
Sbjct: 227 LDAGVQSDKQDTDMRWSQALRDEIMDVQVGFDVNVVEHEVTLRDVMGFKAGDIIPIDLPE 286

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
               ++   G   Y C++G+   N  ++I+++I   +      
Sbjct: 287 H--IMMRIEGLPTYRCKMGKSRDNLALKISEKIPRPETVKTEM 327


>gi|127512304|ref|YP_001093501.1| flagellar motor switch protein FliM [Shewanella loihica PV-4]
 gi|126637599|gb|ABO23242.1| flagellar motor switch protein FliM [Shewanella loihica PV-4]
          Length = 341

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 51/283 (18%), Positives = 98/283 (34%), Gaps = 19/283 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       M    ++S    Q  KF   +H+       +    S       I  
Sbjct: 55  ERFARHLRISMFNMMRRAAEVSINGVQMLKFGEYVHTLFVPTSLNMVRFSPLKGTALITM 114

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E+++ +  +  I     +  +   +    
Sbjct: 115 EARLVFILVDNFFGGDGRFHAKIEGREFTPTERRIVQLLLKIIFEDYKEAWAPVMDVE-- 172

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  DYL    N          E V   + ++ ++     F + +P   +++     
Sbjct: 173 ------FDYLDSEVNPAMANIVSPTEVVVVSSFHIEVDGGGGDFHITMPYS-MIEPIREL 225

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+ Q  D         +   + V +D  I  K+ +LKDV+  K G +IP    E
Sbjct: 226 LDAGVQSDTQDTDMRWSQALKDEIMDVEVGLDATIVEKEISLKDVMGFKAGDIIPVEMPE 285

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
               +L       Y C+LGR  +N  + I ++I   +      
Sbjct: 286 --YIVLRVEDLPTYRCKLGRSRENLALNIREKIPRPETVKTEL 326


>gi|120598257|ref|YP_962831.1| flagellar motor switch protein FliM [Shewanella sp. W3-18-1]
 gi|146293665|ref|YP_001184089.1| flagellar motor switch protein FliM [Shewanella putrefaciens CN-32]
 gi|120558350|gb|ABM24277.1| flagellar motor switch protein FliM [Shewanella sp. W3-18-1]
 gi|145565355|gb|ABP76290.1| flagellar motor switch protein FliM [Shewanella putrefaciens CN-32]
 gi|319427064|gb|ADV55138.1| flagellar motor switch protein FliM [Shewanella putrefaciens 200]
          Length = 343

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 48/283 (16%), Positives = 95/283 (33%), Gaps = 19/283 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       M    ++S    Q  KF   +H+       +    S       I  
Sbjct: 57  ERFARHLRISMFNMMRRAAEVSINGVQMLKFGEYVHTLFVPTSLNMVRFSPLKGTALITM 116

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E+++ +  +  I        +   +    
Sbjct: 117 EARLVFILVDNFFGGDGRFHAKIEGREFTPTERRIVQLLLKIIFEDYKDAWAPVMDVE-- 174

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  DYL    N          E V   + ++ ++     F + +P   +++     
Sbjct: 175 ------FDYLDSEVNPAMANIVSPTEVVVINSFHIEVDGGGGDFHITMPYS-MIEPIREL 227

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+ Q  D         +   + V  D  +   + TLKDV+  K G +IP    E
Sbjct: 228 LDAGVQSDKQDTDMRWSQALHDEIMDVKVGFDACVVEHELTLKDVMNFKAGDIIPVELPE 287

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
               ++       Y C++GR   N  ++I ++I   +      
Sbjct: 288 --YIMMKIEDLPTYRCKMGRSRDNLALKIYEKIPRPETVKTEL 328


>gi|24374733|ref|NP_718776.1| flagellar motor switch protein FliM [Shewanella oneidensis MR-1]
 gi|24349393|gb|AAN56220.1|AE015759_12 flagellar motor switch protein FliM [Shewanella oneidensis MR-1]
          Length = 343

 Score =  221 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 47/283 (16%), Positives = 94/283 (33%), Gaps = 19/283 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       M    ++S    Q  KF   +H+       +            I  
Sbjct: 57  ERFARHLRISMFNMMRRAAEVSINGVQMLKFGEYVHTLFVPTSLNMVRFHPLKGTALITM 116

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E+++ +  +  I        +   +    
Sbjct: 117 EARLVFILVDNFFGGDGRFHAKIEGREFTPTERRIVQLLLKIIFEDYKDAWAPVMDVE-- 174

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  DYL    N          E V   + ++ ++     F + +P   +++     
Sbjct: 175 ------FDYLDSEVNPAMANIVSPTEVVVINSFHIEVDGGGGDFHITMPYS-MIEPIREL 227

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+ Q  D         +   + V  D  +   + TLKDV+  K G +IP    E
Sbjct: 228 LDAGVQSDKQDTDMRWSQALHDEIMDVKVGFDATVVEHELTLKDVMNFKAGDIIPIELPE 287

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
               ++       Y C++GR   N  ++I ++I   +      
Sbjct: 288 --YIMMRIEDLPTYRCKMGRSRDNLALKIYEKIPRPETVKSEL 328


>gi|113969632|ref|YP_733425.1| flagellar motor switch protein FliM [Shewanella sp. MR-4]
 gi|114046862|ref|YP_737412.1| flagellar motor switch protein FliM [Shewanella sp. MR-7]
 gi|113884316|gb|ABI38368.1| flagellar motor switch protein FliM [Shewanella sp. MR-4]
 gi|113888304|gb|ABI42355.1| flagellar motor switch protein FliM [Shewanella sp. MR-7]
          Length = 343

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 47/283 (16%), Positives = 94/283 (33%), Gaps = 19/283 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       M    ++S    Q  KF   +H+       +            I  
Sbjct: 57  ERFARHLRISMFNMMRRAAEVSINGVQMLKFGEYVHTLFVPTSLNMVRFHPLKGTALITM 116

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E+++ +  +  I        +   +    
Sbjct: 117 EARLVFILVDNFFGGDGRFHAKIEGREFTPTERRIVQLLLKIIFEDYKDAWAPVMDVE-- 174

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  DYL    N          E V   + ++ ++     F + +P   +++     
Sbjct: 175 ------FDYLDSEVNPAMANIVSPTEVVVINSFHIEVDGGGGDFHITMPYS-MIEPIREL 227

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+ Q  D         +   + V  D  +   + TLKDV+  K G +IP    E
Sbjct: 228 LDAGVQSDKQDTDMRWSQALHDEIMDVKVGFDATVVEHELTLKDVMNFKAGDIIPIELPE 287

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
               ++       Y C++GR   N  ++I ++I   +      
Sbjct: 288 --YIMMKIEDLPTYRCKMGRSRDNLALKIYEKIPRPETVKSEL 328


>gi|308048759|ref|YP_003912325.1| flagellar motor switch protein FliM [Ferrimonas balearica DSM 9799]
 gi|307630949|gb|ADN75251.1| flagellar motor switch protein FliM [Ferrimonas balearica DSM 9799]
          Length = 357

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 45/283 (15%), Positives = 100/283 (35%), Gaps = 19/283 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       M  + ++S    Q  KF   +H+       +            I  
Sbjct: 56  ERFARHLRISLFNMMRRNAEVSINGVQMVKFGEYVHTLFVPTSLNMVRFRPLKGTGLITM 115

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E+++ +  +  +     +  +   +    
Sbjct: 116 EARLVFILVDNFFGGDGRFQAKIEGREFTPTERRIIQLLLKTVFEDYKESWAPVMDVE-- 173

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E V   + ++ ++     F + +P   +++     
Sbjct: 174 ------FEYLDSEVNPAMANIVSPTEVVVVSSFHIELDGGGGDFHITLPYS-MIEPIREL 226

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+ Q  D         +   + V++ T +  ++ TL+D++ +K G +IP    E
Sbjct: 227 LDAGVQSDKQDTDMRWAKALQDEIMDVPVDLSTMLLEQELTLRDIMEMKAGDIIPVEMPE 286

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
               ++       +  +LGR G N  +RI +RI   +      
Sbjct: 287 H--LLVRIEDLPTFRGKLGRKGDNVAVRIEERIPRPKSYKNEL 327


>gi|157376191|ref|YP_001474791.1| flagellar motor switch protein FliM [Shewanella sediminis HAW-EB3]
 gi|157318565|gb|ABV37663.1| flagellar motor switch protein FliM [Shewanella sediminis HAW-EB3]
          Length = 341

 Score =  220 bits (560), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 51/283 (18%), Positives = 95/283 (33%), Gaps = 19/283 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       M    ++S    Q  KF   +H+       +    S       I  
Sbjct: 55  ERFARHLRISMFNMMRRAAEVSINGVQMLKFGEYVHTLFVPTSLNMVRFSPLKGTALITM 114

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E+++ +  +  I        +   +    
Sbjct: 115 EARLVFILVDNFFGGDGRFHAKIEGREFTPTERRIVQLLLKIIFEDYKDAWAPVMDVE-- 172

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  DYL    N          E V   + ++ ++     F + +P   +++     
Sbjct: 173 ------FDYLDSEVNPAMANIVSPTEVVVVSSFHIEVDGGGGDFHITMPYS-MIEPIREL 225

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+ Q  D         +   ++V ID  I   + TLKDV+  K G VI     E
Sbjct: 226 LDAGVQSDTQDTDMRWSQALKDEIMDVDVGIDATIVEHQVTLKDVMEFKQGDVITVELPE 285

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
               ++       Y C+LG    N  +RI + I   + +    
Sbjct: 286 H--IVMRVEDLPTYRCKLGTARDNLALRICETIPRPETAKNEL 326


>gi|117919797|ref|YP_868989.1| flagellar motor switch protein FliM [Shewanella sp. ANA-3]
 gi|117612129|gb|ABK47583.1| flagellar motor switch protein FliM [Shewanella sp. ANA-3]
          Length = 343

 Score =  219 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 47/283 (16%), Positives = 94/283 (33%), Gaps = 19/283 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       M    ++S    Q  KF   +H+       +            I  
Sbjct: 57  ERFARHLRISMFNMMRRAAEVSINGVQMLKFGEYVHTLFVPTSLNMVRFHPLKGTALITM 116

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E+++ +  +  I        +   +    
Sbjct: 117 EARLVFILVDNFFGGDGRFHAKIEGREFTPTERRIVQLLLKIIFEDYKDAWAPVMDVE-- 174

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  DYL    N          E V   + ++ ++     F + +P   +++     
Sbjct: 175 ------FDYLDSEVNPAMANIVSPTEVVVINSFHIEVDGGGGDFHITMPYS-MIEPIREL 227

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+ Q  D         +   + V  D  +   + TLKDV+  K G +IP    E
Sbjct: 228 LDAGVQSDKQDTDMRWSQALHDEIMDVKVGFDASVVEHELTLKDVMNFKAGDIIPIELPE 287

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
               ++       Y C++GR   N  ++I ++I   +      
Sbjct: 288 --YIMMKIEDLPTYRCKMGRSRDNLALKIYEKIPRPETVKSEL 328


>gi|163750543|ref|ZP_02157781.1| flagellar motor switch protein [Shewanella benthica KT99]
 gi|161329698|gb|EDQ00687.1| flagellar motor switch protein [Shewanella benthica KT99]
          Length = 348

 Score =  219 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 49/283 (17%), Positives = 97/283 (34%), Gaps = 19/283 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       M    ++S    Q  KF   +H+       +    S       I  
Sbjct: 62  ERFARHLRISMFNMMRRAAEVSINGVQMIKFGEYVHTLFVPTSLNMVKFSPLKGTGLITM 121

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E+++ +  +  I     +  +   +    
Sbjct: 122 EARLVFILVDNFFGGDGRFHAKIEGREFTPTERRIVQLLLKIIFEDYKEAWAPVMDVE-- 179

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E V   + ++ ++     F + +P   +++     
Sbjct: 180 ------FEYLDSEVNPAMANIVSPTEVVVVSSFHIEVDGGGGDFHITMPYS-MIEPIREL 232

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+ Q  D         +   + V ID  I  ++  LKDV+  + G +IP    E
Sbjct: 233 LDAGVQSDTQDTDKRWSMALKDEIMDIKVGIDATIVDQEIALKDVMKFRAGDIIPVDLPE 292

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
               +L       Y C+LG+   N  +RI ++I   +      
Sbjct: 293 H--IVLRVEDLPTYRCKLGKSRDNLALRIIEKIPRPKTVKTEL 333


>gi|217976217|ref|YP_002360364.1| surface presentation of antigens (SPOA) protein [Methylocella
           silvestris BL2]
 gi|217501593|gb|ACK49002.1| surface presentation of antigens (SPOA) protein [Methylocella
           silvestris BL2]
          Length = 314

 Score =  219 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 58/311 (18%), Positives = 112/311 (36%), Gaps = 26/311 (8%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +  P+  ++L R+         I + S +L  L                   S  +  + 
Sbjct: 28  DRMPMLHVILDRM---------IAQCSENLRQLSAP------------PAFFSVDTVAAR 66

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           +   ++ +++           +W S   IG  ++ + TL E L G      P    R LS
Sbjct: 67  RVGDVLDAYENKVAIGVYHALAWDSRILIGLDHDFIFTLAEALFGGDGGEAPFTQGRKLS 126

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
           ++E +LA + +      L    ST  +++  LE       L        N F  T  + +
Sbjct: 127 SLELRLAHKALDLFGRALQSAFSTVSDTAFKLERVET--RLDFAVIAPRNAFGVTAKIKL 184

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSED--LIDPFARKTYQLNVNIDTRI 246
            I        ++IPQ   L +    L      +    D         +  +  + +   I
Sbjct: 185 RILGRHGEMFILIPQAA-LNSVRQQLGRNLSDDAAVRDPAWTRQIEGEIGRAEIEVRGVI 243

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
             +   L D+  LK+G ++       T   L  N + ++ C LG+    YT+RI + ++ 
Sbjct: 244 EERHFLLGDIADLKVGGILQLKSTPSTRVRLECNAEPLFWCNLGQGDGVYTLRIDESMSR 303

Query: 307 DQKSLKNFLHK 317
           +Q+ +   L +
Sbjct: 304 EQEFVDEMLSR 314


>gi|218672165|ref|ZP_03521834.1| flagellar C-ring motor switch protein [Rhizobium etli GR56]
          Length = 209

 Score =  219 bits (558), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 65/209 (31%), Positives = 113/209 (54%)

Query: 108 LENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDID 167
           +E+LLGA+ +TI +  +R LS +E  LA     +I+ VL   ++      P+L   +  D
Sbjct: 1   MEHLLGATADTIEEPADRLLSIIELDLAVMVFDKIAKVLRSAVNAPGGFEPSLSAPHAHD 60

Query: 168 YLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDL 227
              +      +EF   INM++T+  + S F LI+PQ  LLKT +     + ++   S + 
Sbjct: 61  TRPRPAEDKPDEFAAAINMSITLAGIVSEFSLIVPQTALLKTQVTPPKPKRQAGGASPEW 120

Query: 228 IDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSC 287
            +    +  + +V ++ RI L+  TL+ +  L +G VIPF    +    +SAN KE+Y C
Sbjct: 121 TEQLGDQVRRSHVTLEARIRLQDLTLRTISKLMVGDVIPFRDTGEVRVEVSANSKELYIC 180

Query: 288 ELGRVGKNYTIRITDRINFDQKSLKNFLH 316
           E GR G+NY +R+ D +N D + +++ ++
Sbjct: 181 EFGRSGENYMVRVKDTMNSDDELIRHLMN 209


>gi|146341901|ref|YP_001206949.1| flagellar motor switch protein FliM [Bradyrhizobium sp. ORS278]
 gi|146194707|emb|CAL78732.1| Flagellar motor switch protein FliM [Bradyrhizobium sp. ORS278]
          Length = 400

 Score =  214 bits (546), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 50/277 (18%), Positives = 104/277 (37%), Gaps = 6/277 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + +    +     +V++S     S +F   ++S     V S      W +       
Sbjct: 114 RLVRLMTTSLRNFTSDNVEVSLDRITSVRFGDYMNSIPLPAVLSVFKAEEWENFGLAMVD 173

Query: 101 NNLVITLLENLLGAS-HETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           + L+ ++++ LLG     T  ++  R  +T+E  L KR I  + A   Q           
Sbjct: 174 STLIYSIIDVLLGGRRGNTQLRVEGRPYTTIETNLVKRLIEVVLADAEQAFRPLSPVRFT 233

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
           ++     +      +R +N     + + + +E+   +  L++P  T+  ++  L+ +   
Sbjct: 234 IDRLET-NPRFAAISRPAN-AAILVKLRIDMEDRGGNIELLLPYATIEPIRPVLLQMFMG 291

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K   +       FA +  +  V +D  +      LK ++ LK+G  +P   R      +
Sbjct: 292 EKFG-RDPVWEGHFATEITRAEVAVDAVLYEADVPLKQLMRLKVGDTLPLDIRPDALVAV 350

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
                 +    +GRVG    IR+T  +     +L  F
Sbjct: 351 RCGNTMLTEGRMGRVGDRVAIRVTKNLRKPHTTLAMF 387


>gi|88858101|ref|ZP_01132743.1| flagellar motor switch protein [Pseudoalteromonas tunicata D2]
 gi|88819718|gb|EAR29531.1| flagellar motor switch protein [Pseudoalteromonas tunicata D2]
          Length = 364

 Score =  214 bits (546), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 47/285 (16%), Positives = 102/285 (35%), Gaps = 20/285 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       M    ++S    Q  KF   IH+       +            I  
Sbjct: 60  ERFARHMRISLFNMMRRTAEVSINGVQMIKFGEYIHTLFVPTSLNMVRFRPLKGTGLITM 119

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E+++ +  +  I     +  +   + S  
Sbjct: 120 EARLVFILVDNFFGGDGRYHAKIEGREFTPTERRIVQMLLKIIFEDYKEAWAPVMDVS-- 177

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E V   + ++ ++     F + +P   +L+     
Sbjct: 178 ------FEYLDSEVNPAMANIVSPTEVVVISSFHIELDGGGGDFHIALPYS-MLEPIREL 230

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+ +  D         +   + V + TR+   K +L+ ++ L+ G VIP    E
Sbjct: 231 LDAGVQSDTEDTDLRWSKALRDEIMDVEVGLSTRMLEVKLSLEQIMNLQAGDVIPVEMPE 290

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLH 316
                +       +  ++GR   N  ++I+++I     S+K+ +H
Sbjct: 291 H--ITVFIEDLPTFRAKMGRSRDNVALQISEKI-KRPDSVKSEMH 332


>gi|119775425|ref|YP_928165.1| flagellar motor switch protein FliM [Shewanella amazonensis SB2B]
 gi|119767925|gb|ABM00496.1| flagellar motor switch protein FliM [Shewanella amazonensis SB2B]
          Length = 342

 Score =  214 bits (545), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 43/283 (15%), Positives = 95/283 (33%), Gaps = 19/283 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       M    ++S    Q  KF   +H+       +            I  
Sbjct: 56  ERFARHLRISMFNMMRRAAEVSINGVQMLKFGEYVHTLFVPTSLNMVRFQPLKGTALITM 115

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E+++ +  +  I        +   +    
Sbjct: 116 EARLVFILVDNFFGGDGRFHAKIEGREFTPTERRIVQLLLKIIFEDYKDAWAPVMDVE-- 173

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  DYL    N          E V   + ++ ++     F + +P   +++     
Sbjct: 174 ------FDYLDSEVNPAMANIVSPTEVVVVNSFHIEVDGGGGDFHITMPYS-MIEPIREL 226

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+ Q  D         +   + V  +  +   + +L+DV+ ++ G VIP    E
Sbjct: 227 LDAGVQSDKQDTDMRWSQALKDEIMDVEVGFEATVVEHQISLRDVMEMQAGDVIPVELPE 286

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
               ++       Y C+LG+  +   ++I ++I   +      
Sbjct: 287 --YVLMKIEELPTYRCKLGKSREQLALKICEKIPRPETVKTEL 327


>gi|148256789|ref|YP_001241374.1| flagellar motor switch protein FliM [Bradyrhizobium sp. BTAi1]
 gi|146408962|gb|ABQ37468.1| Flagellar motor switch protein FliM [Bradyrhizobium sp. BTAi1]
          Length = 400

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 50/277 (18%), Positives = 104/277 (37%), Gaps = 6/277 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + +    +     +V++S     S +F   ++S     V S      W +       
Sbjct: 114 RLVRLMTTSLRNFTSDNVEVSLDRITSVRFGDYMNSIPLPAVLSVFKAEEWENFGLATVD 173

Query: 101 NNLVITLLENLLGAS-HETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           + L+ ++++ LLG     T  ++  R  +T+E  L KR I  + +   Q           
Sbjct: 174 STLIYSIIDVLLGGRRGNTQLRVEGRPYTTIETNLVKRLIEVVLSDAEQAFRPLSPVRFT 233

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
           ++     +      +R +N     + + + +E+   +  L++P  T+  ++  L+ +   
Sbjct: 234 IDRLET-NPRFAAISRPAN-AAILVKLRIDMEDRGGNIELLLPYATIEPIRPVLLQMFMG 291

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K   +       FA +  Q  V +D  +      LK ++ LK+G  +P   R      +
Sbjct: 292 EKFG-RDPVWEGHFATEIAQAEVAVDAVLYEADVPLKQLMRLKVGDTLPLDIRPDALVAV 350

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
                 +    +GRVG    IR+T  +     +L  F
Sbjct: 351 RCGSTMLTEGRMGRVGDRVAIRVTKNLRKPNTTLAMF 387


>gi|27380936|ref|NP_772465.1| flagellar motor switch protein FliM [Bradyrhizobium japonicum USDA
           110]
 gi|27354102|dbj|BAC51090.1| flagellar motor switch protein [Bradyrhizobium japonicum USDA 110]
          Length = 400

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 51/277 (18%), Positives = 108/277 (38%), Gaps = 6/277 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + L    +     +V++S     S +F   ++S     V S      W +       
Sbjct: 114 RLVRLLTTSLRNFTSDNVEVSLDRITSVRFGDYMNSIPLPAVLSVFKAEEWDNFGMATVD 173

Query: 101 NNLVITLLENLLGAS-HETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           +NL+ ++++ LLG     +  ++  R  +T+E +L KR +  + A   Q        +  
Sbjct: 174 SNLIYSMIDVLLGGRRGTSQLRIEGRPYTTIETELVKRLVEVVLADAEQAFRPLSPVTFT 233

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
           ++     +      +R +N     + + + +E+   +  L++P  T+  ++  L+ +   
Sbjct: 234 IDRLET-NPRFAAISRPAN-AAILVRLRIDMEDRGGNIELLLPYATIEPIRGVLLQMFMG 291

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K   +       FA +  Q  +++D  +      LK ++ LK+G  +P   R      +
Sbjct: 292 EKFG-RDPVWEGHFATEIGQAEISVDAVLYEADIPLKQLMRLKVGDTLPLDMRADANVTV 350

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
                 I    +GRVG    IR+T  +     +L  F
Sbjct: 351 RCGDVTITEGRMGRVGDRVAIRVTKPLRKPSTTLAMF 387


>gi|110632665|ref|YP_672873.1| surface presentation of antigens (SPOA) protein [Mesorhizobium sp.
           BNC1]
 gi|110283649|gb|ABG61708.1| surface presentation of antigens (SPOA) protein [Chelativorans sp.
           BNC1]
          Length = 311

 Score =  212 bits (541), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 57/315 (18%), Positives = 108/315 (34%), Gaps = 10/315 (3%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           ++   +  P+  +++ RL G  GD + + + + +        L  IF+ K    + +   
Sbjct: 2   KAPKSDPIPMRDLVVERLVGATGDLRQVTEAARTTAMRSLPVLQDIFQAKFSAPLVLDIA 61

Query: 64  SCQSGKFSHI---IHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
             +  + + +     SF    V          +          +  L+  LLG   +  P
Sbjct: 62  GVEVVRLAELKPEPDSFDALVVIPATDSRDALTMRL---DAQALSLLVSILLGGDPDIPP 118

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
              +R  S +E  +A+      +  LN   S +                      + +  
Sbjct: 119 SPLDRPPSRIELDVARLVFGAFAQALNGTGSRSLGLRLPAPQPLAGPG-DFKRFLVRDGP 177

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNV 240
              I  ++    V+      +P   +LK    +    + +  Q       F  +  +  V
Sbjct: 178 GIRIAFSLGAGPVSGILTAWLPHRIILKARAPAAEDDSPAHTQ---WKQRFGEEVRRSTV 234

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            +   I L K  L  +  LK GQV+           LS   + ++ CE GR+G+NYT+RI
Sbjct: 235 QVTATIPLTKLPLGALANLKPGQVLELQENAPRETRLSVRNRPVFVCEFGRLGQNYTVRI 294

Query: 301 TDRINFDQKSLKNFL 315
               +  Q  L   L
Sbjct: 295 RQPFDDRQAVLDGLL 309


>gi|115523559|ref|YP_780470.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           BisA53]
 gi|115517506|gb|ABJ05490.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           BisA53]
          Length = 403

 Score =  212 bits (540), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 47/277 (16%), Positives = 109/277 (39%), Gaps = 6/277 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + +    +     +V++S     S +FS  ++S     V S      W +       
Sbjct: 117 RLVRLMTTSLRNFTSDNVEVSLDRITSVRFSDYMNSIPLPAVLSVFKAEEWENFGLATVD 176

Query: 101 NNLVITLLENLLGAS-HETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           ++L+ ++++ LLG    +T  ++  R  +T+E  L KR +  + A   Q        +  
Sbjct: 177 SSLIYSMIDVLLGGRRGQTSMRIEGRPYTTIETNLVKRLVEVVLADAEQAFRPLSPVTFK 236

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
           ++     +       R +N     + +++ +E+   +  L++P  T+  ++  L+ +   
Sbjct: 237 IDRLET-NPRFAAITRPAN-AAILVRLHIDMEDRGGNIELLLPYATIEPIRAVLMQMFMG 294

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K   +        A +  Q  +++D  +   +  LK +++LK+G  +P   R      +
Sbjct: 295 EKFG-RDPIWEGHLATEITQAQISVDAVLYEAELPLKQLMSLKVGDTLPLEMRPDALVSV 353

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
                 +    +GRV     IR+T ++     +   F
Sbjct: 354 RCGSVILTEGRMGRVADRVAIRVTKQLRKPNTTYAMF 390


>gi|332533119|ref|ZP_08408988.1| flagellar motor switch protein FliM [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332037401|gb|EGI73855.1| flagellar motor switch protein FliM [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 363

 Score =  211 bits (538), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 44/283 (15%), Positives = 96/283 (33%), Gaps = 19/283 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       M    ++S    Q  KF   IH+       +            I  
Sbjct: 59  ERFARHMRISLFNMMRRTAEVSINGVQMIKFGEYIHTLFVPTSLNMVRFRPLKGTGLITM 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E+++ +  +  I     +  +   + S  
Sbjct: 119 EARLVFILVDNFFGGDGRYHAKIEGREFTPTERRIVQMLLKIIFEDYKEAWAPVMDVS-- 176

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E V   + ++ ++     F + +P   +L+     
Sbjct: 177 ------FEYLDSEVNPAMANIVSPTEVVVISSFHIELDGGGGDFHIALPYS-MLEPIREL 229

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+ +  D         +   + V++ T++     TLK ++ LK G +IP    E
Sbjct: 230 LDAGVQSDTEDTDLRWSKALRDEIMDVEVDMSTQLLEVDLTLKQIMELKAGDIIPVEMPE 289

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
                +       +  ++GR   N  ++I+++I          
Sbjct: 290 H--ITVFVEELPTFRAKMGRSRDNVALQISEKIKRPDSVKSEL 330


>gi|315127312|ref|YP_004069315.1| flagellar motor switch protein FliM [Pseudoalteromonas sp. SM9913]
 gi|315015826|gb|ADT69164.1| flagellar motor switch protein FliM [Pseudoalteromonas sp. SM9913]
          Length = 363

 Score =  211 bits (537), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 43/283 (15%), Positives = 96/283 (33%), Gaps = 19/283 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       M    ++S    Q  KF   IH+       +            I  
Sbjct: 59  ERFARHMRISLFNMMRRTAEVSINGVQMIKFGEYIHTLFVPTSLNMVRFRPLKGTGLITM 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E+++ +  +  I     +  +   + S  
Sbjct: 119 EARLVFILVDNFFGGDGRYHAKIEGREFTPTERRIVQMLLKIIFEDYKEAWAPVMDVS-- 176

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E V   + ++ ++     F + +P   +L+     
Sbjct: 177 ------FEYLDSEVNPAMANIVSPTEVVVISSFHIELDGGGGDFHIALPYS-MLEPIREL 229

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+ +  D         +   + V++ T++     +LK ++ LK G +IP    E
Sbjct: 230 LDAGVQSDTEDTDLRWSKALRDEIMDVEVDLSTQLLEVDLSLKQIMELKAGDIIPVEMPE 289

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
                +       +  ++GR   N  ++I+++I          
Sbjct: 290 H--ITVFVEELPTFRAKMGRSRDNVALQISEKIKRPDSVKSEL 330


>gi|299131782|ref|ZP_07024977.1| flagellar motor switch protein FliM [Afipia sp. 1NLS2]
 gi|298591919|gb|EFI52119.1| flagellar motor switch protein FliM [Afipia sp. 1NLS2]
          Length = 399

 Score =  210 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 44/277 (15%), Positives = 108/277 (38%), Gaps = 6/277 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + +    +     +V++S     S +F+  ++S     V +      W +       
Sbjct: 113 RLVRLMTTSLRNFTSDNVEVSLDRITSVRFADYLNSIPLPCVLTVFKAEEWENFGLFTVD 172

Query: 101 NNLVITLLENLLGAS-HETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           ++L+ ++++ LLG    +T  ++  R  +T+E  L KR +  + A   Q        +  
Sbjct: 173 SSLIYSMIDVLLGGRRGQTSLRIEGRPYTTIETNLVKRLVEVVLADAEQAFRPLSPVTFT 232

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
           ++     +      +R +N     + + + +E+   +  L++P  T+  ++  L+ +   
Sbjct: 233 IDRLET-NPRFAAISRPAN-AAILVRLRVDMEDRGGNVELLLPYATIEPIRNVLLQMFMG 290

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K   +        A +  +  + +D  +      LK +++LK+G  +P   R      +
Sbjct: 291 EKFG-RDPIWEGHLATEIAKAEMYVDAVLYEADMPLKQLMSLKVGDTLPLDIRPDAMVSV 349

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
                 +    +GRVG    IR++  ++    +   F
Sbjct: 350 RCGDVTLSEGRMGRVGDRVAIRVSKPLHKPHTTYAMF 386


>gi|77359748|ref|YP_339323.1| flagellar motor switch protein FliM [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76874659|emb|CAI85880.1| flagellar biosynthesis; component of motor switch and energizing
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 363

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 42/283 (14%), Positives = 95/283 (33%), Gaps = 19/283 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       M    ++S    Q  KF   +H+       +            I  
Sbjct: 59  ERFARHMRISLFNMMRRTAEVSINGVQMIKFGEYVHTLFVPTSLNMVRFRPLKGTGLITM 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E+++ +  +  I     +  +   + S  
Sbjct: 119 EARLVFILVDNFFGGDGRYHAKIEGREFTPTERRIVQMLLKIIFEDYKEAWAPVMDVS-- 176

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E V   + ++ ++     F + +P   +L+     
Sbjct: 177 ------FEYLDSEVNPAMANIVSPTEVVVISSFHIELDGGGGDFHIALPYS-MLEPIREL 229

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+ +  D         +   + V + T++     TLK ++ LK G +IP    E
Sbjct: 230 LDAGVQSDTEDTDLRWSKALRDEIMDVEVELSTQLLEVDLTLKQIMELKAGDIIPVEMPE 289

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
                +       +  ++GR   +  ++I+++I          
Sbjct: 290 H--ITVFVEELPTFRAKMGRSRDSVALQISEKIKRPDSVKSEL 330


>gi|39936958|ref|NP_949234.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           CGA009]
 gi|192292786|ref|YP_001993391.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           TIE-1]
 gi|39650815|emb|CAE29338.1| possible flagellar motor switch protein FliM [Rhodopseudomonas
           palustris CGA009]
 gi|192286535|gb|ACF02916.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           TIE-1]
          Length = 400

 Score =  209 bits (532), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 44/277 (15%), Positives = 109/277 (39%), Gaps = 6/277 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + +    +     +V++S     S +F   ++S     V        W +       
Sbjct: 114 RLVRLMTTSLRNFTSDNVEVSLDRITSVRFGDYMNSIPLPAVLCVFKAEEWQNFGLATVD 173

Query: 101 NNLVITLLENLLGAS-HETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           ++L+ ++++ LLG    +   ++  R  +T+E  L KR +  + A   Q        S +
Sbjct: 174 SSLIYSMIDVLLGGRRGQAALRIEGRPYTTIETNLVKRLLEVVLADAEQAFRPLSPVSFS 233

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
           ++     +      +R +N     + +++ +E+   +  L++P  T+  ++  L+ +   
Sbjct: 234 IDRLET-NPRFAAISRPAN-AAILVRLHIDMEDRGGNIELLLPYATIEPIRGVLMQMFMG 291

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K   + +      A +  Q ++++D  +   +  L+ ++ L++G  +P   R      +
Sbjct: 292 EKFG-RDQVWEGHLATEIVQADISVDAVLYEAELPLRQLMALQVGDTLPLELRADATVAV 350

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
                 +    +GRVG    IR+T  +     +   F
Sbjct: 351 RCGSVVLTEGRMGRVGDRVAIRVTKPLRKPLTTYAMF 387


>gi|75675317|ref|YP_317738.1| flagellar motor switch protein FliM [Nitrobacter winogradskyi
           Nb-255]
 gi|74420187|gb|ABA04386.1| Flagellar motor switch protein FliM [Nitrobacter winogradskyi
           Nb-255]
          Length = 401

 Score =  209 bits (531), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 46/277 (16%), Positives = 107/277 (38%), Gaps = 6/277 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + +    +     +V++S     S +F   ++S     V S      W +       
Sbjct: 115 RLVRLMTTSLRNFTSDNVEVSLDRITSVRFGDYLNSIPLPAVLSVFKAEEWENFGLAMVD 174

Query: 101 NNLVITLLENLLGAS-HETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           ++L+ ++++ LLG    ++  ++  R  +T+E  L KR +  + A   Q        S +
Sbjct: 175 SSLIYSMIDVLLGGRRGQSSLRIEGRPYTTIETNLVKRLVEVVLADAEQAFRPLSPVSFS 234

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
           ++     +       R +N     + + + +E+   +  L++P  T+  ++  L+ +   
Sbjct: 235 IDRLET-NPRFAAITRPAN-AAILVRLRIDMEDRGGTIELLLPYATIEPIRNVLLQMFMG 292

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K   +        A +  Q  + +D  +   +  L+ ++TLK+G  +P   R      +
Sbjct: 293 EKFG-RDPIWESHLATEIAQAQIAVDAVLYEAEIPLRQLMTLKVGDTLPLEMRPDASVAV 351

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
                 +    +GRVG    IR++  +     +   F
Sbjct: 352 RCGSVTLTEGRMGRVGDRVAIRVSRHLRKPSTTFAMF 388


>gi|209884529|ref|YP_002288386.1| flagellar motor switch protein FliM [Oligotropha carboxidovorans
           OM5]
 gi|209872725|gb|ACI92521.1| flagellar motor switch protein FliM [Oligotropha carboxidovorans
           OM5]
          Length = 398

 Score =  209 bits (531), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 44/277 (15%), Positives = 111/277 (40%), Gaps = 6/277 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + +    +     +V++S     S +F+  ++S     V +      W +       
Sbjct: 112 RLVRLMTTSLRNFTSDNVEVSLDRITSVRFADYLNSIPLPCVLTVFKAEEWENFGLFTVD 171

Query: 101 NNLVITLLENLLGAS-HETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           ++L+ ++++ LLG    +T  ++  R  +T+E  L KR +  + A   Q        +  
Sbjct: 172 SSLIYSMIDVLLGGRRGQTSLRIEGRPYTTIETNLVKRLVEVVLADAEQAFRPLSPVTFT 231

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
           ++     +      +R +N     + + + +E+   +  L++P  T+  ++  L+ +   
Sbjct: 232 IDRLET-NPRFAAISRPAN-AAILVRLRVDMEDRGGNVELLLPYATIEPIRNVLLQMFMG 289

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K   +        A +  Q  + +D  +   +  LK +++L++G  +P   R      +
Sbjct: 290 EKFG-RDPIWEGHLATEIAQAELYVDAVLYEAEIPLKQLMSLQVGDTLPLDIRPDALVSV 348

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
                ++    +GRVG    IR++  ++  + +   F
Sbjct: 349 RCGDVKLSEGRMGRVGDRVAIRVSKPLHKPRTTYAMF 385


>gi|86750893|ref|YP_487389.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           HaA2]
 gi|86573921|gb|ABD08478.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           HaA2]
          Length = 401

 Score =  208 bits (530), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 44/277 (15%), Positives = 110/277 (39%), Gaps = 6/277 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + +    +     +V++S     S +FS  ++S     V        W +       
Sbjct: 115 RLVRLMTTSLRNFTSDNVEVSLDRITSVRFSDYMNSIPLPAVLCVFKAEEWQNFGLATVD 174

Query: 101 NNLVITLLENLLGAS-HETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           ++L+ ++++ LLG    +   ++  R  +T+E  L KR +  + A   Q        + +
Sbjct: 175 SSLIYSMIDVLLGGRRGQAAIRIEGRPYTTIETNLVKRLLEVVLADAEQAFRPLSPVAFS 234

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
           ++     +      +R +N     + +++ +E+   +  L++P  T+  ++  L+ +   
Sbjct: 235 IDRLET-NPRFAAISRPAN-AAILVRLHIDMEDRGGNIELLLPYATIEPIRGVLMQMFMG 292

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K   + +      A +  Q ++++D  +   +  L+ ++ L++G  +P   R      +
Sbjct: 293 EKFG-RDQVWEGHLATEIGQADISVDAVLYEAEVPLRQLMALQVGDTLPLDLRADALVAV 351

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
                 +    +GRVG    IR+T  +     +   F
Sbjct: 352 RCGSVTLTEGRMGRVGDRVAIRVTKPLRKPVTTYAMF 388


>gi|92116939|ref|YP_576668.1| flagellar motor switch protein FliM [Nitrobacter hamburgensis X14]
 gi|91799833|gb|ABE62208.1| flagellar motor switch protein FliM [Nitrobacter hamburgensis X14]
          Length = 401

 Score =  208 bits (530), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 46/277 (16%), Positives = 106/277 (38%), Gaps = 6/277 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + +    +     +V++S     S +F   ++S     V S      W +       
Sbjct: 115 RLVRLMTTSLRNFTSDNVEVSLDRITSVRFGDYMNSIPLPAVLSVFKAEEWENFGLAMVD 174

Query: 101 NNLVITLLENLLGAS-HETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           ++L+ ++++ LLG    +T  ++  R  +T+E  L KR +  + A   Q        + +
Sbjct: 175 SSLIYSMIDVLLGGRRGQTSLRIEGRPYTTIETNLVKRLVEVVLADAEQAFRPLSPVTFS 234

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
           ++     +       R +N     + + + +E+   +  L++P  T+  ++  L+ +   
Sbjct: 235 IDRLET-NPRFAAITRPAN-AAILVRLRIDMEDRGGTIELLLPYATIEPIRNVLLQMFMG 292

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K   +        A +  Q  + +D  +   +  LK ++ LK+G  +P   R      +
Sbjct: 293 EKFG-RDPIWESHLATEIAQAQIAVDAVLYEAEIPLKQLMALKVGDTLPLDMRPDASVAV 351

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
                 +    +GRVG    IR++  +     +   F
Sbjct: 352 RCGSVTLTEGRMGRVGDRVAIRVSRHLRKPNTTFAMF 388


>gi|316932826|ref|YP_004107808.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           DX-1]
 gi|315600540|gb|ADU43075.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           DX-1]
          Length = 400

 Score =  208 bits (530), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 44/277 (15%), Positives = 109/277 (39%), Gaps = 6/277 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + +    +     +V++S     S +F   ++S     V        W +       
Sbjct: 114 RLVRLMTTSLRNFTSDNVEVSLDRITSVRFGDYMNSIPLPAVLCVFKAEEWQNFGLATVD 173

Query: 101 NNLVITLLENLLGAS-HETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           ++L+ ++++ LLG    +   ++  R  +T+E  L KR +  + A   Q        S +
Sbjct: 174 SSLIYSMIDVLLGGRRGQAALRIEGRPYTTIETNLVKRLLEVVLADAEQAFRPLSPVSFS 233

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
           ++     +      +R +N     + +++ +E+   +  L++P  T+  ++  L+ +   
Sbjct: 234 IDRLET-NPRFAAISRPAN-AAILVRLHIDMEDRGGNIELLLPYATIEPIRGVLMQMFMG 291

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K   + +      A +  Q ++++D  +   +  L+ ++ L++G  +P   R      +
Sbjct: 292 EKFG-RDQVWEGHLATEIVQADISVDAVLYEAELPLRQLMALQVGDTLPLELRADATVAV 350

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
                 +    +GRVG    IR+T  +     +   F
Sbjct: 351 RCGSVVLTEGRMGRVGDRVAIRVTKPLRRPLTTYAMF 387


>gi|91976164|ref|YP_568823.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           BisB5]
 gi|91682620|gb|ABE38922.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           BisB5]
          Length = 400

 Score =  208 bits (530), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 44/277 (15%), Positives = 108/277 (38%), Gaps = 6/277 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + +    +     +V++S     S +F   ++S     V        W +       
Sbjct: 114 RLVRLMTTSLRNFTSDNVEVSLDRITSVRFGDYMNSIPLPAVLCVFKAEEWQNFGLATVD 173

Query: 101 NNLVITLLENLLGAS-HETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           ++L+ ++++ LLG    +   ++  R  +T+E  L KR +  + A   Q        + +
Sbjct: 174 SSLIYSMIDVLLGGRRGQAALRIEGRPYTTIETNLVKRLLQVVLADAEQAFRPLSPVAFS 233

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
           ++     +      +R +N     + +++ +E+   +  L++P  T+  ++  L+ +   
Sbjct: 234 IDRLET-NPRFAAISRPAN-AAILVRLHIDMEDRGGNIELLLPYATIEPIRGVLMQMFMG 291

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K   + +      A +  Q  +++D  +   +  LK ++ L++G  +P   R      +
Sbjct: 292 EKFG-RDQVWEGHLATEVVQAEISVDAVLYEAEVPLKQLMALQVGDTLPLDLRADALVAV 350

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
                 +    +GRVG    IR+T  +     +   F
Sbjct: 351 RCGSVTLTEGRMGRVGDRVAIRVTKPLRRPVTTYAMF 387


>gi|90423020|ref|YP_531390.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           BisB18]
 gi|90105034|gb|ABD87071.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           BisB18]
          Length = 404

 Score =  208 bits (529), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 45/277 (16%), Positives = 105/277 (37%), Gaps = 6/277 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + +    +     +V++S     S +FS  + S     V S      W +       
Sbjct: 118 RLVRLMTTSLRNFTSDNVEVSLDRITSVRFSDYMSSIPLPAVLSVFKAEEWENFGLATVD 177

Query: 101 NNLVITLLENLLGAS-HETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           + L+ ++++ LLG    +   ++  R  +T+E  L KR +  + A   Q        +  
Sbjct: 178 SALIYSMIDVLLGGRRGQASMRVEGRPYTTIETNLVKRLVEVVLADAEQAFRPLSPVTFK 237

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
           ++     +       R +N     + +++ +E+   +  L++P  T+  ++  L+ +   
Sbjct: 238 IDRLET-NPRFAAITRPAN-AAILVRLHIDMEDRGGNIELLLPYATIEPIRAVLMQMFMG 295

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K   +        + +  Q  +++D  +   +  LK ++ LK+G  +P   R      +
Sbjct: 296 EKFG-RDPIWEGHLSTEIAQAEISVDAVLYEAEIPLKQLMRLKVGDTLPLELRADALVAV 354

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
                 +    +GRV     IR+T ++     +   F
Sbjct: 355 RCGNVTLTEGRMGRVADRVAIRVTKQLRKPNTTYAMF 391


>gi|90406812|ref|ZP_01215004.1| flagellar motor switch protein [Psychromonas sp. CNPT3]
 gi|90312049|gb|EAS40142.1| flagellar motor switch protein [Psychromonas sp. CNPT3]
          Length = 352

 Score =  206 bits (525), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 42/277 (15%), Positives = 97/277 (35%), Gaps = 19/277 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       +    ++S    Q  KF   +H+       +            +  
Sbjct: 63  ERFARHLRISLFNMLRHTAEVSINGVQMLKFGEYVHTLFVPTSLNMVRFRPLKGTALVTM 122

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  I        +    +   
Sbjct: 123 EARLVFILVENFFGGDGRYHAKIEGREFTPTERRIIQMLLKIIFEDYKDAWAPVMTA--- 179

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                D +YL    N          E +   + ++ ++     F + +P   +L+     
Sbjct: 180 -----DFEYLDSEVNPAMANIVSPTEVIVVNSFHIELDGGGGDFHIAMPYS-MLEPIREL 233

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+ +  D         +   ++V +  ++  K+  L+D++   +G +IP    E
Sbjct: 234 LDAGVQSDKEDTDQRWSQALEDEIMDVDVYLTAKLLEKQLPLRDMINWSVGDIIPVELPE 293

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
           +    +   G   +  +LG+   N  ++I DRI   +
Sbjct: 294 ELLVCV--EGLPSFHAKLGKSNDNLALKIIDRIKRPE 328


>gi|145298353|ref|YP_001141194.1| flagellar motor switch protein FliM [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142851125|gb|ABO89446.1| Flagellar motor switch protein [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 356

 Score =  206 bits (525), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 42/285 (14%), Positives = 97/285 (34%), Gaps = 20/285 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       M    ++S    Q  KF   +H+       +            I  
Sbjct: 57  ERFARHMRISLFNMMRRTAEVSINGVQMLKFGEYVHTLFVPTSLNMVRFRPLKGTALITM 116

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  +        +   +    
Sbjct: 117 EARLVFILVENFFGGDGRYHAKIEGREFTPTERRIIQMLLKLVFEDYKDAWAPVMDV--- 173

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F + +P   +L+     
Sbjct: 174 -----GFEYLDSEVNPAMANIVSPTEVIVVSSFHIELDGGGGDFHVAMPYS-MLEPIREL 227

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         +   + V +  ++     TL++++ LK G +IP    E
Sbjct: 228 LDAGVQSDKGDTDVRWSKALRDEIMDVKVELRAKLLETDLTLRELMELKPGDIIPVEMPE 287

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLH 316
                +       +  ++GR   N  ++ITD++    + +K  +H
Sbjct: 288 NLLVYV--EDLPTFHAKMGRTKDNVALKITDKL-KRPEGVKTEMH 329


>gi|85715055|ref|ZP_01046040.1| flagellar motor switch protein [Nitrobacter sp. Nb-311A]
 gi|85698252|gb|EAQ36124.1| flagellar motor switch protein [Nitrobacter sp. Nb-311A]
          Length = 400

 Score =  206 bits (524), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 47/277 (16%), Positives = 106/277 (38%), Gaps = 6/277 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + +    +     +V++S     S +F   ++S     V S      W +       
Sbjct: 114 RLVRLMTTSLRNFTSDNVEVSLDRITSVRFGDYLNSIPLPAVLSVFKAEEWENFGLAMVD 173

Query: 101 NNLVITLLENLLGAS-HETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           ++L+ ++++ LLG    +T  ++  R  +T+E  L KR +  + A   Q        S +
Sbjct: 174 SSLIYSMIDVLLGGRRGQTSLRIEGRPYTTIETNLVKRLVEVVLADAEQAFRPLSPVSFS 233

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
           ++     +       R +N     + + + +E+   +  L++P  T+  ++  L+ +   
Sbjct: 234 IDRLET-NPRFAAITRPAN-AAILVRLRIDMEDRGGTIELLLPYATIEPIRNVLLQMFMG 291

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K   +        A +  Q  + +D  +   +  LK ++TLK+G  +    R      +
Sbjct: 292 EKFG-RDPIWESHLATEIAQAQIAVDAVLYEAEIPLKQLMTLKVGDTLALEMRPDASVAV 350

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
                 +    +GRVG    IR++  +     +   F
Sbjct: 351 RCGSVTLTEGRMGRVGDRVAIRVSRNLRKPNTTFAMF 387


>gi|85711035|ref|ZP_01042095.1| flagellar motor switch protein [Idiomarina baltica OS145]
 gi|85694948|gb|EAQ32886.1| flagellar motor switch protein [Idiomarina baltica OS145]
          Length = 354

 Score =  205 bits (522), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 40/283 (14%), Positives = 98/283 (34%), Gaps = 19/283 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       M    ++S    Q  KF   +H+       +            I  
Sbjct: 58  ERFARHMRVSLFNMMRRTAEVSINGVQMLKFGEYVHTLFVPTSLNMVRFRPLKGTALITM 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E+++ +  +  I     +  +   +    
Sbjct: 118 EARLVFILVDNFFGGDGRYHAKIEGREFTPTERRIIQMLLKLIFEDYKEAWAPVMDV--- 174

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F + +P   +L+     
Sbjct: 175 -----GFEYLDSEVNPAMANIVSPTEVIVISSFHIELDGGGGDFHIALPYS-MLEPIREL 228

Query: 214 LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLK--KTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+ +  D+    A +   ++V ++    L     TL++V+  + G +IP    +
Sbjct: 229 LDAGVQSDKEDTDMRWSKALRDEIMDVPVEMVAKLADVDVTLREVMDFEEGDIIPLEVPD 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
                +       +  ++GR   N  ++I+D+I   +    + 
Sbjct: 289 N--LTVFIEDLPTFHAKMGRSRDNIALKISDKIRRPETVKSDI 329


>gi|311992317|gb|ADQ26732.1| flagellar motor switch protein [Aeromonas hydrophila]
          Length = 356

 Score =  205 bits (521), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 41/285 (14%), Positives = 99/285 (34%), Gaps = 20/285 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       M    ++S    Q  KF   +H+       +            I  
Sbjct: 57  ERFARHMRISLFNMMRRTAEVSINGVQMLKFGEYVHTLFVPTSLNMVRFRPLKGTALITM 116

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  +        +   +    
Sbjct: 117 EARLVFILVENFFGGDGRYHAKIEGREFTPTERRIIQMLLKLVFEDYKDAWAPVMDV--- 173

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F + +P   +L+     
Sbjct: 174 -----GFEYLDSEVNPAMANIVSPTEVIVVSSFHIELDGGGGDFHVAMPYS-MLEPIREL 227

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         +   + V +  ++   + TL++++ L+ G +IP    E
Sbjct: 228 LDAGVQSDKGDTDVRWSKALRDEIMDVKVELRAKLLETELTLRELMELQPGDIIPVEMPE 287

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLH 316
               ++       +  ++GR   N  ++ITD++    + +K  +H
Sbjct: 288 N--LLVFVEDLPTFHAKMGRTKDNVALKITDKL-KRPEGVKTEMH 329


>gi|117619656|ref|YP_855911.1| flagellar motor switch protein FliM [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117561063|gb|ABK38011.1| flagellar motor switch protein FliM [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 356

 Score =  205 bits (521), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 41/285 (14%), Positives = 99/285 (34%), Gaps = 20/285 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       M    ++S    Q  KF   +H+       +            I  
Sbjct: 57  ERFARHMRISLFNMMRRTAEVSINGVQMLKFGEYVHTLFVPTSLNMVRFRPLKGTALITM 116

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  +        +   +    
Sbjct: 117 EARLVFILVENFFGGDGRYHAKIEGREFTPTERRIIQMLLKLVFEDYKDAWAPVMDV--- 173

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F + +P   +L+     
Sbjct: 174 -----GFEYLDSEVNPAMANIVSPTEVIVVSSFHIELDGGGGDFHVAMPYS-MLEPIREL 227

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         +   + V +  ++   + TL++++ L+ G +IP    E
Sbjct: 228 LDAGVQSDKGDTDVRWSKALRDEIMDVKVELRAKLLETELTLRELMELQPGDIIPVEMPE 287

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLH 316
               ++       +  ++GR   N  ++ITD++    + +K  +H
Sbjct: 288 N--LLVFVEDLPTFHAKMGRTKDNVALKITDKL-KRPEGVKTEMH 329


>gi|330828806|ref|YP_004391758.1| flagellar motor switch protein FliM [Aeromonas veronii B565]
 gi|328803942|gb|AEB49141.1| Flagellar motor switch protein FliM [Aeromonas veronii B565]
          Length = 356

 Score =  205 bits (521), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 41/285 (14%), Positives = 99/285 (34%), Gaps = 20/285 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       M    ++S    Q  KF   +H+       +            I  
Sbjct: 57  ERFARHMRISLFNMMRRTAEVSINGVQMLKFGEYVHTLFVPTSLNMVRFRPLKGTALITM 116

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  +        +   +    
Sbjct: 117 EARLVFILVENFFGGDGRYHAKIEGREFTPTERRIIQMLLKLVFEDYKDAWAPVMDV--- 173

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F + +P   +L+     
Sbjct: 174 -----GFEYLDSEVNPAMANIVSPTEVIVVSSFHIELDGGGGDFHVAMPYS-MLEPIREL 227

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         +   + V +  ++   + TL++++ L+ G +IP    E
Sbjct: 228 LDAGVQSDKGDTDVRWSKALRDEIMDVKVELRAKLLETELTLRELMELRPGDIIPVDMPE 287

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLH 316
               ++       +  ++GR   N  ++ITD++    + +K  +H
Sbjct: 288 N--LLVFVEDLPTFHAKMGRTKDNVALKITDKL-KRPEGVKTEMH 329


>gi|294853149|ref|ZP_06793821.1| flagellar motor switch protein FliM [Brucella sp. NVSL 07-0026]
 gi|294818804|gb|EFG35804.1| flagellar motor switch protein FliM [Brucella sp. NVSL 07-0026]
          Length = 348

 Score =  204 bits (520), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 51/301 (16%), Positives = 115/301 (38%), Gaps = 7/301 (2%)

Query: 18  LARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSF 77
           L R  G  GD   ++ ++         F  +  K+      D    S +S   +     F
Sbjct: 52  LLRAAGLSGDD--LKSLAHVFKDASSHFCAR-LKQGSAAAFDAETGSVESTDKTAFNDIF 108

Query: 78  KENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKR 137
            +  + +      W  + ++     LV +++E + GA     P   +R    VE+K+A  
Sbjct: 109 DKAAIITPLKAERWGCSLYLALDAVLVFSVIEAMFGAQGNLGPVDADRPFGMVEQKIANL 168

Query: 138 TIAQISAVLNQCISTTQESS-PNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASS 196
               ++  L++  +T+         D  D     +    LS  F  T  + +T       
Sbjct: 169 LAGHLAGALDRVFNTSSSQPLFAPGDCIDTADFDRENFELSRLF--TCRIAVTAAGKTGQ 226

Query: 197 FVLIIPQETLLKTTLISLSSQNKSENQSED-LIDPFARKTYQLNVNIDTRINLKKTTLKD 255
             L++P+ T         +   +  +Q++        ++  +  + ++  +     +L  
Sbjct: 227 MHLLLPRSTHKPMQDAVAAFLRRPMDQADPAWAKKLRQEVSRARIELEAFMQQGSMSLDA 286

Query: 256 VVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFL 315
           +  L+IGQV+           L A  ++++ C LG+ G ++T+++ D +N ++  +   +
Sbjct: 287 LSRLEIGQVLKLPVDAMEQVRLRAGNQQLFKCTLGKSGIHFTVKVGDPVNQEEDLIDELV 346

Query: 316 H 316
            
Sbjct: 347 A 347


>gi|149908450|ref|ZP_01897113.1| Flagellar motor switch protein [Moritella sp. PE36]
 gi|149808613|gb|EDM68548.1| Flagellar motor switch protein [Moritella sp. PE36]
          Length = 350

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 40/289 (13%), Positives = 103/289 (35%), Gaps = 22/289 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       M    ++S    Q  KF   +H+       +            +  
Sbjct: 58  ERFARHMRISLFNMMRRTAEVSINGVQMLKFGEYVHTLFVPTSLNMVRFRPLKGTALVTM 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  +    ++  +   ++   
Sbjct: 118 EARLVFILVENFFGGDGRYHAKIEGREFTPTERRIIQMLLKIVFEDYHEAWAPVMDAE-- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E V   + ++ ++     F + +P   +L+     
Sbjct: 176 ------FEYLDSEVNPAMANIVSPTEVVVVSSFHIELDGGGGDFHITMPYS-MLEPIREL 228

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+ +  D         +   + V + T++   + T+  ++ L++G +IP    E
Sbjct: 229 LDAGVQSDKEDTDERWSSALQEEILDVPVELSTKLLETELTIGQIMELRVGDIIPIEMPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRI---NFDQKSLKNFLHK 317
           +    +       Y  +LGR   N  ++I+ ++   N  +  + + + +
Sbjct: 289 E--LTVFIEDLPSYKAKLGRNKDNVAVKISRKLKVSNLTKSDIDHVVLR 335


>gi|269103169|ref|ZP_06155866.1| flagellar motor switch protein FliM [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268163067|gb|EEZ41563.1| flagellar motor switch protein FliM [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 347

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 38/277 (13%), Positives = 95/277 (34%), Gaps = 19/277 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       +    ++S    Q  KF    ++       +            +  
Sbjct: 57  ERFARHMRISLFNMLRKTAEVSINGVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALVTM 116

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              L+  L+EN  G       ++  R  +  E+++ +  +  +     +  S        
Sbjct: 117 EARLIFILVENFFGGDGRFHAKIEGREFTPTERRIIQMLLKLVFEDYREAWSPVMGVE-- 174

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F +++P   +++     
Sbjct: 175 ------FEYLDSEVNPTMANIVSPTEVIVVSSFHIELDGGGGDFHVVMPYS-MVEPIREL 227

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         +   + VNI  ++     TL+D++ L++G +IP     
Sbjct: 228 LDAGVQSDKMDTDVRWSRALREEIMDIPVNIRAKLLDVDLTLRDLMELQVGDIIPVDMP- 286

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
              A +       Y  ++GR G N  ++I++++    
Sbjct: 287 -DTATVFVEDLPTYRAKMGRSGDNVALKISEKLKRPD 322


>gi|90579934|ref|ZP_01235742.1| flagellar motor switch protein [Vibrio angustum S14]
 gi|90438819|gb|EAS64002.1| flagellar motor switch protein [Vibrio angustum S14]
          Length = 349

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 40/277 (14%), Positives = 96/277 (34%), Gaps = 19/277 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       +    ++S    Q  KF    ++       +            I  
Sbjct: 57  ERFARHMRISLFNMLRKTAEVSINGVQMIKFGEYQNTLYVPTSLNMVRFRPLKGTALITM 116

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  +     +  S        
Sbjct: 117 EARLVFILVENFFGGDGRFHAKIEGREFTPTERRIVQMLLKLVFEDYREAWSPVMGVE-- 174

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F +++P   +++     
Sbjct: 175 ------FEYLDSEVNPTMANIVSPTEVIVVSSFHIEVDGGGGDFHVVMPYS-MVEPIREL 227

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         +   + VN+  ++     +L+D++ L++G VIP    E
Sbjct: 228 LDAGVQSDKMDTDVRWSKALRDEIMDVPVNLRAKLLDVDLSLRDLMELQVGDVIPIDMPE 287

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
              A +       Y  ++GR G N  ++I++++    
Sbjct: 288 --QATIFVEDLPTYHAKMGRSGDNVALKISEKLQRPD 322


>gi|56460301|ref|YP_155582.1| flagellar motor switch protein FliM [Idiomarina loihiensis L2TR]
 gi|56179311|gb|AAV82033.1| Flagellar motor switch protein [Idiomarina loihiensis L2TR]
          Length = 356

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 38/283 (13%), Positives = 100/283 (35%), Gaps = 19/283 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       M    ++S    Q  KF   +H+       +            I  
Sbjct: 60  ERFARHMRVSLFNMMRRTAEVSINGVQMIKFGEYVHTLFVPTSLNMVRFRPLKGTALITM 119

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E+++ +  +  +     +  +   +    
Sbjct: 120 EARLVFILVDNFFGGDGRYHAKIEGREFTPTERRIIQMLLKLVFEDYKEAWAPVMDV--- 176

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F + +P   +L+     
Sbjct: 177 -----GFEYLDSEVNPAMANIVSPTEVIVISSFHIELDGGGGDFHIALPYS-MLEPIREL 230

Query: 214 LSSQNKSENQSEDLIDPFARKTYQLNVNIDTR--INLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+ +  D+    A +   ++V ++    +   + +L++V+ L+ G VIP    +
Sbjct: 231 LDAGVQSDKEDTDMRWSKALRDEIMDVPVEMIAKLAQTEMSLREVMDLREGDVIPLELPD 290

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
                +       +  ++GR   N  ++I+++I   +    + 
Sbjct: 291 D--LTVLIEDLPTFHAKMGRSRDNVALKISEKIKRPETVKSDI 331


>gi|89075520|ref|ZP_01161931.1| flagellar motor switch protein [Photobacterium sp. SKA34]
 gi|89048792|gb|EAR54363.1| flagellar motor switch protein [Photobacterium sp. SKA34]
          Length = 349

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 40/277 (14%), Positives = 96/277 (34%), Gaps = 19/277 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       +    ++S    Q  KF    ++       +            I  
Sbjct: 57  ERFARHMRISLFNMLRKTAEVSINGVQMIKFGEYQNTLYVPTSLNMVRFRPLKGTALITM 116

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  +     +  S        
Sbjct: 117 EARLVFILVENFFGGDGRFHAKIEGREFTPTERRIVQMLLKLVFEDYREAWSPVMGVE-- 174

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F +++P   +++     
Sbjct: 175 ------FEYLDSEVNPTMANIVSPTEVIVVSSFHIEVDGGGGDFHVVMPYS-MVEPIREL 227

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         +   + VN+  ++     +L+D++ L++G VIP    E
Sbjct: 228 LDAGVQSDKMDTDVRWSKALRDEIMDVPVNLRAKLLDVDLSLRDLMELQVGDVIPIDMPE 287

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
              A +       Y  ++GR G N  ++I++++    
Sbjct: 288 --QATIFVEDLPTYHAKMGRSGDNVALKISEKLQRPD 322


>gi|74055041|gb|AAZ95846.1| FliM [Aeromonas hydrophila]
          Length = 356

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 41/285 (14%), Positives = 98/285 (34%), Gaps = 20/285 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       M    ++S    Q  KF   +H+       +            I  
Sbjct: 57  ERFARHMRISLFNMMRRTAEVSINGVQMLKFGEYVHTLFVPTSLNMVRFRPLKGTALITM 116

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  +        +   +    
Sbjct: 117 EARLVFILVENFFGGDGRYHAKIEGREFTPTERRIIQMLLKLVFEDYKDAWAPVMDV--- 173

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F + +P   +L+     
Sbjct: 174 -----GFEYLDSEVNPAMANIVSPTEVIVVSSFHIELDGGGGDFHVAMPYS-MLEPIREL 227

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         +   + V +  ++     TL++++ L+ G +IP    E
Sbjct: 228 LDAGVQSDKGDTDVRWSKALRDEIMDVKVELRAKLLETDLTLRELMELRPGDIIPVEMPE 287

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLH 316
                +       +  ++GR  +N  ++ITD++    + +K  +H
Sbjct: 288 NLLVYV--EDLPTFHAKMGRTKENVALKITDKL-KRPEGVKTEMH 329


>gi|332305666|ref|YP_004433517.1| flagellar motor switch protein FliM [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332172995|gb|AEE22249.1| flagellar motor switch protein FliM [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 352

 Score =  203 bits (517), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 44/276 (15%), Positives = 94/276 (34%), Gaps = 19/276 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       M    ++S    Q  KF   IH+       +            I  
Sbjct: 58  ERFARHMRVSLFNMMRRSAEVSINGIQMIKFGEYIHTLFVPTSLNMVRFRPLKGTGLITM 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E+++ +  +  I     +  +   + S  
Sbjct: 118 EARLVFILVDNFFGGDGRYHAKIEGREFTPTERRIIQMLLKLIFEDYKEAWAPVMDVS-- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E V   + ++ ++     F + +P   +L+     
Sbjct: 176 ------FEYLDSEVNPAMANIVSPTEVVVISSFHIELDGGGGDFHVSLPYS-MLEPIREL 228

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+ +  D         +   + V + T +     +L+ ++ +K G +IP    E
Sbjct: 229 LDAGVQSDKEDTDLRWSKALRDEIMDVKVELSTHMMDLTLSLQKIMDMKAGDIIPIDMPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
                +       +  +LGR   N  ++ITD+I   
Sbjct: 289 H--ITVMIEELPTFRAKLGRSRDNLALKITDKIPRP 322


>gi|109899345|ref|YP_662600.1| flagellar motor switch protein FliM [Pseudoalteromonas atlantica
           T6c]
 gi|109701626|gb|ABG41546.1| flagellar motor switch protein FliM [Pseudoalteromonas atlantica
           T6c]
          Length = 352

 Score =  203 bits (517), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 44/276 (15%), Positives = 94/276 (34%), Gaps = 19/276 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       M    ++S    Q  KF   IH+       +            I  
Sbjct: 58  ERFARHMRVSLFNMMRRSAEVSINGIQMIKFGEYIHTLFVPTSLNMVRFRPLKGTGLITM 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E+++ +  +  I     +  +   + S  
Sbjct: 118 EARLVFILVDNFFGGDGRYHAKIEGREFTPTERRIIQMLLKLIFEDYKEAWAPVMDVS-- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E V   + ++ ++     F + +P   +L+     
Sbjct: 176 ------FEYLDSEVNPAMANIVSPTEVVVISSFHIELDGGGGDFHVSLPYS-MLEPIREL 228

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+ +  D         +   + V + T +     +L+ ++ +K G +IP    E
Sbjct: 229 LDAGVQSDKEDTDLRWSKALRDEIMDVKVELSTHMMDLTLSLQKIMDMKAGDIIPIDMPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
                +       +  +LGR   N  ++ITD+I   
Sbjct: 289 H--ITVMIEELPTFRAKLGRSRDNLALKITDKIPRP 322


>gi|330445373|ref|ZP_08309025.1| flagellar motor switch protein FliM [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328489564|dbj|GAA03522.1| flagellar motor switch protein FliM [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 349

 Score =  203 bits (516), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 40/277 (14%), Positives = 96/277 (34%), Gaps = 19/277 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       +    ++S    Q  KF    ++       +            I  
Sbjct: 57  ERFARHMRISLFNMLRKTAEVSINGVQMIKFGEYQNTLYVPTSLNMVRFRPLKGTALITM 116

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  +     +  S        
Sbjct: 117 EARLVFILVENFFGGDGRFHAKIEGREFTPTERRIVQMLLKLVFEDYREAWSPVMGVE-- 174

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F +++P   +++     
Sbjct: 175 ------FEYLDSEVNPTMANIVSPTEVIVVSSFHIEVDGGGGDFHVVMPYS-MVEPIREL 227

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         +   + VN+  ++     +L+D++ L++G VIP    E
Sbjct: 228 LDAGVQSDKMDTDVRWSKALRDEIMDVPVNLRAKLLDVDLSLRDLMELQVGDVIPIDMPE 287

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
              A +       Y  ++GR G N  ++I++++    
Sbjct: 288 --QATIFIEDLPTYHAKMGRSGDNVALKISEKLKRPD 322


>gi|239997091|ref|ZP_04717615.1| flagellar motor switch protein FliM [Alteromonas macleodii ATCC
           27126]
          Length = 352

 Score =  202 bits (514), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 44/276 (15%), Positives = 92/276 (33%), Gaps = 19/276 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       M    ++S    Q  KF   IH+       +            I  
Sbjct: 58  ERFARHMRVSLFNMMRRSAEVSINGIQMIKFGEYIHTLFVPTSLNMVRFRPLKGTGLITM 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E+++ +  +  I     +  +   + S  
Sbjct: 118 EARLVFILVDNFFGGDGRYHAKIEGREFTPTERRIIQMLLKIIFEDYKEAWAPVMDVS-- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E V   + ++ ++     F + +P   +L+     
Sbjct: 176 ------FEYLDSEVNPAMANIVSPTEVVVISSFHIELDGGGGDFHVSLPYS-MLEPIREL 228

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+ +  D         +   + V + T +      L+DV+  K G +IP    E
Sbjct: 229 LDAGVQSDKEDTDLRWSKALRDEIMDVKVALTTHMLDVDVPLRDVMEFKPGDIIPVEMPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
               +        +  +LGR   N  ++I ++I   
Sbjct: 289 TITVL--IEDLPTFRAKLGRSRDNLALKIVEKIARP 322


>gi|23499888|ref|NP_699328.1| flagellar motor switch protein FliM [Brucella suis 1330]
 gi|161620211|ref|YP_001594097.1| surface presentation of antigens (SPOA) protein [Brucella canis
           ATCC 23365]
 gi|163844320|ref|YP_001621975.1| hypothetical protein BSUIS_B0131 [Brucella suis ATCC 23445]
 gi|254702553|ref|ZP_05164381.1| hypothetical protein Bsuib36_01102 [Brucella suis bv. 3 str. 686]
 gi|254711391|ref|ZP_05173202.1| hypothetical protein BpinB_14272 [Brucella pinnipedialis B2/94]
 gi|254711990|ref|ZP_05173801.1| hypothetical protein BcetM6_01072 [Brucella ceti M644/93/1]
 gi|254715060|ref|ZP_05176871.1| hypothetical protein BcetM_01082 [Brucella ceti M13/05/1]
 gi|256014915|ref|YP_003104924.1| flagellar motor switch protein FliM [Brucella microti CCM 4915]
 gi|256029979|ref|ZP_05443593.1| hypothetical protein BpinM2_04895 [Brucella pinnipedialis
           M292/94/1]
 gi|260568539|ref|ZP_05839008.1| flagellar motor switch protein FliM [Brucella suis bv. 4 str. 40]
 gi|261216767|ref|ZP_05931048.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261318997|ref|ZP_05958194.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261319634|ref|ZP_05958831.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261753131|ref|ZP_05996840.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|265987000|ref|ZP_06099557.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|23463463|gb|AAN33333.1| flagellar motor switch protein FliM, putative [Brucella suis 1330]
 gi|161337022|gb|ABX63326.1| surface presentation of antigens (SPOA) protein [Brucella canis
           ATCC 23365]
 gi|163675043|gb|ABY39153.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
 gi|255997575|gb|ACU49262.1| flagellar motor switch protein FliM [Brucella microti CCM 4915]
 gi|260155204|gb|EEW90285.1| flagellar motor switch protein FliM [Brucella suis bv. 4 str. 40]
 gi|260921856|gb|EEX88424.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261292324|gb|EEX95820.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261298220|gb|EEY01717.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261742884|gb|EEY30810.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|264659197|gb|EEZ29458.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
          Length = 316

 Score =  202 bits (514), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 51/301 (16%), Positives = 115/301 (38%), Gaps = 7/301 (2%)

Query: 18  LARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSF 77
           L R  G  GD   ++ ++         F  +  K+      D    S +S   +     F
Sbjct: 20  LLRAAGLSGDD--LKSLAHVFKDASSHFCAR-LKQGSAAAFDAETGSVESTDKTAFNDIF 76

Query: 78  KENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKR 137
            +  + +      W  + ++     LV +++E + GA     P   +R    VE+K+A  
Sbjct: 77  DKAAIITPLKAERWGCSLYLALDAVLVFSVIEAMFGAQGNLGPVDADRPFGMVEQKIANL 136

Query: 138 TIAQISAVLNQCISTTQESS-PNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASS 196
               ++  L++  +T+         D  D     +    LS  F  T  + +T       
Sbjct: 137 LAGHLAGALDRVFNTSSSQPLFAPGDCIDTADFDRENFELSRLF--TCRIAVTAAGKTGQ 194

Query: 197 FVLIIPQETLLKTTLISLSSQNKSENQSED-LIDPFARKTYQLNVNIDTRINLKKTTLKD 255
             L++P+ T         +   +  +Q++        ++  +  + ++  +     +L  
Sbjct: 195 MHLLLPRSTHKPMQDAVAAFLRRPMDQADPAWAKKLRQEVSRARIELEAFMQQGSMSLDA 254

Query: 256 VVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFL 315
           +  L+IGQV+           L A  ++++ C LG+ G ++T+++ D +N ++  +   +
Sbjct: 255 LSRLEIGQVLKLPVDAMEQVRLRAGNQQLFKCTLGKSGIHFTVKVGDPVNQEEDLIDELV 314

Query: 316 H 316
            
Sbjct: 315 A 315


>gi|332140589|ref|YP_004426327.1| flagellar motor switch protein FliM [Alteromonas macleodii str.
           'Deep ecotype']
 gi|327550611|gb|AEA97329.1| flagellar motor switch protein FliM [Alteromonas macleodii str.
           'Deep ecotype']
          Length = 352

 Score =  202 bits (514), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 44/276 (15%), Positives = 92/276 (33%), Gaps = 19/276 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       M    ++S    Q  KF   IH+       +            I  
Sbjct: 58  ERFARHMRVSLFNMMRRSAEVSINGIQMIKFGEYIHTLFVPTSLNMVRFRPLKGTGLITM 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E+++ +  +  I     +  +   + S  
Sbjct: 118 EARLVFILVDNFFGGDGRYHAKIEGREFTPTERRIIQMLLKIIFEDYKEAWAPVMDVS-- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E V   + ++ ++     F + +P   +L+     
Sbjct: 176 ------FEYLDSEVNPAMANIVSPTEVVVISSFHIELDGGGGDFHVSLPYS-MLEPIREL 228

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+ +  D         +   + V + T +      L+DV+  K G +IP    E
Sbjct: 229 LDAGVQSDKEDTDLRWSKALRDEIMDVKVALTTHMLDVDVPLRDVMEFKPGDIIPVEMPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
               +        +  +LGR   N  ++I ++I   
Sbjct: 289 TITVL--IEDLPTFRAKLGRSRDNLALKIVEKIARP 322


>gi|256158143|ref|ZP_05456059.1| hypothetical protein BcetM4_04820 [Brucella ceti M490/95/1]
 gi|256252906|ref|ZP_05458442.1| hypothetical protein BcetB_01037 [Brucella ceti B1/94]
 gi|261219994|ref|ZP_05934275.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|265996661|ref|ZP_06109218.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|260918578|gb|EEX85231.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|262550958|gb|EEZ07119.1| conserved hypothetical protein [Brucella ceti M490/95/1]
          Length = 316

 Score =  202 bits (513), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 51/301 (16%), Positives = 115/301 (38%), Gaps = 7/301 (2%)

Query: 18  LARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSF 77
           L R  G  GD   ++ ++         F  +  K+      D    S +S   +     F
Sbjct: 20  LLRAAGLSGDD--LKSLAHVFKDASSHFCAR-LKQGSAAAFDAETGSVESTDKTAFNDIF 76

Query: 78  KENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKR 137
            +  + +      W  + ++     LV +++E + GA     P   +R    VE+K+A  
Sbjct: 77  DKAAIITPLKAERWGCSLYLALDAVLVFSVIEAMFGAQGNLGPVDADRPFGMVEQKIANL 136

Query: 138 TIAQISAVLNQCISTTQESS-PNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASS 196
               ++  L++  +T+         D  D     +    LS  F  T  + +T       
Sbjct: 137 LAGHLAGALDRVFNTSSSQPLFAPGDCIDTADFDRENFELSRLF--TCRIAVTAAGKTGQ 194

Query: 197 FVLIIPQETLLKTTLISLSSQNKSENQSED-LIDPFARKTYQLNVNIDTRINLKKTTLKD 255
             L++P+ T         +   +  +Q++        ++  +  + ++  +     +L  
Sbjct: 195 MHLLLPRSTHKPMQDAVAAFLRRPMDQADPAWAKKLRQEVSRARIELEAFMQQGSMSLDA 254

Query: 256 VVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFL 315
           +  L+IGQV+           L A  ++++ C LG+ G ++T+++ D +N ++  +   +
Sbjct: 255 LSRLEIGQVLKLPVDAMEQVQLRAGNQQLFKCTLGKSGIHFTVKVGDPVNQEEDLIDELV 314

Query: 316 H 316
            
Sbjct: 315 A 315


>gi|254706317|ref|ZP_05168145.1| hypothetical protein BpinM_04820 [Brucella pinnipedialis
           M163/99/10]
 gi|261313764|ref|ZP_05952961.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261302790|gb|EEY06287.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
          Length = 316

 Score =  202 bits (513), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 51/301 (16%), Positives = 115/301 (38%), Gaps = 7/301 (2%)

Query: 18  LARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSF 77
           L R  G  GD   ++ ++         F  +  K+      D    S +S   +     F
Sbjct: 20  LLRAAGLSGDD--LKSLAHVFKDTSSHFCAR-LKQGSAAAFDAETGSVESTDKTAFNDIF 76

Query: 78  KENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKR 137
            +  + +      W  + ++     LV +++E + GA     P   +R    VE+K+A  
Sbjct: 77  DKAAIITPLKAERWGCSLYLALDAVLVFSVIEAMFGAQGNLGPVDADRPFGMVEQKIANL 136

Query: 138 TIAQISAVLNQCISTTQESS-PNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASS 196
               ++  L++  +T+         D  D     +    LS  F  T  + +T       
Sbjct: 137 LAGHLAGALDRVFNTSSSQPLFAPGDCIDTADFDRENFELSRLF--TCRIAVTAAGKTGQ 194

Query: 197 FVLIIPQETLLKTTLISLSSQNKSENQSED-LIDPFARKTYQLNVNIDTRINLKKTTLKD 255
             L++P+ T         +   +  +Q++        ++  +  + ++  +     +L  
Sbjct: 195 MHLLLPRSTHKPMQDAVAAFLRRPMDQADPAWAKKLRQEVSRARIELEAFMQQGSMSLDA 254

Query: 256 VVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFL 315
           +  L+IGQV+           L A  ++++ C LG+ G ++T+++ D +N ++  +   +
Sbjct: 255 LSRLEIGQVLKLPVDAMEQVRLRAGNQQLFKCTLGKSGIHFTVKVGDPVNQEEDLIDELV 314

Query: 316 H 316
            
Sbjct: 315 A 315


>gi|306846301|ref|ZP_07478862.1| surface presentation of antigens protein [Brucella sp. BO1]
 gi|306273296|gb|EFM55165.1| surface presentation of antigens protein [Brucella sp. BO1]
          Length = 316

 Score =  201 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 49/292 (16%), Positives = 113/292 (38%), Gaps = 6/292 (2%)

Query: 26  GDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQ 85
           GD K++  +       +   L    K+      D    S +S   +     F +  + + 
Sbjct: 29  GDLKSLAHVFKDASSHFCARL----KQGSAAAFDAETGSVESTDKTAFNDIFDKAAIITP 84

Query: 86  ASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAV 145
                W  + ++     LV +++E + GA     P   +R    VE+K+A      ++  
Sbjct: 85  LKAERWGCSLYLALDAVLVFSVIEAMFGAQGNLGPVDADRPFGMVEQKIANLLAGHLADA 144

Query: 146 LNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQET 205
           L++  +T   S P       ID    + + L    + T  + +T         L++P+ T
Sbjct: 145 LDRVFNT-GSSQPLFAPGDCIDTADFDRDNLELSRLFTCRIAVTAAGKTGQMHLLLPRST 203

Query: 206 LLKTTLISLSSQNKSENQSED-LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                    +   +  +Q++        ++  +  + ++  +     +L  +  L+IGQV
Sbjct: 204 HKPMQDAVAAFLRRPMDQADPAWAKKLRQEVSRARIELEAFMQQGSMSLDALSRLEIGQV 263

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLH 316
           +           L A  ++++ C LG+ G ++T+++ D +N ++  +   + 
Sbjct: 264 LKLPVDAMEQVRLRAGNQQLFKCTLGKSGIHFTVKVGDPVNQEEDFIDELVA 315


>gi|254699436|ref|ZP_05161264.1| hypothetical protein Bsuib55_01034 [Brucella suis bv. 5 str. 513]
 gi|261749887|ref|ZP_05993596.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261739640|gb|EEY27566.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
          Length = 316

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 51/301 (16%), Positives = 114/301 (37%), Gaps = 7/301 (2%)

Query: 18  LARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSF 77
           L R  G  GD   ++ ++         F  +  K+      D    S +S   +     F
Sbjct: 20  LLRAAGLSGDD--LKSLAHVFKDASSHFCAR-LKQGSAAAFDAETGSVESTDKTAFNDIF 76

Query: 78  KENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKR 137
            +  + +      W  + ++     LV +++E + GA     P   +R    VE+K+A  
Sbjct: 77  DKAAIITPLKAERWGCSLYLALDAVLVFSVIEAMFGAQGNLGPVDADRPFGMVEQKIANL 136

Query: 138 TIAQISAVLNQCISTTQESS-PNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASS 196
               ++  L++  +T+         D  D     +    LS  F  T  + +T       
Sbjct: 137 LAGHLAGALDRVFNTSSSQPLFAPGDCIDTADFDRENFELSRLF--TCRIAVTAAGKTGQ 194

Query: 197 FVLIIPQETLLKTTLISLSSQNKSENQSED-LIDPFARKTYQLNVNIDTRINLKKTTLKD 255
             L++P+ T         +   +  +Q++        ++  +  + ++  +      L  
Sbjct: 195 MHLLLPRSTHKPMQDAVAAFLRRPMDQADPAWAKKLRQEVSRARIELEAFMQQGSMLLDA 254

Query: 256 VVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFL 315
           +  L+IGQV+           L A  ++++ C LG+ G ++T+++ D +N ++  +   +
Sbjct: 255 LSRLEIGQVLKLPVDAMEQVRLRAGNQQLFKCTLGKSGIHFTVKVGDPVNQEEDLIDELV 314

Query: 316 H 316
            
Sbjct: 315 A 315


>gi|54308123|ref|YP_129143.1| flagellar motor switch protein FliM [Photobacterium profundum SS9]
 gi|46912549|emb|CAG19341.1| Putative flagellar motor switch protein FliM [Photobacterium
           profundum SS9]
          Length = 348

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 38/277 (13%), Positives = 93/277 (33%), Gaps = 19/277 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       +    ++S    Q  KF    ++       +            I  
Sbjct: 57  ERFARHMRISLFNMLRKTAEVSINGVQMIKFGEYQNTLYVPTSLNMVRFRPLKGTALITM 116

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  +     +  S        
Sbjct: 117 EARLVFILVENFFGGDGRFHAKIEGREFTPTERRIVQMLLKLVFEDYREAWSPVMGVE-- 174

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F +++P   +++     
Sbjct: 175 ------FEYLDSEVNPTMANIVSPTEVIVVSSFHIELDGGGGDFHVVMPYS-MVEPIREL 227

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+   +D         +   + VN+  ++     +L+D++ L+ G +IP    E
Sbjct: 228 LDAGVQSDKMDKDVRWSMALREEIMDVPVNLRAKLLDVDLSLRDLMELQAGDIIPIDVPE 287

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
                        Y  ++G+ G N  ++IT ++    
Sbjct: 288 SATV--FVEDLPTYRAKMGKSGDNIALKITQKLKRPD 322


>gi|71278806|ref|YP_268251.1| flagellar motor switch protein FliM [Colwellia psychrerythraea 34H]
 gi|71144546|gb|AAZ25019.1| flagellar motor switch protein FliM [Colwellia psychrerythraea 34H]
          Length = 354

 Score =  200 bits (509), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 43/283 (15%), Positives = 95/283 (33%), Gaps = 19/283 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       M    ++S    Q  KF   IH+       +            I  
Sbjct: 60  ERFARHMRISLFNMMRRTAEVSINGIQMIKFGEYIHTLFVPTSLNMVRFRPLKGTALITM 119

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E+++ +  +  +     +  S   + S  
Sbjct: 120 EARLVFILVDNFFGGDGRYHAKIEGREFTPTERRIIQMLLKLVFEDYKEAWSPVMDVS-- 177

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E V   + ++ ++     F + +P   +L+     
Sbjct: 178 ------FEYLDSEVNPSMANIVSPTEVVVISSFHIELDGGGGDFHIALPYS-MLEPIREL 230

Query: 214 LSSQNKSENQSEDLID--PFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+ +  D+        +   + V I+T+      +L  V+ L+ G +IP    +
Sbjct: 231 LDAGVQSDKEDTDMRWSKALRDEIMDVPVTINTKFIEVDISLSQVMELQAGDIIPIEMPD 290

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
               +        +  +LGR   N  ++I  +I   + +    
Sbjct: 291 NITVL--IEDLPTFRAKLGRSRDNIALKIESKIRRPESAKSEL 331


>gi|256059632|ref|ZP_05449829.1| hypothetical protein Bneo5_04675 [Brucella neotomae 5K33]
 gi|261323602|ref|ZP_05962799.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261299582|gb|EEY03079.1| conserved hypothetical protein [Brucella neotomae 5K33]
          Length = 316

 Score =  200 bits (509), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 51/301 (16%), Positives = 114/301 (37%), Gaps = 7/301 (2%)

Query: 18  LARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSF 77
           L R  G  GD   ++ ++         F  +  K+      D    S +S   +     F
Sbjct: 20  LLRAAGLSGDD--LKSLAHVFKDASSHFCAR-LKQGSAAAFDAETGSVESTDKTAFNDIF 76

Query: 78  KENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKR 137
            +  + +      W  + ++     LV +++E + GA     P   +R    VE+K+A  
Sbjct: 77  DKAAIITPLKAERWGCSLYLALDAVLVFSVIEAMFGAQGNLGPVDADRPFGMVEQKIANL 136

Query: 138 TIAQISAVLNQCISTTQESS-PNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASS 196
               ++  L++  +T+         D  D     +    LS  F  T  + +T       
Sbjct: 137 LAGHLAGALDRVFNTSSSQPLFAPGDCIDTADFDRENFELSRLF--TCRIAVTAAGKTGQ 194

Query: 197 FVLIIPQETLLKTTLISLSSQNKSENQSED-LIDPFARKTYQLNVNIDTRINLKKTTLKD 255
             L++P+ T         +   +  +Q++        +   +  + ++  +     +L  
Sbjct: 195 MHLLLPRSTHKPMQDAVAAFLRRPMDQADPAWAKKLRQGVSRARIELEAFMQQGSMSLDA 254

Query: 256 VVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFL 315
           +  L+IGQV+           L A  ++++ C LG+ G ++T+++ D +N ++  +   +
Sbjct: 255 LSRLEIGQVLKLPVDAMEQVRLRAGNQQLFKCTLGKSGIHFTVKVGDPVNQEEDLIDELV 314

Query: 316 H 316
            
Sbjct: 315 A 315


>gi|90411030|ref|ZP_01219044.1| flagellar motor switch protein [Photobacterium profundum 3TCK]
 gi|90328243|gb|EAS44554.1| flagellar motor switch protein [Photobacterium profundum 3TCK]
          Length = 348

 Score =  200 bits (508), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 38/277 (13%), Positives = 93/277 (33%), Gaps = 19/277 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       +    ++S    Q  KF    ++       +            I  
Sbjct: 57  ERFARHMRISLFNMLRKTAEVSINGVQMIKFGEYQNTLYVPTSLNMVRFRPLKGTALITM 116

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  +     +  S        
Sbjct: 117 EARLVFILVENFFGGDGRFHAKIEGREFTPTERRIVQMLLKLVFEDYREAWSPVMGVE-- 174

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F +++P   +++     
Sbjct: 175 ------FEYLDSEVNPTMANIVSPTEVIVVSSFHIEVDGGGGDFHVVMPYS-MVEPIREL 227

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+   +D         +   + VN+  ++     +L+D++ L+ G +IP    E
Sbjct: 228 LDAGVQSDKMDKDVRWSMALREEIMDVPVNLRAKLLDVDLSLRDLMELQAGDIIPIDVPE 287

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
                        Y  ++G+ G N  ++IT ++    
Sbjct: 288 SATV--FVEDLPTYRAKMGKSGDNIALKITQKLKRPD 322


>gi|209695733|ref|YP_002263663.1| flagellar motor switch protein FliM [Aliivibrio salmonicida
           LFI1238]
 gi|208009686|emb|CAQ79985.1| polar flagellar switch protein FliM (flagellar motor switch protein
           FliM) [Aliivibrio salmonicida LFI1238]
          Length = 343

 Score =  200 bits (508), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 38/277 (13%), Positives = 97/277 (35%), Gaps = 19/277 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       +    ++S       KF    ++       +            +  
Sbjct: 58  ERFARHMRISLFNMLRKTAEVSINGVSMVKFGEYQNTLYVPTSLNMVRFRPLKGTALVTM 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  +     +  S        
Sbjct: 118 EARLVFILVENFFGGDGRFHAKIEGREFTPTERRIIQLLLKVVFEDYKEAWSPVMGVE-- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F ++ P   +++     
Sbjct: 176 ------FEYLDSEVNPTMANIVSPTEVIVVSSFHIEVDGGGGDFHVVFPYS-MVEPIREL 228

Query: 214 LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRIN--LKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D+    A +   ++V ++ ++N    + +L+D++ L+ G +IP    E
Sbjct: 229 LDAGVQSDKMDTDVRWSKALRDEIMDVPVEMKVNLLESEISLRDLMDLQAGDIIPIEMPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
              A +       Y  ++G+ G    ++IT++I    
Sbjct: 289 --AATVFVEDLPTYRGKVGKSGDKLAVQITEKIKRPD 323


>gi|262276388|ref|ZP_06054197.1| flagellar motor switch protein FliM [Grimontia hollisae CIP 101886]
 gi|262220196|gb|EEY71512.1| flagellar motor switch protein FliM [Grimontia hollisae CIP 101886]
          Length = 353

 Score =  199 bits (507), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 43/304 (14%), Positives = 102/304 (33%), Gaps = 25/304 (8%)

Query: 19  ARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFK 78
            R+    G   T+E I+       +  L  + ++      ++S    Q  KF    ++  
Sbjct: 44  DRIVR--GRMPTLELINERFARHMRISLFNMIRK----TAEVSINGVQMVKFGEYQNTLF 97

Query: 79  ENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRT 138
                +            I     LV  L+EN  G       ++  R  +  E+++ +  
Sbjct: 98  VPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRFHARIEGREFTPTERRVIQML 157

Query: 139 IAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIEN 192
           +  I        +               +YL    N          E +   + ++ ++ 
Sbjct: 158 LKLIFEDYKDAWAPVMRVE--------FEYLDSEVNPAMANIVSPTEVIVVSSFHIELDG 209

Query: 193 VASSFVLIIPQETLLKTTLISLSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKK 250
               F +++P   +++     L +  +S+    D         +   + V++  ++    
Sbjct: 210 GGGDFHVVMPYS-MVEPIRELLDAGIQSDKMDTDKRWSKALQDEVMDVEVSLTAKLLETT 268

Query: 251 TTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
            +L+D++ ++ G VIP          +       +  +LG+   N  I+ITD++   +  
Sbjct: 269 LSLRDLMEMEAGDVIPVKMP--DACTVYIEDLPTFRGKLGQSNDNLAIKITDKLKRPEVM 326

Query: 311 LKNF 314
             + 
Sbjct: 327 KSDV 330


>gi|153011533|ref|YP_001372747.1| surface presentation of antigens (SPOA) protein [Ochrobactrum
           anthropi ATCC 49188]
 gi|151563421|gb|ABS16918.1| surface presentation of antigens (SPOA) protein [Ochrobactrum
           anthropi ATCC 49188]
          Length = 317

 Score =  199 bits (507), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 48/300 (16%), Positives = 109/300 (36%), Gaps = 6/300 (2%)

Query: 18  LARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSF 77
           L R  G  GD   ++ ++         F     K       D+     +S   +      
Sbjct: 22  LLRAAGLSGDD--LKSLAHVFKDASTHFC-DRLKHGCAAAFDVEAGQVESTDDAAFADIL 78

Query: 78  KENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKR 137
            +  + +      W S  ++     LV +++E + GA         +R    +E+K++  
Sbjct: 79  DKAAIIAPLKAERWGSTLYLTADATLVFSVIEAMYGAQGHVGSVDEDRPFGMLEQKISAL 138

Query: 138 TIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSF 197
               +++ L+Q  +   ++     +  D     +     S  F   I+  +T        
Sbjct: 139 LAGHLASSLDQVFAANGQALFTAGECTDTAEFDRENFERSRLFACRID--VTAAGKTGQV 196

Query: 198 VLIIPQETLLKTTLISLSSQNKSENQ-SEDLIDPFARKTYQLNVNIDTRINLKKTTLKDV 256
            L++P+ T         +   +  NQ          ++  +  + ++  I     TL  +
Sbjct: 197 HLLLPRSTHKPMQDAVAAFLRRPMNQTDPSWAKKMRQEVSRARIELEAFIQQGSMTLDAL 256

Query: 257 VTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLH 316
             L+IGQV+           L A  ++++ C LG+ G ++T+++ D +N ++  +   + 
Sbjct: 257 SMLEIGQVLKLPVDAMKQVRLRAGDQQLFKCTLGKSGIHFTVKVGDPVNQEEDFIDELVA 316


>gi|306837356|ref|ZP_07470235.1| surface presentation of antigens (SPOA) protein [Brucella sp. NF
           2653]
 gi|306407548|gb|EFM63748.1| surface presentation of antigens (SPOA) protein [Brucella sp. NF
           2653]
          Length = 348

 Score =  199 bits (506), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 49/301 (16%), Positives = 112/301 (37%), Gaps = 7/301 (2%)

Query: 18  LARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSF 77
           L R  G  GD   ++ ++         F  +  K+      D      +S   +     F
Sbjct: 52  LLRAAGLSGDD--LKSLAHVFKDASSHFCAR-LKQGSAAAFDAEAGPVESTDKTAFNDIF 108

Query: 78  KENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKR 137
            +  + +      W  + ++     LV +++E + GA     P   +R    VE+K+A  
Sbjct: 109 DKAAIITPLKAERWGCSLYLTLDAVLVFSVIEAMFGAQGNLGPVDGDRPFGMVEQKIANL 168

Query: 138 TIAQISAVLNQCISTTQESS-PNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASS 196
               ++  L++  +T          D  D     +    LS  F  T  + +T       
Sbjct: 169 LAGHLADALDRVFNTGSSQPLFAPGDCIDTADFDRENFELSRLF--TCRIAVTAAGKTGQ 226

Query: 197 FVLIIPQETLLKTTLISLSSQNKSENQSED-LIDPFARKTYQLNVNIDTRINLKKTTLKD 255
             L++P+ T         +   +  +Q++        ++  +  + ++  +     +L  
Sbjct: 227 MHLLLPRSTHKPMQDAVAAFLRRPMDQADPAWAKKLRQEVSRARIELEAFMQQGSMSLDA 286

Query: 256 VVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFL 315
           +  L+IGQV+             A  ++++ C LG+ G ++T+++ D +N ++  +   +
Sbjct: 287 LSRLEIGQVLKLPVDAMEQVRPRAGNQQLFKCTLGKSGIHFTVKVGDPVNQEEDFIDELV 346

Query: 316 H 316
            
Sbjct: 347 A 347


>gi|17989455|ref|NP_542088.1| flagellar motor switch protein FLIM [Brucella melitensis bv. 1 str.
           16M]
 gi|256043048|ref|ZP_05445993.1| flagellar motor switch protein FLIM [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256111966|ref|ZP_05452917.1| flagellar motor switch protein FLIM [Brucella melitensis bv. 3 str.
           Ether]
 gi|260564280|ref|ZP_05834765.1| flagellar motor switch protein FliM [Brucella melitensis bv. 1 str.
           16M]
 gi|265989486|ref|ZP_06102043.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265993415|ref|ZP_06105972.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|17985334|gb|AAL54352.1| flagellar motor switch protein flim [Brucella melitensis bv. 1 str.
           16M]
 gi|260151923|gb|EEW87016.1| flagellar motor switch protein FliM [Brucella melitensis bv. 1 str.
           16M]
 gi|262764285|gb|EEZ10317.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263000155|gb|EEZ12845.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 316

 Score =  199 bits (505), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 50/301 (16%), Positives = 114/301 (37%), Gaps = 7/301 (2%)

Query: 18  LARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSF 77
           L R  G  GD   ++ ++         F  +  K+      D    S +S   +     F
Sbjct: 20  LLRAAGLSGDD--LKSLAHVFKDASSHFCAR-LKQGSAAAFDAETGSVESTDKTAFNDIF 76

Query: 78  KENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKR 137
            +  + +      W  + ++     LV +++E + GA     P   +     VE+K+A  
Sbjct: 77  DKAAIITPLKAERWGCSLYLALDAVLVFSVIEAMFGAQGNLGPVDADHPFGMVEQKIANL 136

Query: 138 TIAQISAVLNQCISTTQESS-PNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASS 196
               ++  L++  +T+         D  D     +    LS  F  T  + +T       
Sbjct: 137 LAGHLAGALDRVFNTSSSQPLFAPGDCIDTADFDRENFELSRLF--TCRIAVTAAGKTGQ 194

Query: 197 FVLIIPQETLLKTTLISLSSQNKSENQSED-LIDPFARKTYQLNVNIDTRINLKKTTLKD 255
             L++P+ T         +   +  +Q++        ++  +  + ++  +     +L  
Sbjct: 195 MHLLLPRSTHKPMQDAVAAFLRRPMDQADPAWAKKLRQEVSRARIELEAFMQQGSMSLDA 254

Query: 256 VVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFL 315
           +  L+IGQV+           L A  ++++ C LG+ G ++T+++ D +N ++  +   +
Sbjct: 255 LSRLEIGQVLKLPVDAMEQVRLRAGNQQLFKCTLGKSGIHFTVKVGDPVNQEEDLIDELV 314

Query: 316 H 316
            
Sbjct: 315 A 315


>gi|59712452|ref|YP_205228.1| flagellar motor switch protein FliM [Vibrio fischeri ES114]
 gi|197335836|ref|YP_002156671.1| flagellar motor switch protein FliM [Vibrio fischeri MJ11]
 gi|59480553|gb|AAW86340.1| flagellar motor switch protein FliM [Vibrio fischeri ES114]
 gi|197317326|gb|ACH66773.1| flagellar motor switch protein FliM [Vibrio fischeri MJ11]
          Length = 344

 Score =  198 bits (503), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 39/277 (14%), Positives = 96/277 (34%), Gaps = 19/277 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       +    ++S       KF    ++       +            +  
Sbjct: 58  ERFARHMRISLFNMLRKTAEVSINGVSMVKFGEYQNTLYVPTSLNMVRFRPLKGTALVTM 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  I     +  S        
Sbjct: 118 EARLVFILVENFFGGDGRFHAKIEGREFTPTERRIIQLLLKVIFEDYKEAWSPVMGVE-- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F ++ P   +++     
Sbjct: 176 ------FEYLDSEVNPTMANIVSPTEVIVVSSFHIEVDGGGGDFHVVFPYS-MVEPIREL 228

Query: 214 LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRIN--LKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D+    A +   ++V ++ ++N    + +L+D++ L+ G +IP    E
Sbjct: 229 LDAGVQSDKMDTDVRWSKALRDEIMDVPVEMKVNLLESQISLRDLMELEAGDIIPVEMPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
              A +       Y  ++G+      I+IT++I    
Sbjct: 289 --AATVFVEDLPTYRGKVGQSNDKLAIQITEKIKRPD 323


>gi|307824486|ref|ZP_07654711.1| flagellar motor switch protein FliM [Methylobacter tundripaludum
           SV96]
 gi|307734470|gb|EFO05322.1| flagellar motor switch protein FliM [Methylobacter tundripaludum
           SV96]
          Length = 331

 Score =  198 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 50/271 (18%), Positives = 96/271 (35%), Gaps = 16/271 (5%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + +F+       +    +I  +  Q  KFS  I         +    +       I  
Sbjct: 69  ERFARFIRISLFNFLRRSAEIFISGIQVQKFSEYIQGLLVPTNLTIVRFNPLRGKALIVI 128

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV T+++N  G + +   Q   R  +  E ++ +  I  I   L +      E    
Sbjct: 129 DPRLVFTVVDNFFGGAGQFYNQTEGREFTPTEMRVVRIIIDMIFKDLKEAWKPVMEL--- 185

Query: 160 LEDFYDIDYLKKNTNRL------SNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                D +Y+    N          E +    +++ +E       + +P   L     + 
Sbjct: 186 -----DFEYVGAEINPRFANIIGPGEIIVISTIHVELEGGGGDVNIAMPYAMLEPIRELL 240

Query: 214 LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKT 273
            +  + S             +  +  V+I++ +  K  T++DV+ LK G VIP       
Sbjct: 241 DAISSDSGEVDGGWQAALRGEVLRAEVSINSLLVEKNMTIRDVMRLKKGDVIPIDMP--D 298

Query: 274 CAILSANGKEIYSCELGRVGKNYTIRITDRI 304
             IL A G  ++  ++G    NY I+I D++
Sbjct: 299 TVILKAEGIPVFEGKVGISDGNYAIQIIDKV 329


>gi|332994114|gb|AEF04169.1| flagellar motor switch protein FliM [Alteromonas sp. SN2]
          Length = 352

 Score =  197 bits (502), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 43/276 (15%), Positives = 93/276 (33%), Gaps = 19/276 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       M    ++S    Q  KF   IH+       +            I  
Sbjct: 58  ERFARHMRVSLFNMMRRSAEVSINGIQMIKFGEYIHTLFVPTSLNMVRFRPLKGTGLITM 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E+++ +  +  I     +  +   + S  
Sbjct: 118 EARLVFILVDNFFGGDGRYHAKIEGREFTPTERRIIQMLLKIIFEDYKEAWAPVMDVS-- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E V   + ++ ++     F + +P   +L+     
Sbjct: 176 ------FEYLDSEVNPAMANIVSPTEVVVISSFHIELDGGGGDFHVSLPYS-MLEPIREL 228

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+ +  D         +   + V + T +     +L+ V+  K G++IP    E
Sbjct: 229 LDAGVQSDKEDTDLRWSKALRDEIMDVKVALTTHMLDVDVSLRQVMEFKPGEIIPVEMPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
               +        +  +LGR   N  ++I ++I   
Sbjct: 289 TITVL--IEDLPTFRAKLGRSRDNLALKIVEKIARP 322


>gi|163801852|ref|ZP_02195749.1| flagellar motor switch protein M [Vibrio sp. AND4]
 gi|159174360|gb|EDP59164.1| flagellar motor switch protein M [Vibrio sp. AND4]
          Length = 348

 Score =  197 bits (502), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 47/309 (15%), Positives = 103/309 (33%), Gaps = 25/309 (8%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
           +NT+        R+    G   T+E I+       +  L  + ++      ++S    Q 
Sbjct: 32  ENTTNFDFSSQDRIVR--GRMPTLELINERFARHMRISLFNMLRK----TAEVSINGVQM 85

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSL 127
            KF    ++       +            I     LV  L+EN  G       ++  R  
Sbjct: 86  MKFGEYQNTLYVPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRFHAKIEGREF 145

Query: 128 STVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNR------LSNEFV 181
           +  E+++ +  +  +     +  S               +YL    N          E +
Sbjct: 146 TPTERRIIQLLLKIVFEDYKEAWSPVMGVE--------FEYLDSEVNPSMANIVSPTEVI 197

Query: 182 TTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSED--LIDPFARKTYQLN 239
              + ++ ++     F +++P   +++     L +  +S+    D         +     
Sbjct: 198 VVSSFHIEVDGGGGDFHVVMPYS-MVEPIRELLDAGVQSDKMETDVRWSSALREEIMDCP 256

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           VN    +  K  +L+D++ L+ G VIP    E   A +       Y  ++GR      ++
Sbjct: 257 VNFRVNLLEKDISLRDLMELQPGDVIPIDMPEN--ATMFIEDLPTYRVKMGRSEDKLAVQ 314

Query: 300 ITDRINFDQ 308
           +++ I    
Sbjct: 315 VSEEIERPH 323


>gi|225685986|ref|YP_002733958.1| Flagellar motor switch protein fliM [Brucella melitensis ATCC
           23457]
 gi|256262888|ref|ZP_05465420.1| flagellar motor switch protein FliM [Brucella melitensis bv. 2 str.
           63/9]
 gi|225642091|gb|ACO02004.1| Flagellar motor switch protein fliM [Brucella melitensis ATCC
           23457]
 gi|263092725|gb|EEZ16934.1| flagellar motor switch protein FliM [Brucella melitensis bv. 2 str.
           63/9]
 gi|326410312|gb|ADZ67376.1| Flagellar motor switch protein fliM [Brucella melitensis M28]
 gi|326553605|gb|ADZ88244.1| Flagellar motor switch protein fliM [Brucella melitensis M5-90]
          Length = 316

 Score =  197 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 50/301 (16%), Positives = 113/301 (37%), Gaps = 7/301 (2%)

Query: 18  LARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSF 77
           L R  G  GD   ++ ++         F  +  K+      D    S +S         F
Sbjct: 20  LLRAAGLSGDD--LKSLAHVFKDASSHFCAR-LKQGSAAAFDAETGSVESTDKMAFNDIF 76

Query: 78  KENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKR 137
            +  + +      W  + ++     LV +++E + GA     P   +     VE+K+A  
Sbjct: 77  DKAAIITPLKAERWGCSLYLALDAVLVFSVIEAMFGAQGNLGPVDADHPFGMVEQKIANL 136

Query: 138 TIAQISAVLNQCISTTQESS-PNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASS 196
               ++  L++  +T+         D  D     +    LS  F  T  + +T       
Sbjct: 137 LAGHLAGALDRVFNTSSSQPLFAPGDCIDTADFDRENFELSRLF--TCRIAVTAAGKTGQ 194

Query: 197 FVLIIPQETLLKTTLISLSSQNKSENQSED-LIDPFARKTYQLNVNIDTRINLKKTTLKD 255
             L++P+ T         +   +  +Q++        ++  +  + ++  +     +L  
Sbjct: 195 MHLLLPRSTHKPMQDAVAAFLRRPMDQADPAWAKKLRQEVSRARIELEAFMQQGSMSLDA 254

Query: 256 VVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFL 315
           +  L+IGQV+           L A  ++++ C LG+ G ++T+++ D +N ++  +   +
Sbjct: 255 LSRLEIGQVLKLPVDAMEQVRLRAGNQQLFKCTLGKSGIHFTVKVGDPVNQEEDLIDELV 314

Query: 316 H 316
            
Sbjct: 315 A 315


>gi|254720632|ref|ZP_05182443.1| hypothetical protein Bru83_14198 [Brucella sp. 83/13]
 gi|265985676|ref|ZP_06098411.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|264664268|gb|EEZ34529.1| conserved hypothetical protein [Brucella sp. 83/13]
          Length = 316

 Score =  197 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 49/301 (16%), Positives = 112/301 (37%), Gaps = 7/301 (2%)

Query: 18  LARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSF 77
           L R  G  GD   ++ ++         F  +  K+      D      +S   +     F
Sbjct: 20  LLRAAGLSGDD--LKSLAHVFKDASSHFCAR-LKQGSAAAFDAEAGPVESTDKTAFNDIF 76

Query: 78  KENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKR 137
            +  + +      W  + ++     LV +++E + GA     P   +R    VE+K+A  
Sbjct: 77  DKAAIITPLKAERWGCSLYLTLDAVLVFSVIEAMFGAQGNLGPVDGDRPFGMVEQKIANL 136

Query: 138 TIAQISAVLNQCISTTQESS-PNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASS 196
               ++  L++  +T          D  D     +    LS  F  T  + +T       
Sbjct: 137 LAGHLADALDRVFNTGSSQPLFAPGDCIDTADFDRENFELSRLF--TCRIAVTAAGKTGQ 194

Query: 197 FVLIIPQETLLKTTLISLSSQNKSENQSED-LIDPFARKTYQLNVNIDTRINLKKTTLKD 255
             L++P+ T         +   +  +Q++        ++  +  + ++  +     +L  
Sbjct: 195 MHLLLPRSTHKPMQDAVAAFLRRPMDQADPAWAKKLRQEVSRARIELEAFMQQGSMSLDA 254

Query: 256 VVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFL 315
           +  L+IGQV+             A  ++++ C LG+ G ++T+++ D +N ++  +   +
Sbjct: 255 LSRLEIGQVLKLPVDAMEQVRPRAGNQQLFKCTLGKSGIHFTVKVGDPVNQEEDFIDELV 314

Query: 316 H 316
            
Sbjct: 315 A 315


>gi|323491452|ref|ZP_08096636.1| flagellar motor switch protein FliM [Vibrio brasiliensis LMG 20546]
 gi|323314321|gb|EGA67401.1| flagellar motor switch protein FliM [Vibrio brasiliensis LMG 20546]
          Length = 349

 Score =  197 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 38/277 (13%), Positives = 96/277 (34%), Gaps = 19/277 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       +    ++S    Q  KF    ++       +            I  
Sbjct: 58  ERFARHMRISLFNMLRKTAEVSINGVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALITM 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  +     +  S        
Sbjct: 118 EARLVFILVENFFGGDGRFHARIEGREFTPTERRIVQLLLKIVFEDYKEAWSPVMGVE-- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F +++P   +++     
Sbjct: 176 ------FEYLDSEVNPSMANIVSPTEVIVVSSFHIEVDGGGGDFHVVMPYS-MVEPIREL 228

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         +   + VN    +  +  +L+D++ L+ G +IP    E
Sbjct: 229 LDAGVQSDKMETDVRWSTALREEIMDVPVNFRVDLLEQDISLRDLMELQPGDIIPVTMPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
              A++       +  ++GR G+N  ++++++I    
Sbjct: 289 H--AVMFVEELPTFRVKMGRSGENLAVQVSEKIKRPD 323


>gi|323496548|ref|ZP_08101602.1| flagellar motor switch protein FliM [Vibrio sinaloensis DSM 21326]
 gi|323318392|gb|EGA71349.1| flagellar motor switch protein FliM [Vibrio sinaloensis DSM 21326]
          Length = 349

 Score =  197 bits (500), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 38/277 (13%), Positives = 95/277 (34%), Gaps = 19/277 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       +    ++S    Q  KF    ++       +            I  
Sbjct: 58  ERFARHMRISLFNMLRKTAEVSINGVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALITM 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  +     +  S        
Sbjct: 118 EARLVFILVENFFGGDGRFHARIEGREFTPTERRIVQLLLKIVFEDYKEAWSPVMGVE-- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F +++P   +++     
Sbjct: 176 ------FEYLDSEVNPSMANIVSPTEVIVVSSFHIEVDGGGGDFHVVMPYS-MVEPIREL 228

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         +   + VN    +  +  +L+D++ L+ G +IP    E
Sbjct: 229 LDAGVQSDKMETDVRWSTALREEIMDVPVNFRVNLLEQDISLRDLMELQPGDIIPITMPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
              A +       +  ++GR G+N  ++++++I    
Sbjct: 289 H--ATMFVEELPTFRVKMGRSGENLAVQVSEKIKRPD 323


>gi|88813208|ref|ZP_01128448.1| flagellar motor switch protein [Nitrococcus mobilis Nb-231]
 gi|88789530|gb|EAR20657.1| flagellar motor switch protein [Nitrococcus mobilis Nb-231]
          Length = 336

 Score =  197 bits (500), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 44/272 (16%), Positives = 99/272 (36%), Gaps = 9/272 (3%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       +    ++S    +  KFS  +H+       +   +           
Sbjct: 60  ERFARLLRTGLFNMLRKTAEVSVVGVELLKFSEYVHTLYLPTSLNLVKVPPLRGTGLCVL 119

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ ++ + Q  A L +  +        
Sbjct: 120 DPKLVFILVDNFFGGDGRYFSKIEGREFTPTETRVIRKVLEQGFADLREAWNPVLPVDF- 178

Query: 160 LEDFYDIDYLKKNTN-RLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQN 218
             +F +++   +  N    +E V     ++ +        + +P  T+++     LS+  
Sbjct: 179 --EFLNMEVNPQFANIVSPSEAVVVSRFHVELNGGGGDLHITLPY-TMIEPVRDVLSAGV 235

Query: 219 KSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAI 276
           +S+    D   +     +     V +  R+   + +L +++ L+ G +IP    E    +
Sbjct: 236 QSDRNDVDQRWVRSLREEMKSAPVRLSCRLTEARVSLHELMRLQPGDIIPIEMPE--TVV 293

Query: 277 LSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
           L A    +    LG  G N  ++IT+ I   Q
Sbjct: 294 LRAAEVPVLRGRLGCSGGNVAVKITEPIRAPQ 325


>gi|229522079|ref|ZP_04411496.1| flagellar motor switch protein FliM [Vibrio cholerae TM 11079-80]
 gi|229341004|gb|EEO06009.1| flagellar motor switch protein FliM [Vibrio cholerae TM 11079-80]
          Length = 349

 Score =  197 bits (500), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 43/277 (15%), Positives = 103/277 (37%), Gaps = 19/277 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       +    ++S    Q  KF    ++       +            +  
Sbjct: 58  ERFARHLRISLFNMLRKTAEVSINGVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALVTM 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  + A   +  S        
Sbjct: 118 EARLVFILVENFFGGDGRYHARIEGREFTPTERRVIQLLLKIVFADYKEAWSPVMGVE-- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F +++P   +++     
Sbjct: 176 ------FEYLDSEVNPSMANIVSPTEVIVVSSFHVEVDGGGGDFHMVMPYS-MVEPIREL 228

Query: 214 LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT--TLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D+    A +   ++V ++ R+NL +    L+D++ L++G VIP    E
Sbjct: 229 LDAGVQSDKMETDVRWSTALREEIMDVPVNFRVNLLEMDIALRDLMELQVGDVIPIKMPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
              A++       Y  ++GR G+   ++++++I    
Sbjct: 289 H--AVMFVEDLPTYRVKMGRSGEKLAVQVSEKIKRPD 323


>gi|148976420|ref|ZP_01813126.1| flagellar motor switch protein M [Vibrionales bacterium SWAT-3]
 gi|145964243|gb|EDK29499.1| flagellar motor switch protein M [Vibrionales bacterium SWAT-3]
          Length = 347

 Score =  197 bits (500), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 40/277 (14%), Positives = 94/277 (33%), Gaps = 19/277 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       +    ++S    Q  KF    ++       +            I  
Sbjct: 58  ERFSRHMRISLFNMLRKTAEVSINGVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALITM 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  +     +  S        
Sbjct: 118 EARLVFILVENFFGGDGRFHAKIEGREFTPTERRIIQLLLKIVFEDYKEAWSPVMGVE-- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F +++P   +++     
Sbjct: 176 ------FEYLDSEVNPSMANIVSPTEVIVVSSFHIEVDGGGGDFHVVMPYS-MVEPIREL 228

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         +   + VN    +  +  +L+D++ L+ G VIP    E
Sbjct: 229 LDAGVQSDKMETDVRWSTALRDEIMDVPVNFRVNLLEQDISLRDLMELRPGDVIPMNMPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
              A +       Y  ++GR G+   ++I+++I    
Sbjct: 289 H--ATMFVEELPTYRVKMGRSGEKLAVQISEKIQRPH 323


>gi|91223552|ref|ZP_01258817.1| flagellar motor switch protein M [Vibrio alginolyticus 12G01]
 gi|269965696|ref|ZP_06179809.1| flagellar motor switch protein [Vibrio alginolyticus 40B]
 gi|91191638|gb|EAS77902.1| flagellar motor switch protein M [Vibrio alginolyticus 12G01]
 gi|269829764|gb|EEZ84000.1| flagellar motor switch protein [Vibrio alginolyticus 40B]
          Length = 348

 Score =  196 bits (499), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 39/277 (14%), Positives = 90/277 (32%), Gaps = 19/277 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       +    ++S    Q  KF    ++       +            I  
Sbjct: 58  ERFARHMRISLFNMLRKTAEVSINGVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALITM 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  +     +  S        
Sbjct: 118 EARLVFILVENFFGGDGRFHAKIEGREFTPTERRIIQLLLKIVFEDYKEAWSPVMGVE-- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F +++P   +++     
Sbjct: 176 ------FEYLDSEVNPSMANIVSPTEVIVVSSFHIEVDGGGGDFHVVMPYS-MVEPIREL 228

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         +     VN    +  K  +L+D++ L+ G +IP    E
Sbjct: 229 LDAGVQSDKMETDVRWSSALREEIMDCPVNFRVNLLEKDISLRDLMELQPGDIIPIEMPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
              A +       Y  ++GR      ++I++ I    
Sbjct: 289 H--ATMFVEDLPTYRVKMGRSEDKLAVQISEEIERPH 323


>gi|254228441|ref|ZP_04921867.1| flagellar motor switch protein FliM [Vibrio sp. Ex25]
 gi|262393595|ref|YP_003285449.1| flagellar motor switch protein FliM [Vibrio sp. Ex25]
 gi|151939029|gb|EDN57861.1| flagellar motor switch protein FliM [Vibrio sp. Ex25]
 gi|262337189|gb|ACY50984.1| flagellar motor switch protein FliM [Vibrio sp. Ex25]
          Length = 348

 Score =  196 bits (499), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 39/277 (14%), Positives = 90/277 (32%), Gaps = 19/277 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       +    ++S    Q  KF    ++       +            I  
Sbjct: 58  ERFARHMRISLFNMLRKTAEVSINGVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALITM 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  +     +  S        
Sbjct: 118 EARLVFILVENFFGGDGRFHAKIEGREFTPTERRIIQLLLKIVFEDYKEAWSPVMGVE-- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F +++P   +++     
Sbjct: 176 ------FEYLDSEVNPSMANIVSPTEVIVVSSFHIEVDGGGGDFHVVMPYS-MVEPIREL 228

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         +     VN    +  K  +L+D++ L+ G +IP    E
Sbjct: 229 LDAGVQSDKMETDVRWSSALREEIMDCPVNFRVNLLEKDISLRDLMELQPGDIIPIEMPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
              A +       Y  ++GR      ++I++ I    
Sbjct: 289 H--ATMFVEDLPTYRVKMGRSEDKLAVQISEEIERPH 323


>gi|254785477|ref|YP_003072906.1| flagellar motor switch protein FliM [Teredinibacter turnerae T7901]
 gi|237685691|gb|ACR12955.1| flagellar motor switch protein FliM [Teredinibacter turnerae T7901]
          Length = 332

 Score =  196 bits (498), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 45/277 (16%), Positives = 104/277 (37%), Gaps = 20/277 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D+S    Q  KF   +H+       +            I  
Sbjct: 57  ERFARYTRISMFNLLRRTADVSVGGIQIQKFGEYVHTLYVPTSLNMVKFRPLRGTALIIL 116

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q+   L++     +     
Sbjct: 117 DAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVQMVLEQVFVDLHEAWKAVK----- 170

Query: 160 LEDFYDIDYLKKNTNR-LSN-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                D +Y+    N  ++N     E V     ++ ++       + +P   +++     
Sbjct: 171 ---LIDFEYINSEVNPSMANIVSPSEVVVVSTFHVELDGGGGELHITMPYS-MVEPIREI 226

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D   +        +  V+++  +  +  TL+++V LK+G +IP    E
Sbjct: 227 LDAGLQSDTDERDDRWVQALREDVMRARVDLECDVVRRDITLREIVDLKVGDIIPVTMPE 286

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
               I +ANG  ++  ++G+   N  +RI D ++  +
Sbjct: 287 --VHIATANGVPMFQAKIGQCNNNLALRILDYVDRTR 321


>gi|218508217|ref|ZP_03506095.1| flagellar C-ring motor switch protein [Rhizobium etli Brasil 5]
          Length = 188

 Score =  196 bits (498), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 55/187 (29%), Positives = 97/187 (51%)

Query: 130 VEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMT 189
           +E  LA     +I+ VL   ++      P+L   +  D   +      +EF   INM++T
Sbjct: 2   IELDLAVMVFDKIANVLRSAVNAPGGFEPSLSAPHAPDARPRPPEDKPDEFAAAINMSLT 61

Query: 190 IENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLK 249
           +  + S F LI+PQ  LLKT + +   + ++   S +  +    +  + +V ++ RI L+
Sbjct: 62  LAGIVSEFSLIVPQTALLKTKVTAPKPKRQAAGASPEWTEQLGDQVRRSHVTLEARIRLQ 121

Query: 250 KTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
             TL+ +  L +G VIPF         +SAN KE+Y CE GR G+NY +R+ D +N D +
Sbjct: 122 DLTLRTISKLMVGDVIPFRDSGDVRVEVSANSKELYVCEFGRSGENYMVRVKDTMNSDDE 181

Query: 310 SLKNFLH 316
            +++ ++
Sbjct: 182 LIRHLMN 188


>gi|86146129|ref|ZP_01064455.1| flagellar motor switch protein [Vibrio sp. MED222]
 gi|218708830|ref|YP_002416451.1| flagellar motor switch protein FliM [Vibrio splendidus LGP32]
 gi|85836076|gb|EAQ54208.1| flagellar motor switch protein [Vibrio sp. MED222]
 gi|218321849|emb|CAV17824.1| Flagellar motor switch protein fliM [Vibrio splendidus LGP32]
          Length = 347

 Score =  196 bits (498), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 40/277 (14%), Positives = 94/277 (33%), Gaps = 19/277 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       +    ++S    Q  KF    ++       +            I  
Sbjct: 58  ERFARHMRISLFNMLRKTAEVSINGVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALITM 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  +     +  S        
Sbjct: 118 EARLVFILVENFFGGDGRFHAKIEGREFTPTERRIIQLLLKIVFEDYKEAWSPVMGVE-- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F +++P   +++     
Sbjct: 176 ------FEYLDSEVNPSMANIVSPTEVIVVSSFHIEVDGGGGDFHVVMPYS-MVEPIREL 228

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         +   + VN    +  +  +L+D++ L+ G VIP    E
Sbjct: 229 LDAGVQSDKMETDVRWSSALRDEIMDVPVNFRVNLLEQDISLRDLMELRPGDVIPMNMPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
              A +       Y  ++GR G+   ++I+++I    
Sbjct: 289 H--ATMFVEELPTYRVKMGRSGEKLAVQISEKIERPH 323


>gi|84388118|ref|ZP_00991014.1| flagellar motor switch protein [Vibrio splendidus 12B01]
 gi|84377185|gb|EAP94055.1| flagellar motor switch protein [Vibrio splendidus 12B01]
          Length = 347

 Score =  196 bits (498), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 40/277 (14%), Positives = 94/277 (33%), Gaps = 19/277 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       +    ++S    Q  KF    ++       +            I  
Sbjct: 58  ERFARHMRISLFNMLRKTAEVSINGVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALITM 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  +     +  S        
Sbjct: 118 EARLVFILVENFFGGDGRFHAKIEGREFTPTERRIIQLLLKIVFEDYKEAWSPVMGVE-- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F +++P   +++     
Sbjct: 176 ------FEYLDSEVNPSMANIVSPTEVIVVSSFHIEVDGGGGDFHVVMPYS-MVEPIREL 228

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         +   + VN    +  +  +L+D++ L+ G VIP    E
Sbjct: 229 LDAGVQSDKMETDVRWSTALRDEIMDVPVNFRVNLLEQDISLRDLMELRPGDVIPMNMPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
              A +       Y  ++GR G+   ++I+++I    
Sbjct: 289 H--ATMFVEELPTYRVKMGRSGEKLAVQISEKIQRPH 323


>gi|260772330|ref|ZP_05881246.1| flagellar motor switch protein FliM [Vibrio metschnikovii CIP
           69.14]
 gi|260611469|gb|EEX36672.1| flagellar motor switch protein FliM [Vibrio metschnikovii CIP
           69.14]
          Length = 281

 Score =  196 bits (498), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 43/269 (15%), Positives = 99/269 (36%), Gaps = 19/269 (7%)

Query: 54  MDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLG 113
           +    ++S    Q  KF    ++       +            +     LV  L+EN  G
Sbjct: 2   LRKTAEVSINGVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALVTMEARLVFILVENFFG 61

Query: 114 ASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNT 173
                  ++  R  +  E+++ +  +  + A   +  S               +YL    
Sbjct: 62  GDGRYHARIEGREFTPTERRVIQLLLKIVFADYKEAWSPVMGVE--------FEYLDSEV 113

Query: 174 NR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDL 227
           N          E +   + ++ ++     F +++P   +++     L +  +S+    D+
Sbjct: 114 NPSMANIVSPTEVIVVCSFHIEVDGGGGDFHMVMPYS-MVEPIRELLDAGVQSDKMETDV 172

Query: 228 IDPFARKTYQLNVNIDTRIN--LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIY 285
               A +   ++V I+ R+N   +   L+D++ L++G +IP    E   AI+       Y
Sbjct: 173 RWSSALRDEIMDVPINFRVNLLEQDIALRDLMDLQVGDIIPIKMPEH--AIMFVEELPTY 230

Query: 286 SCELGRVGKNYTIRITDRINFDQKSLKNF 314
             ++GR G    ++I+ +I   +    + 
Sbjct: 231 RVKMGRSGDKLAVQISQKIKRPEAMKTDL 259


>gi|149188092|ref|ZP_01866387.1| flagellar motor switch protein M [Vibrio shilonii AK1]
 gi|148838080|gb|EDL55022.1| flagellar motor switch protein M [Vibrio shilonii AK1]
          Length = 349

 Score =  196 bits (498), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 39/277 (14%), Positives = 94/277 (33%), Gaps = 19/277 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       +    ++S    Q  KF    ++       +            I  
Sbjct: 58  ERFARHMRISLFNMLRKTAEVSINGVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALITM 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  +     +  S        
Sbjct: 118 EARLVFILVENFFGGDGRFHAKIEGREFTPTERRIIQLLMKTVFEDYKEAWSPVMGVE-- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F +++P   +++     
Sbjct: 176 ------FEYLDSEVNPSMANIVSPTEVIVVSSFHIEVDGGGGDFHVVMPYS-MVEPIREL 228

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         +   + VN    +  K  +L+D++ L+ G +IP    E
Sbjct: 229 LDAGVQSDKMETDVRWSSALREEIMDVPVNFRVNLLEKDVSLRDLMELQAGDIIPIDMPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
              A +       +  ++GR G+   ++I+++I    
Sbjct: 289 N--ATMFVEELPTFRVKMGRTGEKVAVQISEKIRRPD 323


>gi|269961627|ref|ZP_06175989.1| flagellar motor switch protein [Vibrio harveyi 1DA3]
 gi|269833668|gb|EEZ87765.1| flagellar motor switch protein [Vibrio harveyi 1DA3]
          Length = 348

 Score =  196 bits (497), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 40/277 (14%), Positives = 90/277 (32%), Gaps = 19/277 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       +    ++S    Q  KF    ++       +            I  
Sbjct: 58  ERFARHMRISLFNMLRKTAEVSINGVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALITM 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  +     +  S        
Sbjct: 118 EARLVFILVENFFGGDGRFHAKIEGREFTPTERRIIQLLLKIVFEDYKEAWSPVMGVE-- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F +++P   +++     
Sbjct: 176 ------FEYLDSEVNPSMANIVSPTEVIVVSSFHIEVDGGGGDFHVVMPYS-MVEPIREL 228

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         +     VN    +  K  +L+D++ L+ G VIP    E
Sbjct: 229 LDAGVQSDKMETDVRWSSALREEIMDCPVNFRVNLLEKDISLRDLMELQPGDVIPIEMPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
              A +       Y  ++GR      ++I++ I    
Sbjct: 289 H--ATMFIEDLPTYRVKMGRSEDKMAVQISEEIERPH 323


>gi|239834451|ref|ZP_04682779.1| surface presentation of antigens (SPOA) protein [Ochrobactrum
           intermedium LMG 3301]
 gi|239822514|gb|EEQ94083.1| surface presentation of antigens (SPOA) protein [Ochrobactrum
           intermedium LMG 3301]
          Length = 321

 Score =  196 bits (497), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 47/302 (15%), Positives = 107/302 (35%), Gaps = 10/302 (3%)

Query: 20  RLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKE 79
           R  G  GD   ++ ++         F     K       DI     +S   +       +
Sbjct: 24  RAAGLSGDD--LKSLAHVFKDASTHFC-DRLKHGCAAAFDIDAGQVESTDEAAFADILDK 80

Query: 80  NFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE----TIPQLYNRSLSTVEKKLA 135
             + +      W    ++     LV +++E + GA             +R    +E+K++
Sbjct: 81  AAIIAPLKAERWGCTLYLTADATLVFSVIEAMFGAQGNIGGNVGSVDEDRPFGMLEQKIS 140

Query: 136 KRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVAS 195
                 ++  L+Q  +   ++     +  D     +     S  F   I+  +T      
Sbjct: 141 ALLAGHLAKSLDQVFAGNGQTLFAAGECIDTAEFDRENFERSRLFACRID--VTAAGKTG 198

Query: 196 SFVLIIPQETLLKTTLISLSSQNKSENQSED-LIDPFARKTYQLNVNIDTRINLKKTTLK 254
              L++P+ T         +   +  NQ++         +  +  + ++  I     TL 
Sbjct: 199 RVHLLLPRSTHKPMQDAVAAFLRRPMNQADPSWAKKMRHEVSRARIELEAFIQQGSMTLD 258

Query: 255 DVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
            +  L+IGQV+           L A  ++++ C LG+ G ++T+++ D +N ++  +   
Sbjct: 259 ALSMLEIGQVLKLPADAMEQVRLRAGDQQLFKCTLGKSGIHFTVKVGDPVNQEEDFIDEL 318

Query: 315 LH 316
           + 
Sbjct: 319 VA 320


>gi|153834156|ref|ZP_01986823.1| flagellar motor switch protein FliM [Vibrio harveyi HY01]
 gi|156975423|ref|YP_001446330.1| flagellar motor switch protein FliM [Vibrio harveyi ATCC BAA-1116]
 gi|148869526|gb|EDL68524.1| flagellar motor switch protein FliM [Vibrio harveyi HY01]
 gi|156527017|gb|ABU72103.1| hypothetical protein VIBHAR_03154 [Vibrio harveyi ATCC BAA-1116]
          Length = 348

 Score =  196 bits (497), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 40/277 (14%), Positives = 90/277 (32%), Gaps = 19/277 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       +    ++S    Q  KF    ++       +            I  
Sbjct: 58  ERFARHMRISLFNMLRKTAEVSINGVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALITM 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  +     +  S        
Sbjct: 118 EARLVFILVENFFGGDGRFHAKIEGREFTPTERRIIQLLLKIVFEDYKEAWSPVMGVE-- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F +++P   +++     
Sbjct: 176 ------FEYLDSEVNPSMANIVSPTEVIVVSSFHIEVDGGGGDFHVVMPYS-MVEPIREL 228

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         +     VN    +  K  +L+D++ L+ G VIP    E
Sbjct: 229 LDAGVQSDKMETDVRWSSALREEIMDCPVNFRVNLLEKDISLRDLMELQPGDVIPIEMPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
              A +       Y  ++GR      ++I++ I    
Sbjct: 289 H--ATMFIEDLPTYRVKMGRSEDKMAVQISEEIERPH 323


>gi|262404472|ref|ZP_06081027.1| flagellar motor switch protein FliM [Vibrio sp. RC586]
 gi|262349504|gb|EEY98642.1| flagellar motor switch protein FliM [Vibrio sp. RC586]
          Length = 349

 Score =  195 bits (496), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 43/277 (15%), Positives = 102/277 (36%), Gaps = 19/277 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       +    ++S    Q  KF    ++       +            +  
Sbjct: 58  ERFARHLRISLFNMLRKTAEVSINGVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALVTM 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  + A   +  S        
Sbjct: 118 EARLVFILVENFFGGDGRYHARIEGREFTPTERRVIQLLLKIVFADYKEAWSPVMGVE-- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F +++P   + +     
Sbjct: 176 ------FEYLDSEVNPSMANIVSPTEVIVVSSFHVEVDGGGGDFHMVMPYSMM-EPIREL 228

Query: 214 LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT--TLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D+    A +   ++V ++ R+NL +    L+D++ L++G VIP    E
Sbjct: 229 LDAGVQSDKMETDVRWSTALREEIMDVPVNFRVNLLEMDIALRDLMELQVGDVIPIKMPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
              A++       Y  ++GR G+   ++++++I    
Sbjct: 289 H--AVMFVEELPTYRVKMGRSGEKLAVQVSEKIKRPD 323


>gi|254506968|ref|ZP_05119107.1| flagellar motor switch protein FliM [Vibrio parahaemolyticus 16]
 gi|219550253|gb|EED27239.1| flagellar motor switch protein FliM [Vibrio parahaemolyticus 16]
          Length = 349

 Score =  195 bits (496), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 38/277 (13%), Positives = 93/277 (33%), Gaps = 19/277 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       +    ++S    Q  KF    ++       +            I  
Sbjct: 58  ERFARHMRISLFNMLRKTAEVSINGVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALITM 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  +     +  S        
Sbjct: 118 EARLVFILVENFFGGDGRFHARIEGREFTPTERRIVQLLLKIVFEDYKEAWSPVMGVE-- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F +++P   +++     
Sbjct: 176 ------FEYLDSEVNPSMANIVSPTEVIVVSSFHIEVDGGGGDFHVVMPYS-MVEPIREL 228

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         +   + VN    +  +  +L+D++ L+ G +IP    E
Sbjct: 229 LDAGVQSDKMETDVRWSTALREEIMDVPVNFRVNLLEQDISLRDLMELRPGDIIPISMPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
              A +       Y  ++GR G    ++++++I    
Sbjct: 289 H--ATMFVEELPTYRVKMGRSGDKLAVQVSEKIKRPD 323


>gi|262166227|ref|ZP_06033964.1| flagellar motor switch protein FliM [Vibrio mimicus VM223]
 gi|262025943|gb|EEY44611.1| flagellar motor switch protein FliM [Vibrio mimicus VM223]
          Length = 300

 Score =  195 bits (496), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 43/277 (15%), Positives = 103/277 (37%), Gaps = 19/277 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       +    ++S    Q  KF    ++       +            +  
Sbjct: 9   ERFARHLRISLFNMLRKTAEVSINGVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALVTM 68

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  + A   +  S        
Sbjct: 69  EARLVFILVENFFGGDGRYHARIEGREFTPTERRVIQLLLKIVFADYKEAWSPVMGVE-- 126

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F +++P   +++     
Sbjct: 127 ------FEYLDSEVNPSMANIVSPTEVIVVSSFHVEVDGGGGDFHMVMPYS-MVEPIREL 179

Query: 214 LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT--TLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D+    A +   ++V ++ R+NL +    L+D++ L++G VIP    E
Sbjct: 180 LDAGVQSDKMETDVRWSTALREEIMDVPVNFRVNLLEMDIALRDLMELQVGDVIPIKMPE 239

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
              A++       Y  ++GR G+   ++++++I    
Sbjct: 240 H--AVMFVEELPTYRVKMGRSGEKLAVQVSEKIKRPD 274


>gi|260767699|ref|ZP_05876634.1| flagellar motor switch protein FliM [Vibrio furnissii CIP 102972]
 gi|260617208|gb|EEX42392.1| flagellar motor switch protein FliM [Vibrio furnissii CIP 102972]
 gi|315179469|gb|ADT86383.1| flagellar motor switch protein FliM [Vibrio furnissii NCTC 11218]
          Length = 352

 Score =  195 bits (496), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 36/277 (12%), Positives = 93/277 (33%), Gaps = 19/277 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       +    ++S    Q  KF    ++       +            +  
Sbjct: 58  ERFARHMRISLFNMLRKTAEVSINGVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALVTM 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  +        +        
Sbjct: 118 EARLVFILVENFFGGDGRYHARIEGREFTPTERRVIQLLLKIVFGDYKDAWAPVMGVE-- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F +++P   +++     
Sbjct: 176 ------FEYLDSEVNPSMANIVSPTEVIVVSSFHIEVDGGGGDFHIVMPYS-MVEPIREL 228

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         +   + VN    +  +   L+D++ L++G +IP    E
Sbjct: 229 LDAGVQSDKMETDVRWSSALREEIMDVPVNFRVNLLEQDLALRDLMELQVGDIIPIKMPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
              A +       Y  ++GR G+   ++++++I    
Sbjct: 289 H--ATMFVEELPTYRVKMGRSGEKLAVQVSEKIRRPD 323


>gi|15642125|ref|NP_231757.1| flagellar motor switch protein FliM [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121586821|ref|ZP_01676603.1| flagellar motor switch protein FliM [Vibrio cholerae 2740-80]
 gi|121727171|ref|ZP_01680338.1| flagellar motor switch protein FliM [Vibrio cholerae V52]
 gi|147675314|ref|YP_001217648.1| flagellar motor switch protein FliM [Vibrio cholerae O395]
 gi|153213269|ref|ZP_01948681.1| flagellar motor switch protein FliM [Vibrio cholerae 1587]
 gi|153803040|ref|ZP_01957626.1| flagellar motor switch protein FliM [Vibrio cholerae MZO-3]
 gi|153818973|ref|ZP_01971640.1| flagellar motor switch protein FliM [Vibrio cholerae NCTC 8457]
 gi|153822893|ref|ZP_01975560.1| flagellar motor switch protein FliM [Vibrio cholerae B33]
 gi|153825557|ref|ZP_01978224.1| flagellar motor switch protein FliM [Vibrio cholerae MZO-2]
 gi|153828607|ref|ZP_01981274.1| flagellar motor switch protein FliM [Vibrio cholerae 623-39]
 gi|227082251|ref|YP_002810802.1| flagellar motor switch protein FliM [Vibrio cholerae M66-2]
 gi|229507789|ref|ZP_04397294.1| flagellar motor switch protein FliM [Vibrio cholerae BX 330286]
 gi|229511974|ref|ZP_04401453.1| flagellar motor switch protein FliM [Vibrio cholerae B33]
 gi|229513777|ref|ZP_04403239.1| flagellar motor switch protein FliM [Vibrio cholerae TMA 21]
 gi|229519110|ref|ZP_04408553.1| flagellar motor switch protein FliM [Vibrio cholerae RC9]
 gi|229528862|ref|ZP_04418252.1| flagellar motor switch protein FliM [Vibrio cholerae 12129(1)]
 gi|229607334|ref|YP_002877982.1| flagellar motor switch protein FliM [Vibrio cholerae MJ-1236]
 gi|254226360|ref|ZP_04919949.1| flagellar motor switch protein FliM [Vibrio cholerae V51]
 gi|254291362|ref|ZP_04962155.1| flagellar motor switch protein FliM [Vibrio cholerae AM-19226]
 gi|254849211|ref|ZP_05238561.1| flagellar motor switch protein FliM [Vibrio cholerae MO10]
 gi|255745135|ref|ZP_05419084.1| flagellar motor switch protein FliM [Vibrio cholera CIRS 101]
 gi|262153475|ref|ZP_06028605.1| flagellar motor switch protein FliM [Vibrio cholerae INDRE 91/1]
 gi|262167485|ref|ZP_06035191.1| flagellar motor switch protein FliM [Vibrio cholerae RC27]
 gi|262191375|ref|ZP_06049565.1| flagellar motor switch protein FliM [Vibrio cholerae CT 5369-93]
 gi|298497852|ref|ZP_07007659.1| flagellar motor switch protein FliM [Vibrio cholerae MAK 757]
 gi|9656676|gb|AAF95271.1| flagellar motor switch protein FliM [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121548988|gb|EAX59027.1| flagellar motor switch protein FliM [Vibrio cholerae 2740-80]
 gi|121630416|gb|EAX62809.1| flagellar motor switch protein FliM [Vibrio cholerae V52]
 gi|124116069|gb|EAY34889.1| flagellar motor switch protein FliM [Vibrio cholerae 1587]
 gi|124121438|gb|EAY40181.1| flagellar motor switch protein FliM [Vibrio cholerae MZO-3]
 gi|125621110|gb|EAZ49455.1| flagellar motor switch protein FliM [Vibrio cholerae V51]
 gi|126510468|gb|EAZ73062.1| flagellar motor switch protein FliM [Vibrio cholerae NCTC 8457]
 gi|126519589|gb|EAZ76812.1| flagellar motor switch protein FliM [Vibrio cholerae B33]
 gi|146317197|gb|ABQ21736.1| flagellar motor switch protein FliM [Vibrio cholerae O395]
 gi|148875878|gb|EDL74013.1| flagellar motor switch protein FliM [Vibrio cholerae 623-39]
 gi|149740708|gb|EDM54807.1| flagellar motor switch protein FliM [Vibrio cholerae MZO-2]
 gi|150422692|gb|EDN14646.1| flagellar motor switch protein FliM [Vibrio cholerae AM-19226]
 gi|227010139|gb|ACP06351.1| flagellar motor switch protein FliM [Vibrio cholerae M66-2]
 gi|227014022|gb|ACP10232.1| flagellar motor switch protein FliM [Vibrio cholerae O395]
 gi|229332636|gb|EEN98122.1| flagellar motor switch protein FliM [Vibrio cholerae 12129(1)]
 gi|229343799|gb|EEO08774.1| flagellar motor switch protein FliM [Vibrio cholerae RC9]
 gi|229348958|gb|EEO13915.1| flagellar motor switch protein FliM [Vibrio cholerae TMA 21]
 gi|229351939|gb|EEO16880.1| flagellar motor switch protein FliM [Vibrio cholerae B33]
 gi|229355294|gb|EEO20215.1| flagellar motor switch protein FliM [Vibrio cholerae BX 330286]
 gi|229369989|gb|ACQ60412.1| flagellar motor switch protein FliM [Vibrio cholerae MJ-1236]
 gi|254844916|gb|EET23330.1| flagellar motor switch protein FliM [Vibrio cholerae MO10]
 gi|255736965|gb|EET92361.1| flagellar motor switch protein FliM [Vibrio cholera CIRS 101]
 gi|262024057|gb|EEY42752.1| flagellar motor switch protein FliM [Vibrio cholerae RC27]
 gi|262030712|gb|EEY49346.1| flagellar motor switch protein FliM [Vibrio cholerae INDRE 91/1]
 gi|262032750|gb|EEY51298.1| flagellar motor switch protein FliM [Vibrio cholerae CT 5369-93]
 gi|297542185|gb|EFH78235.1| flagellar motor switch protein FliM [Vibrio cholerae MAK 757]
 gi|327484654|gb|AEA79061.1| Flagellar motor switch protein FliM [Vibrio cholerae LMA3894-4]
          Length = 349

 Score =  195 bits (495), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 43/277 (15%), Positives = 103/277 (37%), Gaps = 19/277 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       +    ++S    Q  KF    ++       +            +  
Sbjct: 58  ERFARHLRISLFNMLRKTAEVSINGVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALVTM 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  + A   +  S        
Sbjct: 118 EARLVFILVENFFGGDGRYHARIEGREFTPTERRVIQLLLKIVFADYKEAWSPVMGVE-- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F +++P   +++     
Sbjct: 176 ------FEYLDSEVNPSMANIVSPTEVIVVSSFHVEVDGGGGDFHMVMPYS-MVEPIREL 228

Query: 214 LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT--TLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D+    A +   ++V ++ R+NL +    L+D++ L++G VIP    E
Sbjct: 229 LDAGVQSDKMETDVRWSTALREEIMDVPVNFRVNLLEMDIALRDLMELQVGDVIPIKMPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
              A++       Y  ++GR G+   ++++++I    
Sbjct: 289 H--AVMFVEELPTYRVKMGRSGEKLAVQVSEKIKRPD 323


>gi|229524128|ref|ZP_04413533.1| flagellar motor switch protein FliM [Vibrio cholerae bv. albensis
           VL426]
 gi|297582024|ref|ZP_06943943.1| flagellar motor switch protein FliM [Vibrio cholerae RC385]
 gi|229337709|gb|EEO02726.1| flagellar motor switch protein FliM [Vibrio cholerae bv. albensis
           VL426]
 gi|297533719|gb|EFH72561.1| flagellar motor switch protein FliM [Vibrio cholerae RC385]
          Length = 349

 Score =  195 bits (495), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 43/277 (15%), Positives = 103/277 (37%), Gaps = 19/277 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       +    ++S    Q  KF    ++       +            +  
Sbjct: 58  ERFARHLRISLFNMLRKTAEVSINGVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALVTM 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  + A   +  S        
Sbjct: 118 EARLVFILVENFFGGDGRYHARIEGREFTPTERRVIQLLLKIVFADYKEAWSPVMGVE-- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F +++P   +++     
Sbjct: 176 ------FEYLDSEVNPSMANIVSPTEVIVVSSFHVEVDGGGGDFHMVMPYS-MVEPIREL 228

Query: 214 LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT--TLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D+    A +   ++V ++ R+NL +    L+D++ L++G VIP    E
Sbjct: 229 LDAGVQSDKMETDVRWSTALREEIMDVPVNFRVNLLEMDIALRDLMELQVGDVIPIKMPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
              A++       Y  ++GR G+   ++++++I    
Sbjct: 289 H--AVMFIEELPTYRVKMGRSGEKLAVQVSEKIKRPD 323


>gi|258621111|ref|ZP_05716145.1| flagellar motor switch protein [Vibrio mimicus VM573]
 gi|262170887|ref|ZP_06038565.1| flagellar motor switch protein FliM [Vibrio mimicus MB-451]
 gi|258586499|gb|EEW11214.1| flagellar motor switch protein [Vibrio mimicus VM573]
 gi|261891963|gb|EEY37949.1| flagellar motor switch protein FliM [Vibrio mimicus MB-451]
          Length = 349

 Score =  194 bits (494), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 43/277 (15%), Positives = 102/277 (36%), Gaps = 19/277 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       +    ++S    Q  KF    ++       +            +  
Sbjct: 58  ERFARHLRISLFNMLRKTAEVSINGVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALVTM 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  + A   +  S        
Sbjct: 118 EARLVFILVENFFGGDGRYHARIEGREFTPTERRVIQLLLKIVFADYKEAWSPVMGVE-- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F +++P   + +     
Sbjct: 176 ------FEYLDSEVNPSMANIVSPTEVIVVSSFHVEVDGGGGDFHMVMPYSMM-EPIREL 228

Query: 214 LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT--TLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D+    A +   ++V ++ R+NL +    L+D++ L++G VIP    E
Sbjct: 229 LDAGVQSDKMETDVRWSTALREEIMDVPVNFRVNLLEMDIALRDLMELQVGDVIPIKMPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
              A++       Y  ++GR G+   ++++++I    
Sbjct: 289 H--AVMFVEELPTYRVKMGRSGEKLAVQVSEKIKRPD 323


>gi|258626185|ref|ZP_05721033.1| flagellar motor switch protein [Vibrio mimicus VM603]
 gi|258581540|gb|EEW06441.1| flagellar motor switch protein [Vibrio mimicus VM603]
          Length = 349

 Score =  194 bits (494), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 43/277 (15%), Positives = 102/277 (36%), Gaps = 19/277 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       +    ++S    Q  KF    ++       +            +  
Sbjct: 58  ERFARHLRISLFNMLRKTAEVSINGVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALVTM 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  + A   +  S        
Sbjct: 118 EARLVFILVENFFGGDGRYHARIEGREFTPTERRVIQLLLKIVFADYKEAWSPVMGVE-- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F +++P   + +     
Sbjct: 176 ------FEYLDSEVNPSMANIVSPTEVIVVSSFHVEVDGGGGDFHMVMPYSMM-EPIREL 228

Query: 214 LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT--TLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D+    A +   ++V ++ R+NL +    L+D++ L++G VIP    E
Sbjct: 229 LDAGVQSDKMETDVRWSTALREEIMDVPVNFRVNLLEMDIALRDLMELQVGDVIPIKMPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
              A++       Y  ++GR G+   ++++++I    
Sbjct: 289 H--AVMFVEELPTYRVKMGRSGEKLAVQVSEKIKRPD 323


>gi|27365287|ref|NP_760815.1| flagellar motor switch protein FliM [Vibrio vulnificus CMCP6]
 gi|37680658|ref|NP_935267.1| flagellar motor switch protein FliM [Vibrio vulnificus YJ016]
 gi|320155671|ref|YP_004188050.1| flagellar motor switch protein FliM [Vibrio vulnificus MO6-24/O]
 gi|27361434|gb|AAO10342.1| flagellar motor switch protein FliM [Vibrio vulnificus CMCP6]
 gi|37199407|dbj|BAC95238.1| flagellar motor switch protein FliM [Vibrio vulnificus YJ016]
 gi|319930983|gb|ADV85847.1| flagellar motor switch protein FliM [Vibrio vulnificus MO6-24/O]
          Length = 347

 Score =  194 bits (493), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 38/277 (13%), Positives = 92/277 (33%), Gaps = 19/277 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       +    ++S    Q  KF    ++       +            I  
Sbjct: 58  ERFARHMRISLFNMLRKTAEVSINGVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALITM 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  +     +  S        
Sbjct: 118 EARLVFILVENFFGGDGRFHAKIEGREFTPTERRIIQLLLKIVFEDYKEAWSPVMGVE-- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F +++P   +++     
Sbjct: 176 ------FEYLDSEVNPSMANIVSPTEVIVVSSFHIEVDGGGGDFHVVMPYS-MVEPIREL 228

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         +     VN    +  K  +L+D++ L+ G VIP    +
Sbjct: 229 LDAGVQSDKMETDVRWSSALREEIMDCPVNFRVNLLEKDISLRDLMELRPGDVIPIEMPK 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
              A++       Y  ++G+  +   ++I++ I    
Sbjct: 289 H--AVMFVEELPTYRVKMGQSNEKLAVQISEEIERPH 323


>gi|28899016|ref|NP_798621.1| flagellar motor switch protein FliM [Vibrio parahaemolyticus RIMD
           2210633]
 gi|153837001|ref|ZP_01989668.1| flagellar motor switch protein FliM [Vibrio parahaemolyticus
           AQ3810]
 gi|260365238|ref|ZP_05777795.1| flagellar motor switch protein FliM [Vibrio parahaemolyticus K5030]
 gi|260878788|ref|ZP_05891143.1| flagellar motor switch protein FliM [Vibrio parahaemolyticus
           AN-5034]
 gi|260897383|ref|ZP_05905879.1| flagellar motor switch protein FliM [Vibrio parahaemolyticus
           Peru-466]
 gi|260899942|ref|ZP_05908337.1| flagellar motor switch protein FliM [Vibrio parahaemolyticus
           AQ4037]
 gi|4322004|gb|AAD15907.1| polar flagellar switch protein FliM [Vibrio parahaemolyticus]
 gi|28807235|dbj|BAC60505.1| flagellar motor switch protein FliM [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149749774|gb|EDM60519.1| flagellar motor switch protein FliM [Vibrio parahaemolyticus
           AQ3810]
 gi|308088268|gb|EFO37963.1| flagellar motor switch protein FliM [Vibrio parahaemolyticus
           Peru-466]
 gi|308094184|gb|EFO43879.1| flagellar motor switch protein FliM [Vibrio parahaemolyticus
           AN-5034]
 gi|308107409|gb|EFO44949.1| flagellar motor switch protein FliM [Vibrio parahaemolyticus
           AQ4037]
 gi|308115479|gb|EFO53019.1| flagellar motor switch protein FliM [Vibrio parahaemolyticus K5030]
 gi|328474447|gb|EGF45252.1| flagellar motor switch protein FliM [Vibrio parahaemolyticus 10329]
          Length = 348

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 38/277 (13%), Positives = 89/277 (32%), Gaps = 19/277 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       +    ++S    Q  KF    ++       +            I  
Sbjct: 58  ERFARHMRISLFNMLRKTAEVSINGVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALITM 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  +     +  S        
Sbjct: 118 EARLVFILVENFFGGDGRFHAKIEGREFTPTERRIIQLLLKIVFEDYKEAWSPVMGVE-- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F +++P   +++     
Sbjct: 176 ------FEYLDSEVNPSMANIVSPTEVIVVSSFHIEVDGGGGDFHVVMPYS-MVEPIREL 228

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         +     VN    +  K  +L+D++ L+ G +IP    E
Sbjct: 229 LDAGVQSDKMETDVRWSSALREEIMDCPVNFRVNLLEKDISLRDLMELQPGDIIPIEMPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
              A +       Y  ++GR      ++++  I    
Sbjct: 289 H--ATMFIEDLPTYRVKMGRSEDKLAVQVSQEIERPH 323


>gi|260776477|ref|ZP_05885372.1| flagellar motor switch protein FliM [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260607700|gb|EEX33965.1| flagellar motor switch protein FliM [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 351

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 37/277 (13%), Positives = 94/277 (33%), Gaps = 19/277 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       +    ++S    Q  KF    ++       +            I  
Sbjct: 60  ERFARHMRISLFNMLRKTAEVSINGVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALITM 119

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  +     +  S        
Sbjct: 120 EARLVFILVENFFGGDGRFHARIEGREFTPTERRIVQLLLKIVFEDYKEAWSPVMGVE-- 177

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F +++P   +++     
Sbjct: 178 ------FEYLDSEVNPSMANIVSPTEVIVVSSFHIEVDGGGGDFHVVMPYS-MVEPIREL 230

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         +   + VN    +  +  +L+D++ L+ G +IP    E
Sbjct: 231 LDAGVQSDKMETDVRWSTALREEIMDVPVNFRVNLLEQDISLRDLMELQPGDIIPITMPE 290

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
              A +       +  ++GR G+   ++++++I    
Sbjct: 291 N--ATMFVEELPTFRVKMGRSGEQLAVQVSEKIKRPD 325


>gi|261209862|ref|ZP_05924163.1| flagellar motor switch protein FliM [Vibrio sp. RC341]
 gi|260841048|gb|EEX67573.1| flagellar motor switch protein FliM [Vibrio sp. RC341]
          Length = 349

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 43/277 (15%), Positives = 103/277 (37%), Gaps = 19/277 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       +    ++S    Q  KF    ++       +            +  
Sbjct: 58  ERFARHLRISLFNMLRKTAEVSINGVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALVTM 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  + A   +  S        
Sbjct: 118 EARLVFILVENFFGGDGRYHARIEGREFTPTERRVIQLLLKIVFADYKEAWSPVMGVE-- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F +++P   +++     
Sbjct: 176 ------FEYLDSEVNPSMANIVSPTEVIVVSSFHVEVDGGGGDFHMVMPYS-MVEPIREL 228

Query: 214 LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT--TLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D+    A +   ++V ++ R+NL +    L+D++ L++G VIP    E
Sbjct: 229 LDAGVQSDKMETDVRWSTALREEIMDVPVNFRVNLLEMDIALRDLMELQVGDVIPIKMPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
              A++       Y  ++GR G+   ++++++I    
Sbjct: 289 H--AVMFVEELPTYRVKMGRSGEKLAVQVSEKIKRPD 323


>gi|261252329|ref|ZP_05944902.1| flagellar motor switch protein FliM [Vibrio orientalis CIP 102891]
 gi|260935720|gb|EEX91709.1| flagellar motor switch protein FliM [Vibrio orientalis CIP 102891]
          Length = 349

 Score =  193 bits (491), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 37/277 (13%), Positives = 95/277 (34%), Gaps = 19/277 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       +    ++S    Q  KF    ++       +            I  
Sbjct: 58  ERFARHMRISLFNMLRKTAEVSINGVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALITM 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  +     +  S        
Sbjct: 118 EARLVFILVENFFGGDGRFHARIEGREFTPTERRIVQLLLKIVFEDYKEAWSPVMGVE-- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F +++P   +++     
Sbjct: 176 ------FEYLDSEVNPSMANIVSPTEVIVVSSFHIEVDGGGGDFHVVMPYS-MVEPIREL 228

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         +   + VN   ++  +  +L+D++ L+ G +IP    E
Sbjct: 229 LDAGVQSDKMETDVRWSTALREEIMDVPVNFRVQLLEQDISLRDLMELQPGDIIPINMPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
              A +       +  ++GR G+   ++++++I    
Sbjct: 289 H--ATMFVEELPTFRTKMGRSGELLAVQVSEKIKRPD 323


>gi|220934501|ref|YP_002513400.1| flagellar motor switch protein FliM [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995811|gb|ACL72413.1| flagellar motor switch protein FliM [Thioalkalivibrio sp. HL-EbGR7]
          Length = 326

 Score =  193 bits (490), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 44/277 (15%), Positives = 95/277 (34%), Gaps = 19/277 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       +    +IS    +  KFS  +H+       +   +           
Sbjct: 61  ERFARQMRISLFNLLRRSAEISVGGIKMTKFSEYVHTLFVPTSLNMVKIKPLRGTALFVV 120

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ + T+ Q    L +  +   +    
Sbjct: 121 DPKLVFILVDNFFGGDGRYHAKIEGREFTPTELRVIRMTLDQAFTDLKKAWAPVMDL--- 177

Query: 160 LEDFYDIDYLKKNTNRL------SNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                D +Y+    N          E V   + ++ ++       + +P   +++     
Sbjct: 178 -----DFEYINSEVNPQFANIVSPTEVVCVSSFHIELDGGGGDLHVTMPYS-MIEPMREL 231

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D   I     +     V + + +     +L+DV+ LK G +IP    E
Sbjct: 232 LDAGIQSDRSDVDERWIRALRDEVKAAEVELSSMLTETTLSLEDVMRLKPGDIIPIDLPE 291

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
               +L A G  +   + G       I++T+RI    
Sbjct: 292 --QVLLRAEGIPVLRGKFGVSDGYNAIKVTERIRRAD 326


>gi|77457773|ref|YP_347278.1| flagellar motor switch protein FliM [Pseudomonas fluorescens Pf0-1]
 gi|77381776|gb|ABA73289.1| flagellar motor switch protein [Pseudomonas fluorescens Pf0-1]
          Length = 322

 Score =  193 bits (490), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 40/276 (14%), Positives = 98/276 (35%), Gaps = 20/276 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D++    Q  KF   +HS       +   +           
Sbjct: 59  ERFARYTRISMFNMLRRSADVAVGGVQVMKFGEYVHSLYVPTSLNLVKIKPLRGTALFIL 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q    L +      E    
Sbjct: 119 DAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLEQAFVDLKEAWQAIMEV--- 174

Query: 160 LEDFYDIDYLKKNTNRL------SNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                + +Y+    N         +E +     ++ ++       + +P   +++     
Sbjct: 175 -----NFEYINSEVNPAMANIVGPSEAIVVSTFHIELDGGGGDLHVTMPYS-MIEPVREM 228

Query: 214 LSSQNKS--ENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S  ++Q E  ++   +    ++V I   +  ++  L+D++ ++ G VIP    E
Sbjct: 229 LDAGFQSDLDDQDERWVNALRQDVLDVDVPIGATVARRQLKLRDILHMQPGDVIPVEMPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
               I+ ANG   +  ++G    N  +++ + I   
Sbjct: 289 D--MIMRANGVPAFKVKMGSHKGNLALQVIEPIERR 322


>gi|170722847|ref|YP_001750535.1| flagellar motor switch protein FliM [Pseudomonas putida W619]
 gi|169760850|gb|ACA74166.1| flagellar motor switch protein FliM [Pseudomonas putida W619]
          Length = 322

 Score =  192 bits (489), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 41/270 (15%), Positives = 92/270 (34%), Gaps = 8/270 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D++    Q  KF   +HS       +   +           
Sbjct: 59  ERFARYTRISMFNLLRRSADVAVGGVQVMKFGEYVHSLYVPTSLNLVKIKPLRGTSLFIL 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q    L +        +  
Sbjct: 119 DAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLDQCFIDLKEAWQAIMPVNFE 177

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK 219
             +      +        +E V     ++ ++       + +P   +++     L +  +
Sbjct: 178 YMNSEVNPAMANIVG--PSEAVVVSTFHIELDGGGGDLHVTMPYS-MIEPVREMLDAGFQ 234

Query: 220 S--ENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
           S  ++Q E  +         ++V +   +  ++  L+DV+ ++ G VIP    E    +L
Sbjct: 235 SDLDDQDERWVKALREDVLDVSVPLSATVARRQLKLRDVLHMQPGDVIPVELPEH--LVL 292

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFD 307
            ANG   +   LG    N  ++I D I   
Sbjct: 293 RANGVPSFKARLGSHKGNLALQIIDPIERR 322


>gi|192360300|ref|YP_001982201.1| flagellar motor switch protein FliM [Cellvibrio japonicus Ueda107]
 gi|190686465|gb|ACE84143.1| flagellar motor switch protein FliM [Cellvibrio japonicus Ueda107]
          Length = 339

 Score =  192 bits (488), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 43/270 (15%), Positives = 96/270 (35%), Gaps = 8/270 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D+S    Q  KF   +H+       +            I  
Sbjct: 57  ERFARYTRISMFNLLRRTADVSVGGVQIQKFGEYVHTLYVPTSLNMVKFRPLRGTALIIL 116

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q    L +        S  
Sbjct: 117 DARLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVQMVLNQAFVDLGEAWKAVFPVSF- 174

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK 219
            E  +             +E V     ++ ++       + +P   +++     L +  +
Sbjct: 175 -EYVHSEVNPSLANIVSPSEVVVVSTFHIELDGGGGEMHITVPYS-MIEPIREVLDAGLQ 232

Query: 220 SEN--QSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
           S++  Q E  +           V+++  +  +  TL+D+V LK G +IP         ++
Sbjct: 233 SDSEEQDERWVRALREDVLAAKVDLECDVVRRDITLRDIVDLKEGDIIPVEFP--DYHVV 290

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFD 307
           +ANG  ++  +LG+   N  ++I + I+  
Sbjct: 291 TANGVPMFRTQLGQHNDNLALKILEFIDRS 320


>gi|254523832|ref|ZP_05135887.1| flagellar motor switch protein FliM [Stenotrophomonas sp. SKA14]
 gi|219721423|gb|EED39948.1| flagellar motor switch protein FliM [Stenotrophomonas sp. SKA14]
          Length = 334

 Score =  192 bits (488), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 45/289 (15%), Positives = 98/289 (33%), Gaps = 23/289 (7%)

Query: 26  GDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQ 85
           G   T+E +      L++  L  + +       ++S    +  KF+  +HS       + 
Sbjct: 47  GRMPTLEMVHERFARLWRIGLFNLIR----RSAELSVRGIELIKFNDYMHSLYVPTNLNL 102

Query: 86  ASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAV 145
                      I     LV  +++N  G       ++  R  +  E ++    + Q  A 
Sbjct: 103 IRFKPLRGTGLIVFEPTLVFAIVDNFFGGDGRYPTRIEGREFTATEMRVIHLLLKQTFAD 162

Query: 146 LNQCISTTQESSPNLEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVL 199
           L +  +   +         D +Y+    N          E+V    +++ ++       +
Sbjct: 163 LREAWAPVMDV--------DFEYINSEINPHFANIVTPREYVVVCRLHVELDGGGGDIHV 214

Query: 200 IIPQETLLKTTLISLSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVV 257
            +P   +L+     L +  +S+    D         +     V + + +  K+ TL+D+ 
Sbjct: 215 TLPYS-MLEPIRELLDAGIQSDRNDRDESWGQTLREQLNIAEVTLSSVLASKRMTLRDLT 273

Query: 258 TLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
            LK+G V+P          L      +++ E G       ++IT     
Sbjct: 274 RLKVGDVLPIELNP--QVPLCVENIPVFTGEFGIANGMNAVKITATHPP 320


>gi|306841070|ref|ZP_07473793.1| surface presentation of antigen protein [Brucella sp. BO2]
 gi|306288908|gb|EFM60211.1| surface presentation of antigen protein [Brucella sp. BO2]
          Length = 253

 Score =  192 bits (487), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 41/244 (16%), Positives = 98/244 (40%), Gaps = 4/244 (1%)

Query: 75  HSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKL 134
             F +  + +      W  + ++     LV +++E + GA     P   +R    VE+K+
Sbjct: 11  DIFDKAAIITPLKAERWGCSLYLTLDAVLVFSVIEAMFGAQGNLGPVDADRPFGMVEQKI 70

Query: 135 AKRTIAQISAVLNQCISTTQESS-PNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENV 193
           A      ++  L++  +T          D  D     ++   LS  F  T ++ +T    
Sbjct: 71  ANLLAGHLAGALDRVFNTGSSQPLFAPGDCIDTADFDRDNFELSRLF--TCHIAVTAAGK 128

Query: 194 ASSFVLIIPQETLLKTTLISLSSQNKSENQSED-LIDPFARKTYQLNVNIDTRINLKKTT 252
                L++P+ T         +   +  +Q++        ++  +  + ++  +     +
Sbjct: 129 TGQMHLLLPRSTHKPMQDAVAAFLRRPMDQADPAWAKKLRQEVSRARIELEAFMQQGSMS 188

Query: 253 LKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLK 312
           L  +  L+IGQV+           L A  ++++ C LG+ G ++T+++ D +N ++  + 
Sbjct: 189 LDALSRLEIGQVLKLPVDAMEQVRLRAGNQQLFKCTLGKSGIHFTVKVGDPVNQEEDLID 248

Query: 313 NFLH 316
             + 
Sbjct: 249 ELVA 252


>gi|83647849|ref|YP_436284.1| flagellar motor switch protein FliM [Hahella chejuensis KCTC 2396]
 gi|83635892|gb|ABC31859.1| flagellar motor switch protein FliM [Hahella chejuensis KCTC 2396]
          Length = 340

 Score =  191 bits (486), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 44/273 (16%), Positives = 103/273 (37%), Gaps = 20/273 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +  + D++    Q  KF   IH+       +   +           
Sbjct: 57  ERFARYTRISLFNLLRRNADVASGGVQILKFGEYIHTLYVPTSLNLVKIRPLRGTGLFIL 116

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q+   + +  +   +    
Sbjct: 117 DAKLVFKLVDNFFGGDGR-HAKIEGREFTPTEIRIVQMVLEQVFHDMKEAWNAVMKV--- 172

Query: 160 LEDFYDIDYLKKNTNR-LSN-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                D +Y+    N  ++N     E V     ++ ++       + +P   +++     
Sbjct: 173 -----DFEYVNSEVNPAMANIVSPSEVVVVSTFHIELDGGGGDMHVAMPYS-MIEPIREV 226

Query: 214 LSSQNKS--ENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S  ++  E  I    +   +  V ++  +  +K +L+ +  LK G VIP    E
Sbjct: 227 LDAGVQSDVDDVDERWISALQQDILEARVPLNAAVVRQKISLRSLSRLKPGDVIPVELPE 286

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
                ++ANG  I+  ++G+   N  ++I D+I
Sbjct: 287 --TITVTANGVPIFIAKVGQCNGNLALKIVDKI 317


>gi|26991047|ref|NP_746472.1| flagellar motor switch protein FliM [Pseudomonas putida KT2440]
 gi|148546747|ref|YP_001266849.1| flagellar motor switch protein FliM [Pseudomonas putida F1]
 gi|24986079|gb|AAN69936.1|AE016632_7 flagellar motor switch protein FliM [Pseudomonas putida KT2440]
 gi|5921670|gb|AAD56294.1| FliM [Pseudomonas putida]
 gi|148510805|gb|ABQ77665.1| flagellar motor switch protein FliM [Pseudomonas putida F1]
 gi|313497806|gb|ADR59172.1| FliM [Pseudomonas putida BIRD-1]
          Length = 322

 Score =  191 bits (486), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 41/270 (15%), Positives = 91/270 (33%), Gaps = 8/270 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D++    Q  KF   +HS       +   +           
Sbjct: 59  ERFARYTRISMFNLLRRSADVAVGGVQVMKFGEYVHSLYVPTSLNLVKIKPLRGTSLFIL 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q    L +        S  
Sbjct: 119 DAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLDQCFVDLKEAWQAIMPVSFE 177

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK 219
             +      +        +E V     ++ ++       + +P   +++     L +  +
Sbjct: 178 YMNSEVNPAMANIVG--PSEAVVVSTFHIELDGGGGDLHVTMPYS-MIEPVREMLDAGFQ 234

Query: 220 S--ENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
           S  ++Q E  +         + V +   +  ++  L+D++ ++ G VIP    E    +L
Sbjct: 235 SDLDDQDERWVKALREDVLDVAVPMTATVARRQLKLRDILHMQPGDVIPVELPEH--LVL 292

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFD 307
            ANG   +   LG    N  ++I D I   
Sbjct: 293 RANGVPAFKARLGSHKGNLALQIIDPIERR 322


>gi|325273547|ref|ZP_08139778.1| flagellar motor switch protein FliM [Pseudomonas sp. TJI-51]
 gi|324101325|gb|EGB98940.1| flagellar motor switch protein FliM [Pseudomonas sp. TJI-51]
          Length = 322

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 41/270 (15%), Positives = 91/270 (33%), Gaps = 8/270 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D++    Q  KF   +HS       +   +           
Sbjct: 59  ERFARYTRISMFNLLRRSADVAVGGVQVMKFGEYVHSLYVPTSLNLVKIKPLRGTSLFIL 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q    L +        S  
Sbjct: 119 DAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLDQCFVDLKEAWQAIMPVSFE 177

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK 219
             +      +        +E V     ++ ++       + +P   +++     L +  +
Sbjct: 178 YMNSEVNPAMANIVG--PSEAVVVSTFHIELDGGGGDLHVTMPYS-MIEPVREMLDAGFQ 234

Query: 220 S--ENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
           S  ++Q E  +         + V +   +  ++  L+D++ ++ G VIP    E    +L
Sbjct: 235 SDLDDQDERWVKALREDVLDVAVPMTATVARRQLKLRDILHMQPGDVIPVELPEH--LVL 292

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFD 307
            ANG   +   LG    N  ++I D I   
Sbjct: 293 RANGVPAFKARLGSHKGNLALQIIDPIERR 322


>gi|167034915|ref|YP_001670146.1| flagellar motor switch protein FliM [Pseudomonas putida GB-1]
 gi|166861403|gb|ABY99810.1| flagellar motor switch protein FliM [Pseudomonas putida GB-1]
          Length = 322

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 40/270 (14%), Positives = 91/270 (33%), Gaps = 8/270 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D++    Q  KF   +HS       +   +           
Sbjct: 59  ERFARYTRISMFNLLRRSADVAVGGVQVMKFGEYVHSLYVPTSLNLVKIKPLRGTSLFIL 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q    L +        +  
Sbjct: 119 DAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLDQCFVDLKEAWQAIMPVTFE 177

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK 219
             +      +        +E V     ++ ++       + +P   +++     L +  +
Sbjct: 178 YMNSEVNPAMANIVG--PSEAVVVSTFHIELDGGGGDLHVTMPYS-MIEPVREMLDAGFQ 234

Query: 220 S--ENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
           S  ++Q E  +         + V +   +  ++  L+D++ ++ G VIP    E    +L
Sbjct: 235 SDLDDQDERWVKALREDVLDVAVPMTATVARRQLKLRDILHMQPGDVIPVELPEH--LVL 292

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFD 307
            ANG   +   LG    N  ++I D I   
Sbjct: 293 RANGVPAFKARLGSHKGNLALQIIDPIERR 322


>gi|289666107|ref|ZP_06487688.1| flagellar motor switch protein FliM [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 337

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 43/270 (15%), Positives = 90/270 (33%), Gaps = 19/270 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + +         +    D+S       KF+  +HS       +            I  
Sbjct: 59  ERFARLWRIGLFNLIRRSADLSVRGIDLVKFNEYMHSLYVPTNLNLIRFKPLRGTGLIVF 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV T+++N  G       ++  R  +  E ++ +  + Q  A L +  +   +    
Sbjct: 119 EPTLVFTVVDNFFGGDGRYHTRIEGREFTATEMRVVQLMLKQTFADLKEAWAPVMDV--- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                D +Y+    N          E+V     ++ +E       + +P   +L+     
Sbjct: 176 -----DFEYINSEINPHFANIVTPREYVVVCRFHVELEGGGGEIHITLPYS-MLEPIREL 229

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         +     V + + +  K+ TL+ +  LK+G V+P     
Sbjct: 230 LDAGIQSDRNDRDDSWNVMLREQLDTAEVTLSSVLASKRMTLRQLTGLKVGDVLPIELPA 289

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRIT 301
                L      +++ E G    N  ++IT
Sbjct: 290 --QVPLCVEDIPLFTGEFGISNGNNAVKIT 317


>gi|83594172|ref|YP_427924.1| flagellar motor switch protein FliM [Rhodospirillum rubrum ATCC
           11170]
 gi|83577086|gb|ABC23637.1| flagellar motor switch protein FliM [Rhodospirillum rubrum ATCC
           11170]
          Length = 384

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 44/269 (16%), Positives = 109/269 (40%), Gaps = 6/269 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + +    +     +V++S  + QS +F   ++S     + S      W +   +   
Sbjct: 116 RLVRMMSTSLRNFTSDNVEVSLDNIQSYRFGDYLNSIPLPAMLSVFKAEEWDNYGLLTID 175

Query: 101 NNLVITLLENLLGASHETIP-QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           ++++ ++++ LLG    T   ++  R  +T+E+ L +R +  + A L+         +  
Sbjct: 176 SSMIYSIVDVLLGGRRGTAAMRIEGRPYTTIERNLVERLVHVVLADLSAAFDPLSPVTFR 235

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
            +     +      +R SN  +    + + +E+      ++IP  TL  ++  L+ +   
Sbjct: 236 FDRLET-NPRFATISRPSNAAIVA-KLRIDMEDRGGRLDMLIPYATLEPVRELLLQMFMG 293

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K   +        A + +   V +D  ++     L  ++++++G  I F     +   L
Sbjct: 294 EKFG-RDSIWETHLAEEMWSTEVQMDAILDEVYMPLNKILSMEVGSQILFNATPDSTVQL 352

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINF 306
                 ++  ++GR G+N  IR+  + N 
Sbjct: 353 RCGDVPMFDGKMGRKGQNIAIRVDSKHNR 381


>gi|312884904|ref|ZP_07744594.1| flagellar motor switch protein FliM [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309367381|gb|EFP94943.1| flagellar motor switch protein FliM [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 348

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 43/283 (15%), Positives = 95/283 (33%), Gaps = 19/283 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       +    ++S    Q  KF    ++       +            +  
Sbjct: 57  ERFARHLRISLFNMLRKTAEVSINGVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTGLVTM 116

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L+EN  G       ++  R  +  E+++ +  +  I     +  S        
Sbjct: 117 EARLVFILVENFFGGEGRYHSRIEGREFTPTERRIVQLLLKIIFEDYKEAWSPVMGVE-- 174

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E +   + ++ ++     F ++ P   +++     
Sbjct: 175 ------FEYLDSEVNPSMANIVSPTEVIVVSSFHVEVDGGGGDFHVVFPYS-MVEPIREL 227

Query: 214 LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRIN--LKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D+    A K   ++V I+ R+N       L+D++ L+ G +IP     
Sbjct: 228 LDAGVQSDKMEADVRWSSALKEEIMDVPINFRVNLLEHDIALRDLMELQPGDIIPVEMPP 287

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
              A++       Y  ++GR      I+I++ I        + 
Sbjct: 288 H--AVMFVEELPTYRVKMGRSSDKLAIQISEEIKRPDAVKTDI 328


>gi|289670556|ref|ZP_06491631.1| flagellar motor switch protein FliM [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 337

 Score =  191 bits (484), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 43/270 (15%), Positives = 90/270 (33%), Gaps = 19/270 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + +         +    D+S       KF+  +HS       +            I  
Sbjct: 59  ERFARLWRIGLFNLIRRSADLSVRGIDLVKFNEYMHSLYVPTNLNLIRFKPLRGTGLIVF 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV T+++N  G       ++  R  +  E ++ +  + Q  A L +  +   +    
Sbjct: 119 EPTLVFTVVDNFFGGDGRYHTRIEGREFTATEMRVVQLMLKQTFADLKEAWAPVMDV--- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                D +Y+    N          E+V     ++ +E       + +P   +L+     
Sbjct: 176 -----DFEYINSEINPHFANIVTPREYVVVCRFHVELEGGGGEIHITLPYS-MLEPIREL 229

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         +     V + + +  K+ TL+ +  LK+G V+P     
Sbjct: 230 LDAGIQSDRNDRDDSWNVMLREQLDTAEVTLSSVLASKRMTLRQLTGLKVGDVLPIELPA 289

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRIT 301
                L      +++ E G    N  ++IT
Sbjct: 290 --QVPLCVEDIPLFTGEFGVSNGNNAVKIT 317


>gi|194365650|ref|YP_002028260.1| flagellar motor switch protein FliM [Stenotrophomonas maltophilia
           R551-3]
 gi|194348454|gb|ACF51577.1| flagellar motor switch protein FliM [Stenotrophomonas maltophilia
           R551-3]
          Length = 334

 Score =  191 bits (484), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 44/289 (15%), Positives = 98/289 (33%), Gaps = 23/289 (7%)

Query: 26  GDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQ 85
           G   T+E +      L++  L  + +       ++S    +  KF+  +HS       + 
Sbjct: 47  GRMPTLEMVHERFARLWRIGLFNLIR----RSAELSVRGIELIKFNDYMHSLYVPTNLNL 102

Query: 86  ASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAV 145
                      I     LV  +++N  G       ++  R  +  E ++    + Q  A 
Sbjct: 103 IRFKPLRGTGLIVFEPTLVFAIVDNFFGGDGRYPTRIEGREFTATEMRVIHLLLKQTFAD 162

Query: 146 LNQCISTTQESSPNLEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVL 199
           L +  +   +         D +Y+    N          E+V    +++ ++       +
Sbjct: 163 LREAWAPVMDV--------DFEYINSEINPHFANIVTPREYVVVCRLHVELDGGGGDIHV 214

Query: 200 IIPQETLLKTTLISLSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVV 257
            +P   +L+     L +  +S+    D         +     V + + +  K+ TL+D+ 
Sbjct: 215 TLPYS-MLEPIRELLDAGIQSDRNDRDESWGQTLREQLNIAEVTLSSVLASKRMTLRDLT 273

Query: 258 TLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
            LK+G ++P          L      +++ E G       ++IT     
Sbjct: 274 QLKVGDILPIELSP--QVPLCVENIPVFTGEFGIANGMNAVKITATHPP 320


>gi|330808225|ref|YP_004352687.1| flagellar motor switch protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327376333|gb|AEA67683.1| Flagellar motor switch protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 322

 Score =  191 bits (484), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 39/276 (14%), Positives = 98/276 (35%), Gaps = 20/276 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D++    Q  KF   +HS       +   +           
Sbjct: 59  ERFARYTRISMFNMLRRSADVAVGGVQVMKFGEYVHSLYVPTSLNLVKIKPLRGTALFIL 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q    L +      E    
Sbjct: 119 DAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLEQAFVDLKEAWQAIMEV--- 174

Query: 160 LEDFYDIDYLKKNTNRL------SNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                + +Y+    N         +E +     ++ ++       + +P   +++     
Sbjct: 175 -----NFEYINSEVNPAMANIVGPSEAIVVSTFHIELDGGGGDLHVTMPYS-MIEPVREM 228

Query: 214 LSSQNKS--ENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S  ++Q E  I+   +    ++V I   +  ++  L+D++ ++ G +IP    E
Sbjct: 229 LDAGFQSDLDDQDERWINALRQDVLDVDVPIGATVARRQLRLRDILHMQPGDIIPVEMPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
               ++ ANG   +  ++G    N  +++ + I   
Sbjct: 289 D--MVMRANGVPAFKVKMGSHKGNLALQVIEPIERR 322


>gi|70729040|ref|YP_258774.1| flagellar motor switch protein FliM [Pseudomonas fluorescens Pf-5]
 gi|68343339|gb|AAY90945.1| flagellar motor switch protein FliM [Pseudomonas fluorescens Pf-5]
          Length = 322

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 39/276 (14%), Positives = 93/276 (33%), Gaps = 20/276 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D++    Q  KF   +HS       +   +           
Sbjct: 59  ERFARYTRISMFNMLRRSADVAVGGVQVMKFGEYVHSLYVPTSLNLVKIKPLRGTALFIL 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q    L +           
Sbjct: 119 DAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLEQAFVDLKEAWQAIM----- 172

Query: 160 LEDFYDIDYLKKNTNRL------SNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                + +Y+    N         +E +     ++ ++       + +P   +++     
Sbjct: 173 ---PVNFEYINSEVNPAMANIVGPSEAIVVSTFHIELDGGGGDLHVTMPYS-MIEPIREM 228

Query: 214 LSSQNKS--ENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S  ++Q E            + V +   +  ++  L+D++ ++ G VIP    E
Sbjct: 229 LDAGFQSDLDDQDERWSKALREDVLDVAVPLSATVARRQLRLRDILHMQPGDVIPVELPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
               I+ ANG   +  +LG    N  +++ + I   
Sbjct: 289 D--MIMRANGVPSFKVKLGSHKGNLALQVIEPIERR 322


>gi|144897829|emb|CAM74693.1| Flagellar motor switch protein fliM [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 382

 Score =  190 bits (482), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 43/267 (16%), Positives = 108/267 (40%), Gaps = 6/267 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + +    +     +V++S  +  S +F   ++S     + +      W +   +   
Sbjct: 117 RLVRMMSTSMRNFTSDNVEVSLDNILSLRFGDYLNSIPLPAMLAVFKAEEWDNYGLLTVD 176

Query: 101 NNLVITLLENLLGASHETIP-QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           ++L+ ++++ LLG    T   ++  R  +T+E+ L +R +  + + L+         +  
Sbjct: 177 SSLIYSIVDVLLGGRRGTAAMRIEGRPYTTIERNLVERMVHVVLSDLSAAFDPLSPVTFR 236

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
            +     +      +R SN  +    + + +E+      L++P  TL  ++  L+ +   
Sbjct: 237 FDRLET-NPRFATISRPSNAAIVA-KLRIDMEDRGGRLELLLPYATLEPVRELLLQMFMG 294

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K   +        A + +   V ++  ++ +   L+DV+  K+G  I    +  +   L
Sbjct: 295 EKFG-RDSIWETHLAEELWLTEVQMEAVLDEQVMGLRDVLNWKVGSKILLNAQPNSPIDL 353

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRI 304
                 ++   +GR G +  IR+ D+I
Sbjct: 354 RCGDVSMFRGRMGRKGPHIAIRVDDKI 380


>gi|190574232|ref|YP_001972077.1| flagellar motor switch protein FliM [Stenotrophomonas maltophilia
           K279a]
 gi|190012154|emb|CAQ45777.1| putative flagellar motor switch protein FliM [Stenotrophomonas
           maltophilia K279a]
          Length = 334

 Score =  190 bits (482), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 43/289 (14%), Positives = 99/289 (34%), Gaps = 23/289 (7%)

Query: 26  GDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQ 85
           G   T+E +      L++  L  + +       ++S    +  KF+  +HS       + 
Sbjct: 47  GRMPTLEMVHERFARLWRIGLFNLIR----RSAELSVRGIELIKFNDYMHSLYVPTNLNL 102

Query: 86  ASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAV 145
                      I     LV  +++N  G       ++  R  +  E ++    + Q  A 
Sbjct: 103 IRFKPLRGTGLIVFEPTLVFAIVDNFFGGDGRYPTRIEGREFTATEMRVIHLLLKQTFAD 162

Query: 146 LNQCISTTQESSPNLEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVL 199
           L +  +   +         D +Y+    N          E+V    +++ ++       +
Sbjct: 163 LREAWAPVMDV--------DFEYINSEINPHFANIVTPREYVVVCRLHVELDGGGGDIHV 214

Query: 200 IIPQETLLKTTLISLSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVV 257
            +P   +L+     L +  +S+    D         +     V + + +  K+ TL+D+ 
Sbjct: 215 TLPYS-MLEPIRELLDAGIQSDRNDRDESWGKTLREQLNIAEVTLSSVLASKRMTLRDLT 273

Query: 258 TLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
            LK+G ++P     +    +      +++ E G       ++IT     
Sbjct: 274 QLKVGDILPIELSPQVPVCV--ENIPVFTGEFGIANGMNAVKITATHPP 320


>gi|104782811|ref|YP_609309.1| flagellar motor switch protein FliM [Pseudomonas entomophila L48]
 gi|95111798|emb|CAK16522.1| flagellar motor switch protein FliM [Pseudomonas entomophila L48]
          Length = 322

 Score =  189 bits (481), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 41/276 (14%), Positives = 92/276 (33%), Gaps = 20/276 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D++    Q  KF   +HS       +   +           
Sbjct: 59  ERFARYTRISMFNLLRRSADVAVGGVQVMKFGEYVHSLYVPTSLNLVKIKPLRGTALFIL 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q    L +           
Sbjct: 119 DAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLDQCFVDLKEAWQAIM----- 172

Query: 160 LEDFYDIDYLKKNTNRL------SNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                + +Y+    N         +E V     ++ ++       + +P   +++     
Sbjct: 173 ---PVNFEYINSEVNPAMANIVGPSEAVVVSTFHIELDGGGGDLHVTMPYS-MIEPVREM 228

Query: 214 LSSQNKS--ENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S  ++Q E  +         + V +   +  ++  L+D++ ++ G VIP    E
Sbjct: 229 LDAGFQSDLDDQDERWVKALREDVLDVAVPMSATVARRQLKLRDILHMQPGDVIPVELPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
               +L ANG   +   LG       ++I D I   
Sbjct: 289 H--LVLRANGVPAFKARLGSHKGTLALQIIDPIERR 322


>gi|254491591|ref|ZP_05104770.1| flagellar motor switch protein FliM [Methylophaga thiooxidans
           DMS010]
 gi|224463069|gb|EEF79339.1| flagellar motor switch protein FliM [Methylophaga thiooxydans
           DMS010]
          Length = 340

 Score =  188 bits (478), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 46/286 (16%), Positives = 94/286 (32%), Gaps = 11/286 (3%)

Query: 26  GDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQ 85
           G   T+E I+   G   +  L  + +       +IS +  Q  KFS  +H+       + 
Sbjct: 51  GRMPTLEMINERFGRYLRISLFDMLR----RSAEISVSGIQVMKFSEYMHTLFVPTSLNL 106

Query: 86  ASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAV 145
             L        I     LV T+L+N  G       ++  R  +  E ++ +  +      
Sbjct: 107 IHLHPLRGTGLIVLEPKLVFTILDNYFGGEGRFQARIEGREFTATELRVIRMVLNLCFTD 166

Query: 146 LNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQET 205
           L +  S   E              +       +E V     ++ ++       L  P   
Sbjct: 167 LTEAWSPVMEVDFEFVSHEV--NPQFANIVSPSEVVVISTFHVELDGGGGDIHLTFPYS- 223

Query: 206 LLKTTLISLSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQ 263
           +L+     L +  +S+  ++D         +    +V I  ++     TL  +  LK G 
Sbjct: 224 MLEPIRELLDTGLQSDRTADDGRWSKAMREELMVADVEIWAKLAETSLTLAQIHKLKTGD 283

Query: 264 VIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
           +IP    +    +       ++    G   +   ++I + I   + 
Sbjct: 284 IIPIQMPKN--VVAMVEDVPMFRASYGEHNEKAALKIAEVIEHPKD 327


>gi|94500287|ref|ZP_01306820.1| flagellar motor switch protein FliM [Oceanobacter sp. RED65]
 gi|94427586|gb|EAT12563.1| flagellar motor switch protein FliM [Oceanobacter sp. RED65]
          Length = 331

 Score =  188 bits (478), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 41/273 (15%), Positives = 94/273 (34%), Gaps = 20/273 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D++    Q  KF   IH+       +   +           
Sbjct: 57  ERFARYTRISMFNFLRRSADVASGGIQIMKFGEYIHTLYVPTSLNMVKVRPLRGTALFIF 116

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  ++Q+   + +      +    
Sbjct: 117 DAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVQMVLSQVFTDMKEAWHAVLDL--- 172

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                D +Y     N         +E V   + ++ ++       + +P   +++     
Sbjct: 173 -----DFEYYGSEVNPAMANIVSPSEVVVISSFHIELDGGGGDLHVALPYS-MIEPIREF 226

Query: 214 LSSQNKS--ENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S  +   +  +           V +   +  ++ +L++V   + G VIP    E
Sbjct: 227 LDAGVQSDVDEVDDRWVQSLQEDIQSAKVPVHGTVVDREISLREVAAFQPGDVIPVDMPE 286

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
               IL ANG  I+  +LG    N  ++I + I
Sbjct: 287 D--FILQANGTPIFRGQLGVRDDNLAVKIKEPI 317


>gi|89094448|ref|ZP_01167388.1| flagellar motor switch protein [Oceanospirillum sp. MED92]
 gi|89081340|gb|EAR60572.1| flagellar motor switch protein [Oceanospirillum sp. MED92]
          Length = 325

 Score =  188 bits (478), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 47/271 (17%), Positives = 102/271 (37%), Gaps = 8/271 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D++    Q  K+   IH+       +   ++          
Sbjct: 61  ERFARYTRISLFNLLRRAADVTVGGVQVMKYGDYIHTLYVPTSMNLIRVNPLRGTALFIM 120

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E +L  + + Q    L +  +  +E S +
Sbjct: 121 DAKLVFKLVDNFFGGDGR-HAKIEGREFTPTETRLIHKALEQFFLDLEEAWNPVKELSFD 179

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK 219
               ++++    N      E V      + +E  +  F + +P   +L+     L S  +
Sbjct: 180 -HLGHEMNPAMANV-INPTEVVVVSTFQVDLEGGSGEFHVAMPYS-MLEPIRDLLVSGFQ 236

Query: 220 S--ENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
           S  + + E       R      + ++  +  ++ TL+DVV L+ G +IP    E     L
Sbjct: 237 SGEDEKDERWQVALQRDILMAGLPLEMTLAQQEMTLRDVVDLQAGDIIPIELPE--TFEL 294

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
            AN   +Y+C +G    N  +++ ++I   +
Sbjct: 295 KANKVPVYNCTMGVSRGNLAVKVVNQIERPK 325


>gi|307945662|ref|ZP_07660998.1| flagellar motor switch protein FliM [Roseibium sp. TrichSKD4]
 gi|307771535|gb|EFO30760.1| flagellar motor switch protein FliM [Roseibium sp. TrichSKD4]
          Length = 410

 Score =  188 bits (477), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 41/271 (15%), Positives = 98/271 (36%), Gaps = 6/271 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              +      +     +V++S  S  S +F   ++S     +        W     I   
Sbjct: 125 RLVRLTTTSLRNFTSDNVEVSLDSISSVRFGDYLNSIPLPAILGVFKAEEWDGFGMITVE 184

Query: 101 NNLVITLLENLLGA-SHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           ++L+ ++++ LLG     T  ++  R  +T+E  L ++ ++ I     Q  +        
Sbjct: 185 SSLIYSIIDVLLGGGRGATAVRVEGRPYTTIETNLVQQMVSLILQDAEQAFAPLSPVHFT 244

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
           +E     +      +R +N     + + + +E+   +  +++P  TL  ++  L+ +   
Sbjct: 245 MERLET-NPRFAAISRPAN-AAILVELRIDMEDRGGTVEIMMPYATLEPIRDLLLQMFMG 302

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K   +        A + +   V +D  +      L  V+ L +GQ + F         L
Sbjct: 303 EKFG-RDPIWEGHLATEVHAAEVEVDAVLYETHLPLGRVMNLDVGQTLVFDIEPTDPVTL 361

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
                 +    +G+      I++T  +   +
Sbjct: 362 KCGNVPLTEGTMGKAEDAIAIQVTKNLRKPK 392


>gi|312962266|ref|ZP_07776758.1| flagellar motor switch protein FliM [Pseudomonas fluorescens WH6]
 gi|311283603|gb|EFQ62192.1| flagellar motor switch protein FliM [Pseudomonas fluorescens WH6]
          Length = 322

 Score =  188 bits (477), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 40/276 (14%), Positives = 98/276 (35%), Gaps = 20/276 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D++    Q  KF   +HS       +   +           
Sbjct: 59  ERFARYTRISMFNMLRRSADVAVGGVQGMKFGEYVHSLYVPTSLNLVKIKPLRGTALFIL 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q    L +      E    
Sbjct: 119 DAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLEQAFIDLKEAWQAIMEV--- 174

Query: 160 LEDFYDIDYLKKNTNRL------SNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                + +Y+    N         +E +     ++ ++       + +P   +++     
Sbjct: 175 -----NFEYINSEVNPAMANIVGPSEAIVVSTFHIELDGGGGDLHVTMPYS-MIEPVREM 228

Query: 214 LSSQNKS--ENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S  ++Q E  +         ++V +   +  ++  L+D++ ++ G VIP    +
Sbjct: 229 LDAGFQSDLDDQDERWVKALREDLLDVDVPLSATVARRQLRLRDILHMQPGDVIPVELPQ 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
           +   I+ ANG   +  +LG    N  +++ + IN  
Sbjct: 289 E--MIMRANGVPSFKVKLGSHKGNLALQVIEPINRR 322


>gi|90021820|ref|YP_527647.1| flagellar motor switch protein FliM [Saccharophagus degradans 2-40]
 gi|89951420|gb|ABD81435.1| flagellar motor switch protein FliM [Saccharophagus degradans 2-40]
          Length = 333

 Score =  188 bits (477), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 46/277 (16%), Positives = 103/277 (37%), Gaps = 20/277 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D+S    Q  KF   +H+       +            I  
Sbjct: 57  ERFARYTRISMFNLLRRTADVSVGGIQIQKFGEYVHTLYVPTSLNMVKFRPLRGTALIIL 116

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q+   L +     +     
Sbjct: 117 DAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVQMVLEQVFIDLKEAWKAVK----- 170

Query: 160 LEDFYDIDYLKKNTNR-LSN-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                D +Y+    N  ++N     E V     ++ ++       + +P   +++     
Sbjct: 171 ---AIDFEYINSEVNPSMANIVSPSEVVVVSTFHVELDGGGGELHITMPYS-MVEPIREV 226

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D   +        +  V+++  +  ++ TL+D+V L+ G +IP    E
Sbjct: 227 LDAGLQSDTDERDDRWVRALQEDVMEARVDLEADLVRREVTLRDIVDLREGDIIPITMPE 286

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
               IL+ANG  ++  +LG++  N  +RI   ++   
Sbjct: 287 YN--ILTANGVPMFKTQLGQLNDNLAMRILGFVDRSN 321


>gi|288958672|ref|YP_003449013.1| flagellar motor switch protein [Azospirillum sp. B510]
 gi|288910980|dbj|BAI72469.1| flagellar motor switch protein [Azospirillum sp. B510]
          Length = 357

 Score =  188 bits (477), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 41/271 (15%), Positives = 101/271 (37%), Gaps = 6/271 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + +    +     +V++S     S +F   ++S     + S      W +   +   
Sbjct: 86  RLVRMMSTSLRNFTSDNVEVSLDQISSVRFGDYLNSIPLPAMLSVFKAEEWDNYGLMVVD 145

Query: 101 NNLVITLLENLLGASHETIP-QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           + L+ ++++ LLG    T   ++  R  +T+E+ L +R +  + + L+         +  
Sbjct: 146 SALIYSIVDVLLGGRRGTAAMRIEGRPYTTIERNLVERMVHVVLSDLSAAFDPLSPVTFR 205

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
            +     +       R +N     + + + +E+      L+IP  TL  ++  L+ +   
Sbjct: 206 FDRLET-NPRFATIARPAN-AAVLVKLRIDMEDRGGRLELMIPYATLEPVRELLLQMFMG 263

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K   +        A +    +V++   ++    TL DV+  ++G  I           L
Sbjct: 264 EKFG-RDSIWETHLASELMVTDVDLSAVLDEVTMTLHDVLNWRVGTRILLNATPDGAIEL 322

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
                 ++   +GR G +  +R+   +   +
Sbjct: 323 RCGDVSMFQGRMGRKGGHIAVRLEKELPKQE 353


>gi|328543159|ref|YP_004303268.1| flagellar motor switch protein FliM [polymorphum gilvum
           SL003B-26A1]
 gi|326412905|gb|ADZ69968.1| Flagellar motor switch protein FliM [Polymorphum gilvum
           SL003B-26A1]
          Length = 411

 Score =  188 bits (477), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 47/277 (16%), Positives = 105/277 (37%), Gaps = 6/277 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              +      +     +V++S  S  S +F   ++S     +        W     +   
Sbjct: 127 RLVRLTTTSLRNFTSDNVEVSLDSISSVRFGDYLNSIPLPAILGVFKAEEWDGFGLVTVE 186

Query: 101 NNLVITLLENLL-GASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           ++L+ ++++ LL G    T  ++  R  +T+E  L +R +  I A   Q  +       N
Sbjct: 187 SSLIYSIIDVLLGGGRGTTAVRVEGRPYTTIETNLVRRMVEIILADAEQAFAPLSPVHFN 246

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
           LE     +      +R +N     + + + +E+   +  +++P  TL  ++  L+ +   
Sbjct: 247 LERLET-NPRFAAISRPAN-AAILVELRIDMEDRGGTIEIMMPYATLEPIRDLLLQMFMG 304

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K   +        A + +   + +D  +      L  V++L +GQ + F         +
Sbjct: 305 EKFG-RDPIWEGHLASEIHAAEIEVDAVLYETHLPLGRVLSLDVGQTLIFDVDPHDPITI 363

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
                 +    LG+V  +  IR+T  +   + +L  F
Sbjct: 364 KCGNVPLTEGTLGKVEDSIAIRVTRGLRRPKMTLAAF 400


>gi|302185372|ref|ZP_07262045.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           syringae 642]
          Length = 322

 Score =  187 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 43/276 (15%), Positives = 98/276 (35%), Gaps = 20/276 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D++    Q  KF   +HS       + A +           
Sbjct: 59  ERFARYTRISMFNLLRRSADVAVGGVQVMKFGEYVHSLYVPTSLNLAKIKPLRGTALFIL 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q    L +      E    
Sbjct: 119 DAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLDQAFVDLKEAWQAIMEV--- 174

Query: 160 LEDFYDIDYLKKNTNRL------SNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                + +Y+    N         +E V     ++ ++       + +P   +++     
Sbjct: 175 -----NFEYINSEVNPAMANIVGPSEAVVISTFHIELDGGGGDLHVTMPYS-MIEPIREM 228

Query: 214 LSSQNKS--ENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S  ++Q E  ++        +NV + T I  ++  L+D++ ++ G VIP    +
Sbjct: 229 LDAGFQSDLDDQDERWVNALKEDVLDVNVPLTTTIAQRQLPLRDILHMRPGDVIPVELSD 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
               +L ANG   +  +LG       +++ + I   
Sbjct: 289 S--LVLRANGVPSFKVKLGSHKGKMALQVIEPIARR 322


>gi|21242691|ref|NP_642273.1| flagellar motor switch protein FliM [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|294664066|ref|ZP_06729468.1| flagellar motor switch protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|21108164|gb|AAM36809.1| flagellar protein [Xanthomonas axonopodis pv. citri str. 306]
 gi|292606169|gb|EFF49418.1| flagellar motor switch protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 337

 Score =  187 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 41/270 (15%), Positives = 90/270 (33%), Gaps = 19/270 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + +         +    D+S       KF+  +HS       +            I  
Sbjct: 59  ERFARLWRIGLFNLIRRSADLSVRGIDLVKFNEYMHSLYVPTNLNLIRFKPLRGTGLIVF 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV T+++N  G       ++  R  +  E ++ +  + Q  A L +  +   +    
Sbjct: 119 EPTLVFTVVDNFFGGDGRFHTRIEGREFTATEMRVIQLMLKQTFADLKEAWAPVMDV--- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                D +Y+    N          E+V     ++ +E       + +P   +L+     
Sbjct: 176 -----DFEYINSEINPHFANIVTPREYVVVCRFHVELEGGGGEIHITLPYS-MLEPIREL 229

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         +     V + + +  K+ +L+ +  LK+G ++P     
Sbjct: 230 LDAGIQSDRNDRDDSWNVMLREQLDTAEVTLSSVLASKRMSLRQLTGLKVGDILPIDLPA 289

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRIT 301
                L      +++ E G    N  ++IT
Sbjct: 290 --QVPLCVEDIPLFTGEFGVSNGNNAVKIT 317


>gi|326796458|ref|YP_004314278.1| flagellar motor switch protein FliM [Marinomonas mediterranea
           MMB-1]
 gi|326547222|gb|ADZ92442.1| flagellar motor switch protein FliM [Marinomonas mediterranea
           MMB-1]
          Length = 329

 Score =  187 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 49/283 (17%), Positives = 104/283 (36%), Gaps = 21/283 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D+S    Q  KF   +H+       +        S      
Sbjct: 57  ERFARYTRISLFNLLRRTADVSSGGLQIMKFGEYVHTLYVPTSLNLVKFRPLRSTALFIL 116

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q+   L +  +   +    
Sbjct: 117 DAKLVFKLVDNFFGGDGR-HAKIEGREFTPTEIRIVQLMLEQVFVDLTEAWAPVLKLE-- 173

Query: 160 LEDFYDIDYLKKNTNR-LSN-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                 ++Y+    N  ++N     E V     ++ ++       + +P   +++     
Sbjct: 174 ------LEYISSEVNPAMANIVSPSEVVVVSTFHIELDGGGGELHITLPYS-MIEPVREL 226

Query: 214 LSSQNKS--ENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S  + + +       +    ++VN+   I  KK TL DV+  K G VIP    E
Sbjct: 227 LDAGVQSDVDEKDDRWGKSLEQDVQDVDVNLHVNIASKKITLGDVLKFKTGDVIPIEMPE 286

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD-QKSLKN 313
                + AN    +  +LG     Y++++ + I    ++SLKN
Sbjct: 287 --YVTVRANNVPTFRGKLGSSNGKYSVQMKESIKAQMKESLKN 327


>gi|325928696|ref|ZP_08189868.1| flagellar motor switch protein FliM [Xanthomonas perforans 91-118]
 gi|325540928|gb|EGD12498.1| flagellar motor switch protein FliM [Xanthomonas perforans 91-118]
          Length = 337

 Score =  187 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 41/270 (15%), Positives = 90/270 (33%), Gaps = 19/270 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + +         +    D+S       KF+  +HS       +            I  
Sbjct: 59  ERFARLWRIGLFNLIRRSADLSVRGIDLVKFNEYMHSLYVPTNLNLIRFKPLRGTGLIVF 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV T+++N  G       ++  R  +  E ++ +  + Q  A L +  +   +    
Sbjct: 119 EPTLVFTVVDNFFGGDGRFHTRIEGREFTATEMRVIQLMLKQTFADLKEAWAPVMDV--- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                D +Y+    N          E+V     ++ +E       + +P   +L+     
Sbjct: 176 -----DFEYINSEINPHFANIVTPREYVVVCRFHVELEGGGGEIHITLPYS-MLEPIREL 229

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         +     V + + +  K+ +L+ +  LK+G ++P     
Sbjct: 230 LDAGIQSDRNDRDDSWNVMLREQLDTAEVTLSSVLASKRMSLRQLTGLKVGDILPIDLPA 289

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRIT 301
                L      +++ E G    N  ++IT
Sbjct: 290 --QVPLCVEDIPLFTGEFGVSNGNNAVKIT 317


>gi|330961230|gb|EGH61490.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 252

 Score =  187 bits (475), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 42/262 (16%), Positives = 95/262 (36%), Gaps = 20/262 (7%)

Query: 54  MDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLG 113
           +    D++    Q  KF   +HS       + A +              LV  L++N  G
Sbjct: 3   LRRSADVAVGGVQVMKFGEYVHSLYVPTSLNLAKIKPLRGTALFILDAKLVFKLVDNFFG 62

Query: 114 ASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNT 173
                  ++  R  +  E ++ +  + Q    L +      E         + +Y+    
Sbjct: 63  GDGR-HAKIEGREFTPTELRVVRMVLDQAFIDLKEAWQAIMEV--------NFEYINSEV 113

Query: 174 NRL------SNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKS--ENQSE 225
           N         +E V     ++ ++       + +P   +++     L +  +S  ++Q E
Sbjct: 114 NPAMANIVGPSEAVVISTFHIELDGGGGDLHVTMPYS-MIEPIREMLDAGFQSDLDDQDE 172

Query: 226 DLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIY 285
             ++        +NV + T I  ++  L+D++ ++ G VIP    +    ++ ANG   +
Sbjct: 173 RWVNALKEDVLDVNVPLTTTIAQRQLPLRDILHMRPGDVIPVELSDS--LVMRANGVPSF 230

Query: 286 SCELGRVGKNYTIRITDRINFD 307
             +LG       +++ + I   
Sbjct: 231 KVKLGSHKGKMALQVIEPIARR 252


>gi|78047547|ref|YP_363722.1| flagellar motor switch protein FliM [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|78035977|emb|CAJ23668.1| flagellar motor switch protein FliM [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 337

 Score =  187 bits (475), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 41/270 (15%), Positives = 90/270 (33%), Gaps = 19/270 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + +         +    D+S       KF+  +HS       +            I  
Sbjct: 59  ERFARLWRIGLFNLIRRSADLSVRGIDLVKFNEYMHSLYVPTNLNLIRFKPLRGTGLIVF 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV T+++N  G       ++  R  +  E ++ +  + Q  A L +  +   +    
Sbjct: 119 EPTLVFTVVDNFFGGDGRFHTRIEGREFTATEMRVIQLMLKQTFADLKEAWAPVMDV--- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                D +Y+    N          E+V     ++ +E       + +P   +L+     
Sbjct: 176 -----DFEYINSEINPHFANIVTPREYVVVCRFHVELEGGGGEIHITLPYS-MLEPIREL 229

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         +     V + + +  K+ +L+ +  LK+G ++P     
Sbjct: 230 LDAGIQSDRNDRDDSWNVMLREQLDTAEVTLSSVLASKRMSLRQLTGLKVGDILPIDLPA 289

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRIT 301
                L      +++ E G    N  ++IT
Sbjct: 290 --QVPLCVEDIPLFTGEFGVSNGNNAVKIT 317


>gi|330953758|gb|EGH54018.1| flagellar motor switch protein FliM [Pseudomonas syringae Cit 7]
          Length = 322

 Score =  187 bits (475), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 43/262 (16%), Positives = 95/262 (36%), Gaps = 20/262 (7%)

Query: 54  MDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLG 113
           +    D++    Q  KF   +HS       + A +              LV  L++N  G
Sbjct: 73  LRRSADVAVGGVQVMKFGEYVHSLYVPTSLNLAKIKPLRGTALFILDAKLVFKLVDNFFG 132

Query: 114 ASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNT 173
                  ++  R  +  E ++ +  + Q    L +      E         + +Y+    
Sbjct: 133 GDGR-HAKIEGREFTPTELRVVRMVLDQAFVDLKEAWQAIMEV--------NFEYINSEV 183

Query: 174 NRL------SNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKS--ENQSE 225
           N         +E V     ++ ++       + +P   +++     L +  +S  ++Q E
Sbjct: 184 NPAMANIVGPSEAVVISTFHIELDGGGGDLHVTMPYS-MIEPIREMLDAGFQSDLDDQDE 242

Query: 226 DLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIY 285
             ++        +NV + T I  ++  L+D++ ++ G VIP    +    +L ANG   +
Sbjct: 243 RWVNALKEDVLDVNVPLTTTIAQRQLPLRDILHMRPGDVIPVELGDS--LVLRANGVPSF 300

Query: 286 SCELGRVGKNYTIRITDRINFD 307
             +LG       +++ + I   
Sbjct: 301 KVKLGSHKGKMALQVIEPIARR 322


>gi|325920567|ref|ZP_08182489.1| flagellar motor switch protein FliM [Xanthomonas gardneri ATCC
           19865]
 gi|325548960|gb|EGD19892.1| flagellar motor switch protein FliM [Xanthomonas gardneri ATCC
           19865]
          Length = 337

 Score =  187 bits (474), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 42/270 (15%), Positives = 90/270 (33%), Gaps = 19/270 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + +         +    D+S       KF+  +HS       +            I  
Sbjct: 59  ERFARLWRIGLFNLIRRSADLSVRGIDLVKFNEYMHSLYVPTNLNLIRFKPLRGTGLIVF 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV T+++N  G       ++  R  +  E ++ +  + Q  A L +  +   E    
Sbjct: 119 EPTLVFTVVDNFFGGDGRYHTRIEGREFTATEMRVVQLMLKQTFADLKEAWAPVMEV--- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                D +Y+    N          E+V     ++ +E       + +P   +L+     
Sbjct: 176 -----DFEYINSEINPHFANIVTPREYVVVCRFHVELEGGGGEIHITLPYS-MLEPIREL 229

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         +     V + + +  K+ +L+ +  LK+G ++P     
Sbjct: 230 LDAGIQSDRNDRDDSWNVMLREQLDTAEVTLSSVLASKRMSLRQLTGLKVGDILPIDLPA 289

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRIT 301
                L      +++ E G    N  ++IT
Sbjct: 290 --QVPLCVEEIPLFTGEFGVSNGNNAVKIT 317


>gi|304311107|ref|YP_003810705.1| Flagellar motor switch protein [gamma proteobacterium HdN1]
 gi|301796840|emb|CBL45052.1| Flagellar motor switch protein [gamma proteobacterium HdN1]
          Length = 354

 Score =  187 bits (474), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 43/277 (15%), Positives = 95/277 (34%), Gaps = 20/277 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D++    Q  KF   +HS       +   +           
Sbjct: 59  ERFARYTRISMFNLLRRSADVAVGGVQVIKFGEYVHSLYVPTSLNMVRIKPLRGTALFIL 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q    + +           
Sbjct: 119 DAKLVFKLVDNFFGGDGR-HVKIEGREFTPTENRVVQLVLKQAFKDMEEAWKAVL----- 172

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N         +E V     ++ ++       L +P   +++     
Sbjct: 173 ---PVKFEYLSSEVNPALANIVSPSEVVVVNTFHIELDGGGGDLQLTVPYS-MIEPLREV 228

Query: 214 LSSQNKSE--NQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L S  +S+  NQ E  +     +    NV++  ++  +K  L ++  LK G V+     E
Sbjct: 229 LDSGVQSDVGNQDERWMSSLREEIMGANVHLRCKLLDRKIKLSELAALKTGDVLQVEMPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
               ++ AN    Y  +LG   + Y ++I +++   +
Sbjct: 289 H--VMIYANEVPTYRGKLGTSREKYAVKIAEKVQRPE 323


>gi|28869173|ref|NP_791792.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213967550|ref|ZP_03395698.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           tomato T1]
 gi|301382887|ref|ZP_07231305.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           tomato Max13]
 gi|302061097|ref|ZP_07252638.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           tomato K40]
 gi|302131287|ref|ZP_07257277.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|28852413|gb|AAO55487.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213927851|gb|EEB61398.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           tomato T1]
 gi|330964686|gb|EGH64946.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           actinidiae str. M302091]
 gi|331016994|gb|EGH97050.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 322

 Score =  186 bits (473), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 43/276 (15%), Positives = 97/276 (35%), Gaps = 20/276 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D++    Q  KF   +HS       + A +           
Sbjct: 59  ERFARYTRISMFNLLRRSADVAVGGVQVMKFGEYVHSLYVPTSLNLAKIKPLRGTALFIL 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q    L +      E    
Sbjct: 119 DAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLDQAFIDLKEAWQAIMEV--- 174

Query: 160 LEDFYDIDYLKKNTNRL------SNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                + +Y+    N         +E V     ++ ++       + +P   +++     
Sbjct: 175 -----NFEYINSEVNPAMANIVGPSEAVVISTFHIELDGGGGDLHVTMPYS-MIEPIREM 228

Query: 214 LSSQNKS--ENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S  ++Q E  ++        +NV + T I  ++  L+D++ ++ G VIP     
Sbjct: 229 LDAGFQSDLDDQDERWVNALKEDVLDVNVPLTTTIAQRQLPLRDILHMRPGDVIPVELS- 287

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
               +L ANG   +  +LG       +++ + I   
Sbjct: 288 -DTLVLRANGVPSFKVKLGSHKGKMALQVIEPIARR 322


>gi|330876026|gb|EGH10175.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 322

 Score =  186 bits (473), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 43/276 (15%), Positives = 98/276 (35%), Gaps = 20/276 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D++    Q  KF   +HS       + A +           
Sbjct: 59  ERFARYTRISMFNLLRRSADVAVGGVQVMKFGEYVHSLYVPTSLNLAKIKPLRGTALFIL 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q    L +      E    
Sbjct: 119 DAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLDQAFIDLKEAWQAIMEV--- 174

Query: 160 LEDFYDIDYLKKNTNRL------SNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                + +Y+    N +       +E V     ++ ++       + +P   +++     
Sbjct: 175 -----NFEYINSEVNPVMANIVGPSEAVVISTFHIELDGGGGDLHVTMPYS-MIEPIREM 228

Query: 214 LSSQNKS--ENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S  ++Q E  ++        +NV + T I  ++  L+D++ ++ G VIP     
Sbjct: 229 LDAGFQSDLDDQDERWVNALKEDVLDVNVPLTTTIAQRQLPLRDILHMRPGDVIPVELS- 287

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
               +L ANG   +  +LG       +++ + I   
Sbjct: 288 -DTLVLRANGVPSFKVKLGSHKGKMALQVIEPIARR 322


>gi|66046676|ref|YP_236517.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           syringae B728a]
 gi|289678975|ref|ZP_06499865.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           syringae FF5]
 gi|63257383|gb|AAY38479.1| Flagellar motor switch protein FliM [Pseudomonas syringae pv.
           syringae B728a]
 gi|330972446|gb|EGH72512.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 322

 Score =  186 bits (473), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 42/276 (15%), Positives = 98/276 (35%), Gaps = 20/276 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D++    Q  KF   +HS       + A +           
Sbjct: 59  ERFARYTRISMFNLLRRSADVAVGGVQVMKFGEYVHSLYVPTSLNLAKIKPLRGTALFIL 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q    L +      E    
Sbjct: 119 DAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLDQAFVDLKEAWQAIMEV--- 174

Query: 160 LEDFYDIDYLKKNTNRL------SNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                + +Y+    N         +E V     ++ ++       + +P   +++     
Sbjct: 175 -----NFEYINSEVNPAMANIVGPSEAVVISTFHIELDGGGGDLHVTMPYS-MIEPIREM 228

Query: 214 LSSQNKS--ENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S  ++Q E  ++        +NV + T I  ++  L+D++ ++ G VIP    +
Sbjct: 229 LDAGFQSDLDDQDERWVNALKEDVLDVNVPLTTTIAQRQLPLRDILHMRPGDVIPVELSD 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
               ++ ANG   +  +LG       +++ + I   
Sbjct: 289 S--LVMRANGVPSFKVKLGSHKGKMALQVIEPIARR 322


>gi|325917742|ref|ZP_08179929.1| flagellar motor switch protein FliM [Xanthomonas vesicatoria ATCC
           35937]
 gi|325536041|gb|EGD07850.1| flagellar motor switch protein FliM [Xanthomonas vesicatoria ATCC
           35937]
          Length = 337

 Score =  186 bits (473), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 42/270 (15%), Positives = 90/270 (33%), Gaps = 19/270 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + +         +    D+S       KF+  +HS       +            I  
Sbjct: 59  ERFARLWRIGLFNLIRRSADLSVRGIDLVKFNEYMHSLYVPTNLNLIRFKPLRGTGLIVF 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV T+++N  G       ++  R  +  E ++ +  + Q  A L +  +   E    
Sbjct: 119 EPTLVFTVVDNFFGGDGRFHTRIEGREFTATEMRVIQLMLKQTFADLKEAWAPVMEV--- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                D +Y+    N          E+V     ++ +E       + +P   +L+     
Sbjct: 176 -----DFEYINSEINPHFANIVTPREYVVVCRFHVELEGGGGEIHITLPYS-MLEPIREL 229

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         +     V + + +  K+ +L+ +  LK+G ++P     
Sbjct: 230 LDAGIQSDRNDRDDSWNVMLREQLNTAEVTLSSVLASKRMSLRQLTGLKVGDILPIDLPA 289

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRIT 301
                L      +++ E G    N  ++IT
Sbjct: 290 --QVPLCVEEIPMFTGEFGVSNGNNAVKIT 317


>gi|296531938|ref|ZP_06894735.1| flagellar motor switch protein FliM [Roseomonas cervicalis ATCC
           49957]
 gi|296267736|gb|EFH13564.1| flagellar motor switch protein FliM [Roseomonas cervicalis ATCC
           49957]
          Length = 355

 Score =  186 bits (473), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 47/276 (17%), Positives = 102/276 (36%), Gaps = 6/276 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + +    +     +V++S     S +F   +++     +        W +   +   
Sbjct: 67  RLVRIMSTSLRNFTSDNVEVSIEGITSLRFGDYLNTIPLPAMLVVFKAEEWDNYGLVVVD 126

Query: 101 NNLVITLLENLLGAS-HETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           + L+ ++++ LLG     T  ++  R  +T+E+ L +R    +   L+       E    
Sbjct: 127 SALIYSVVDVLLGGRRGTTAMRIEGRPYTTIERGLIERLTEVVLKDLSDAFGPLAEVEFR 186

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK 219
            E   +++      +R SN  V    + + +E+      L++P  T L+     L  Q  
Sbjct: 187 FERL-EVNPRFAAISRPSNAAVLA-RLRVDMESRGGQLQLLLPYAT-LEPVRELLLQQFM 243

Query: 220 SENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            E    D       A +  Q  V +D  ++ +   L DVV L++G +I           L
Sbjct: 244 GEKFGRDSIWETHLAEELRQTEVALDVVLDEQTMRLSDVVRLQVGDLITLGVGPGAPVRL 303

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKN 313
                 ++  ++G       +RI   +    + L++
Sbjct: 304 RCGDTSLFEGQVGGRKGRLAVRIDRAMPRQAEGLRD 339


>gi|254470104|ref|ZP_05083508.1| flagellar motor switch protein FliM [Pseudovibrio sp. JE062]
 gi|211960415|gb|EEA95611.1| flagellar motor switch protein FliM [Pseudovibrio sp. JE062]
          Length = 409

 Score =  186 bits (473), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 46/277 (16%), Positives = 107/277 (38%), Gaps = 6/277 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              +      +     +V++S  S  + +F   ++S     +        W     +   
Sbjct: 125 RLVRLTTTSLRNFTSDNVEVSLDSMTNVRFGDYLNSIPLPAILGVFKAKEWDGFGLVTVE 184

Query: 101 NNLVITLLENLLGA-SHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           ++L+ ++++ LLG     +  ++  R  +T+E  L +R I  I     Q        S  
Sbjct: 185 SSLIYSIIDVLLGGGRGSSPTRVEGRPYTTIESNLVRRMIEIILLDAEQAFGPLSPVSFP 244

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
           LE     +      +R +N  +  + + + +E+      +++P  TL  ++  L+ +   
Sbjct: 245 LERLET-NPRFAAISRPANAAIM-VELRIDMEDRGGKVEIVLPYATLEPIRDLLLQMFMG 302

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K   +     +  A + Y   V +D  +      L+ V+ L++GQ + F    +    +
Sbjct: 303 EKFG-RDPIWEEHLATEVYSSEVQVDAVLYENTIPLQRVLNLEVGQTLLFDTGPRDPVQV 361

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
              G ++    +G V    +I I+ ++   + +L  F
Sbjct: 362 KCGGVQLTEGLMGHVDDRISIEISKKLKQPKMTLAAF 398


>gi|209963533|ref|YP_002296448.1| flagellar motor switch protein FliM [Rhodospirillum centenum SW]
 gi|7025355|gb|AAF35846.1|AF220002_3 lateral flagellar motor switch protein FliM [Rhodospirillum
           centenum]
 gi|209956999|gb|ACI97635.1| flagellar motor switch protein FliM [Rhodospirillum centenum SW]
          Length = 352

 Score =  186 bits (473), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 46/311 (14%), Positives = 104/311 (33%), Gaps = 26/311 (8%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +  P+  ++  RL                        L   F+      V+++     S 
Sbjct: 66  DRLPMLDVVFDRLVR---------------------LLNTSFRNLTSGTVEVTVQQIASV 104

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           +F   +       + +      W ++  +   + L+ ++++ LLG        +  R  +
Sbjct: 105 RFGDYLSGIPLPSLIAVVRAEEWDNHCLLTVDSELIYSIVDILLGGRRSDPAPIDGRPYT 164

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
            +E+ LA+R I  +   L    S         E               SN    +    +
Sbjct: 165 VIERALAERLIRTVLKDLGTAFSPLSAVGFACERVETTPQFA--VITRSNNACISARFQV 222

Query: 189 TIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRI 246
            ++       L+IP  TL  ++  L+ +    K   +          +  + +V++   +
Sbjct: 223 ALDGRGGCVSLLIPYATLEPIRDLLLQMFMGEKFG-RDSMWETHLKNELRRTSVDLSAVL 281

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
              + +L D++  K G  +    R    A+L+     ++  E+G+   N  IRI   +  
Sbjct: 282 GQAQVSLTDLLAWKEGTQLVLDMRPDAQALLTCGHVPMFVGEMGQRNGNVAIRIDADLGA 341

Query: 307 DQKSLKNFLHK 317
             + +   L +
Sbjct: 342 QDEVIHGLLQR 352


>gi|71737319|ref|YP_275531.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257484906|ref|ZP_05638947.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|289629023|ref|ZP_06461977.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289651613|ref|ZP_06482956.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|298487824|ref|ZP_07005864.1| Flagellar motor switch protein fliM [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|71557872|gb|AAZ37083.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|298157549|gb|EFH98629.1| Flagellar motor switch protein fliM [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320325124|gb|EFW81193.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320329383|gb|EFW85376.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330866455|gb|EGH01164.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           aesculi str. 0893_23]
 gi|330889050|gb|EGH21711.1| flagellar motor switch protein FliM [Pseudomonas syringae pv. mori
           str. 301020]
 gi|330986499|gb|EGH84602.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331011074|gb|EGH91130.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 322

 Score =  186 bits (472), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 44/276 (15%), Positives = 98/276 (35%), Gaps = 20/276 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D++    Q  KF   +HS       + A +           
Sbjct: 59  ERFARYTRISMFNLLRRSADVAVGGVQVMKFGEYVHSLYVPTSLNLAKIKPLRGTALFIL 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q    L +      E    
Sbjct: 119 DAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLDQAFIDLKEAWQAIMEV--- 174

Query: 160 LEDFYDIDYLKKNTNRL------SNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                + +Y+    N         +E V     ++ ++       + +P   +++     
Sbjct: 175 -----NFEYINSEVNPAMANIVGPSEAVVISTFHIELDGGGGDLHVTMPYS-MIEPIREM 228

Query: 214 LSSQNKS--ENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S  ++Q E  I+        +NV + T I  ++  L+D++ ++ G VIP    E
Sbjct: 229 LDAGFQSDLDDQDERWINALKEDVLDVNVPLTTTIAQRQLPLRDILHMRPGDVIPVELSE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
               ++ ANG   +  +LG       +++ + I   
Sbjct: 289 S--LVMRANGVPSFKVKLGSHKGKMALQVIEPIARR 322


>gi|254504876|ref|ZP_05117027.1| flagellar motor switch protein FliM [Labrenzia alexandrii DFL-11]
 gi|222440947|gb|EEE47626.1| flagellar motor switch protein FliM [Labrenzia alexandrii DFL-11]
          Length = 412

 Score =  186 bits (472), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 44/277 (15%), Positives = 104/277 (37%), Gaps = 6/277 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              +      +     +V++S  S  S +F   ++S     +     +  W     I   
Sbjct: 128 RLVRLTTTSLRNFTSDNVEVSLDSISSVRFGDYLNSIPLPAILGVFKVEEWDGFGLITVE 187

Query: 101 NNLVITLLENLL-GASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           ++L+ ++++ LL G    T  ++  R  +T+E  L ++ +  I     Q  +       N
Sbjct: 188 SSLIYSIIDVLLGGGRGTTAARVEGRPYTTIETNLVQQMVQLILQDAEQAFAPLSPVHFN 247

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
           LE     +      +R +N     + + + +E+   +  +++P  TL  ++  L+ +   
Sbjct: 248 LERLET-NPRFAAISRPAN-AAILVELRIDMEDRGGTVEIMMPYATLEPIRDLLLQMFMG 305

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K   +        A + +   + +D  +      L  V++L +GQ + F        ++
Sbjct: 306 EKFG-RDPIWEGHLATEIHAAEIEVDAVLYETYLPLGRVLSLDVGQTLVFDVAPTDPVLV 364

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
                 +    LG+   +  IR+   +   + +L  F
Sbjct: 365 KCGNIPLTEGTLGKTEDSIAIRVAKNLRKPKMTLAAF 401


>gi|229591843|ref|YP_002873962.1| flagellar motor switch protein FliM [Pseudomonas fluorescens SBW25]
 gi|229363709|emb|CAY51095.1| flagellar motor switch protein [Pseudomonas fluorescens SBW25]
          Length = 322

 Score =  186 bits (472), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 39/273 (14%), Positives = 97/273 (35%), Gaps = 20/273 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D++    Q  KF   +HS       +   +           
Sbjct: 59  ERFARYTRISMFNMLRRSADVAVGGVQVMKFGEYVHSLYVPTSLNLVKIKPLRGTALFIL 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q    L +      E    
Sbjct: 119 DAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLEQAFIDLKEAWQAIMEV--- 174

Query: 160 LEDFYDIDYLKKNTNRL------SNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                + +Y+    N         +E +     ++ ++       + +P   +++     
Sbjct: 175 -----NFEYINSEVNPAMANIVGPSEAIVVSTFHIELDGGGGDLHVTMPYS-MIEPVREM 228

Query: 214 LSSQNKS--ENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S  ++Q E  +         ++V +   +  ++  L+D++ ++ G +IP    E
Sbjct: 229 LDAGFQSDLDDQDERWVKALREDLLDVDVPLSATVARRQLRLRDILHMQPGDIIPVELPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
           +   I+ ANG   +  +LG    N  +++ + I
Sbjct: 289 E--MIMRANGVPSFKVKLGSHKGNLALQVVESI 319


>gi|237799245|ref|ZP_04587706.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331022100|gb|EGI02157.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 322

 Score =  186 bits (471), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 42/276 (15%), Positives = 98/276 (35%), Gaps = 20/276 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D++    Q  KF   +HS       + A +           
Sbjct: 59  ERFARYTRISMFNLLRRSADVAVGGVQVMKFGEYVHSLYVPTSLNLAKIKPLRGTALFIL 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q    L +      E    
Sbjct: 119 DAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLDQAFIDLKEAWQAIMEV--- 174

Query: 160 LEDFYDIDYLKKNTNRL------SNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                + +Y+    N         +E V     ++ ++       + +P   +++     
Sbjct: 175 -----NFEYINSEVNPAMANIVGPSEAVVISTFHIELDGGGGDLHVTMPYS-MIEPIREM 228

Query: 214 LSSQNKS--ENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S  ++Q E  ++        +NV + T I  ++  L+D++ ++ G VIP    +
Sbjct: 229 LDAGFQSDLDDQDERWVNALKEDVLDVNVPLTTTIAQRQLPLRDILHMRPGDVIPVELSD 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
               ++ ANG   +  +LG       +++ + I   
Sbjct: 289 S--LVMRANGVPSFKVKLGSHKGKMALQVIEPIARR 322


>gi|166712025|ref|ZP_02243232.1| flagellar motor switch protein FliM [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 337

 Score =  186 bits (471), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 41/270 (15%), Positives = 91/270 (33%), Gaps = 19/270 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + +         +    D+S       KF+  +HS       +            I  
Sbjct: 59  ERFARLWRIGLFNLIRRSADLSVRGIDLVKFNEYMHSLYVPTNLNLIRFKPLRGTGLIVF 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV T+++N  G       ++  R  +  E ++ +  + Q  A L +  +   +    
Sbjct: 119 EPTLVFTVVDNFFGGDGRYHTRIEGREFTATEMRVVQLMLKQTFADLKEAWAPVMDV--- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                D++Y+    N          E+V     ++ +E       + +P   +L+     
Sbjct: 176 -----DLEYINSEINPHFANIVTPREYVVVCRFHVELEGGGGEIHITLPYS-MLEPIREL 229

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         +     V + + +  K+ +L+ +  LK+G ++P     
Sbjct: 230 LDAGIQSDRNDRDDSWNVMLREQLDTAEVTLSSVLASKRMSLRQLTGLKVGDILPIDLPA 289

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRIT 301
                L      +++ E G    N  ++IT
Sbjct: 290 --QVPLCVEEIPLFTGEFGVSNGNNAVKIT 317


>gi|154253006|ref|YP_001413830.1| flagellar motor switch protein FliM [Parvibaculum lavamentivorans
           DS-1]
 gi|154156956|gb|ABS64173.1| flagellar motor switch protein FliM [Parvibaculum lavamentivorans
           DS-1]
          Length = 374

 Score =  186 bits (471), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 40/267 (14%), Positives = 102/267 (38%), Gaps = 6/267 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + +    +     +V++S  +  S +F   ++S     + +      W +       
Sbjct: 76  RLVRLMTVSLRNFTSDNVEVSLDNVSSIRFGDYLNSIPLPAILAVFRAKQWDNYGMFTVD 135

Query: 101 NNLVITLLENLLGASHETIP-QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           +NL+ ++++ LLG    T   ++  R  +T+E  L +R I  +   +          +  
Sbjct: 136 SNLIYSIVDVLLGGRRGTAAMRIEGRPYTTIELNLVQRMIEVVLQDVQSAFEPLSPVTLE 195

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
           L+                      + + + +E+      L++P  TL  ++  L+ +   
Sbjct: 196 LDRMETNPRFAAIARPA--NAAILVKLRVDMEDRGGRIELLLPYATLEPIRELLLQMFMG 253

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K   +        A + +   V ++  ++ ++ +L++V+  ++GQ +      +    L
Sbjct: 254 EKFG-RDTIWESHLATELWATKVPLEAVLDEQQLSLREVMDFRVGQTLMLNSGPEGAIDL 312

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRI 304
              G  +   ++GRVG +  +R+   I
Sbjct: 313 RCGGVRLGKGKMGRVGNHVAVRVEQAI 339


>gi|119476310|ref|ZP_01616661.1| flagellar motor switch protein M [marine gamma proteobacterium
           HTCC2143]
 gi|119450174|gb|EAW31409.1| flagellar motor switch protein M [marine gamma proteobacterium
           HTCC2143]
          Length = 320

 Score =  186 bits (471), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 42/270 (15%), Positives = 97/270 (35%), Gaps = 8/270 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D++    Q  KF   +H+       +   L        I  
Sbjct: 57  ERFSRYTRISLFNLLRRSADVAVGGIQVQKFGEYVHTLFVPTSLNMIKLRPLRGTGLIVL 116

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + +  A L +           
Sbjct: 117 DAKLVFKLVDNYFGGDGR-HAKIEGREFTPTELRVVEMVLQEAFADLKEAWRAVLPVEFE 175

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK 219
             +               +E V     ++ ++       + +P   +++    +L S  +
Sbjct: 176 FVNAEV--NPSMANIVSPSEVVVVSTFHIELDGGGGDMHITLPYA-MIEPIRETLDSGLQ 232

Query: 220 S--ENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
           +  ++  +  I           VN+  ++  K+  L+D++ LK G VIP         ++
Sbjct: 233 TDVDDIDDRWIKSLREDILNATVNMGCKVAEKEVPLRDIIDLKEGDVIPMEMPGD--LVI 290

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFD 307
           SANG  +   +LG+   N  +++ ++IN +
Sbjct: 291 SANGIPMMLAKLGQSKGNLALQVVEKINNE 320


>gi|285018173|ref|YP_003375884.1| flagellar motor switch protein [Xanthomonas albilineans GPE PC73]
 gi|283473391|emb|CBA15896.1| probable flagellar motor switch protein [Xanthomonas albilineans]
          Length = 335

 Score =  185 bits (470), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 42/275 (15%), Positives = 90/275 (32%), Gaps = 19/275 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + +         +    D+S       KF+  +HS       +            I  
Sbjct: 58  ERFARLCRIGLFNLIRRSADLSVRGIDLVKFNDYMHSLYVPSNLNLIKFKPLRGTGLIVF 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV T+++N  G       ++  R  +  E ++ +  + Q  A L++  +        
Sbjct: 118 EPTLVFTVVDNFFGGDGRYPTRIEGREFTPTEMRVIQLMLKQTFADLHEAWAPVMNVE-- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N          E+V     ++ +E       + +P   +L+     
Sbjct: 176 ------FEYLNSEVNPHFANIVTPREYVVVSRFHVELEGGGGEIHVTLPYS-MLEPIREL 228

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         + Y   V I + +  K+ +L+++  L+IG ++P     
Sbjct: 229 LDAGIQSDRVDRDESWNIMLREQLYGSEVTISSVLAQKEMSLRELTRLRIGDILPIDLP- 287

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                L      +++ E G       ++IT     
Sbjct: 288 -KQVPLCVENIPVFTGEFGVSQGQNAVKITATHPP 321


>gi|58582231|ref|YP_201247.1| flagellar motor switch protein FliM [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84624124|ref|YP_451496.1| flagellar motor switch protein FliM [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|188576791|ref|YP_001913720.1| flagellar motor switch protein FliM [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188576983|ref|YP_001913912.1| flagellar motor switch protein FliM [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|58426825|gb|AAW75862.1| flagellar protein [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84368064|dbj|BAE69222.1| flagellar protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188521243|gb|ACD59188.1| flagellar motor switch protein FliM [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188521435|gb|ACD59380.1| flagellar motor switch protein FliM [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 337

 Score =  185 bits (470), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 41/270 (15%), Positives = 91/270 (33%), Gaps = 19/270 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + +         +    D+S       KF+  +HS       +            I  
Sbjct: 59  ERFARLWRIGLFNLIRRSADLSVRGIDLVKFNEYMHSLYVPTNLNLIRFKPLRGTGLIVF 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV T+++N  G       ++  R  +  E ++ +  + Q  A L +  +   +    
Sbjct: 119 EPTLVFTVVDNFFGGDGRYHTRIEGREFTATEMRVVQLMLKQTFADLKEAWAPVMDV--- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                D++Y+    N          E+V     ++ +E       + +P   +L+     
Sbjct: 176 -----DLEYINSEINPHFANIVTPREYVVVCRFHVELEGGGGEIHITLPYS-MLEPIREL 229

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         +     V + + +  K+ +L+ +  LK+G ++P     
Sbjct: 230 LDAGIQSDRNDRDDSWNVMLREQLDTAEVTLSSVLASKRMSLRQLTGLKVGDILPIDLPA 289

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRIT 301
                L      +++ E G    N  ++IT
Sbjct: 290 --QVPLCVEEIPLFTGEFGVSNGNNAVKIT 317


>gi|21231367|ref|NP_637284.1| flagellar motor switch protein FliM [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|188991610|ref|YP_001903620.1| flagellar motor switch protein FliM [Xanthomonas campestris pv.
           campestris str. B100]
 gi|21113030|gb|AAM41208.1| flagellar protein [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|167733370|emb|CAP51571.1| Flagellar motor switch protein FliM [Xanthomonas campestris pv.
           campestris]
          Length = 337

 Score =  185 bits (469), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 42/270 (15%), Positives = 90/270 (33%), Gaps = 19/270 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + +         +    D+S       KF+  +HS       +            I  
Sbjct: 59  ERFARLWRIGLFNLIRRSADLSVRGIDLVKFNEYMHSLYVPTNLNLIRFKPLRGTGLIVF 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV T+++N  G       ++  R  +  E ++ +  + Q  A L +  +   +    
Sbjct: 119 EPTLVFTVVDNFFGGDGRFHTRIEGREFTATEMRVIQLMLKQTFADLKEAWAPVMDV--- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                D +Y+    N          E+V     ++ +E       + +P   +L+     
Sbjct: 176 -----DFEYINSEINPHFANIVTPREYVVVCRFHVELEGGGGEIHITLPYS-MLEPIREL 229

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D         +     V + + +  K+ +L+ +  LKIG ++P     
Sbjct: 230 LDAGIQSDRNDRDDSWNVMLREQLDTAEVTLSSVLASKRMSLRQLTGLKIGDILPIDLPA 289

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRIT 301
                L      +++ E G    N  ++IT
Sbjct: 290 --QVPLCVEEIPLFTGEFGVSNGNNAVKIT 317


>gi|23015785|ref|ZP_00055552.1| COG1868: Flagellar motor switch protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 395

 Score =  185 bits (469), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 37/265 (13%), Positives = 104/265 (39%), Gaps = 6/265 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + +    +     +V++S  +  S +F   ++S     + +      W +   +   
Sbjct: 128 RLVRMMSTSMRNFTSDNVEVSLDNILSLRFGDYLNSIPLPAMLAVFKAEEWDNFGLLTVD 187

Query: 101 NNLVITLLENLLGASHETIP-QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           ++L+ ++++ LLG    T   ++  R  +T+E+ L +R +  + + L+         +  
Sbjct: 188 SSLIYSIVDVLLGGRRGTAAMRIEGRPYTTIERNLVERMVHVVLSDLSAAFDPLSPVTFR 247

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
            +     +      +R SN  +    + + +E+      L++P  TL  ++  L+ +   
Sbjct: 248 FDRLET-NPRFATISRPSNAAIVA-KLRIDMEDRGGRLELLLPYATLEPVRELLLQMFMG 305

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K   +        A + +   V ++  ++ +   L++V+  K G          +   +
Sbjct: 306 EKFG-RDSIWETHLAEELWLTEVELEAVLDEQVMNLREVLNWKPGSKFMLNATADSQIDM 364

Query: 278 SANGKEIYSCELGRVGKNYTIRITD 302
                 ++   +GR G++  I++ +
Sbjct: 365 RCGEVAMFRGRMGRKGQHIAIQVDE 389


>gi|83312597|ref|YP_422861.1| flagellar motor switch protein FliM [Magnetospirillum magneticum
           AMB-1]
 gi|82947438|dbj|BAE52302.1| Flagellar motor switch protein fliM [Magnetospirillum magneticum
           AMB-1]
          Length = 393

 Score =  185 bits (469), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 37/265 (13%), Positives = 104/265 (39%), Gaps = 6/265 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + +    +     +V++S  +  S +F   ++S     + +      W +   +   
Sbjct: 126 RLVRMMSTSMRNFTSDNVEVSLDNILSLRFGDYLNSIPLPAMLAVFKAEEWDNFGLLTVD 185

Query: 101 NNLVITLLENLLGASHETIP-QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           ++L+ ++++ LLG    T   ++  R  +T+E+ L +R +  + + L+         +  
Sbjct: 186 SSLIYSIVDVLLGGRRGTAAMRIEGRPYTTIERNLVERMVHVVLSDLSAAFDPLSPVTFR 245

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
            +     +      +R SN  +    + + +E+      L++P  TL  ++  L+ +   
Sbjct: 246 FDRLET-NPRFATISRPSNAAIVA-KLRIDMEDRGGRLELLLPYATLEPVRELLLQMFMG 303

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K   +        A + +   V ++  ++ +   L++V+  K G          +   +
Sbjct: 304 EKFG-RDSIWETHLAEELWLTEVELEAVLDEQVMNLREVLNWKPGSKFMLNATADSQIDM 362

Query: 278 SANGKEIYSCELGRVGKNYTIRITD 302
                 ++   +GR G++  I++ +
Sbjct: 363 RCGEVAMFRGRMGRKGQHIAIQVDE 387


>gi|296447445|ref|ZP_06889370.1| surface presentation of antigens (SPOA) protein [Methylosinus
           trichosporium OB3b]
 gi|296255065|gb|EFH02167.1| surface presentation of antigens (SPOA) protein [Methylosinus
           trichosporium OB3b]
          Length = 339

 Score =  184 bits (468), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 46/258 (17%), Positives = 104/258 (40%), Gaps = 5/258 (1%)

Query: 60  ISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETI 119
           ++  S  + + +   ++     + +    +   +   +G     V  ++E L GA     
Sbjct: 83  VAVESVAATRAAEAQNALDALAITATYGGAEPDARVTLGAERKFVFAMVEGLFGADGSEP 142

Query: 120 PQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNE 179
                R+L++VE +LA+  + +++  L    ++T  ++  L+             R  + 
Sbjct: 143 FYEEERALTSVEIRLARLVLDRLAKALQISFASTAGAALALDPVEPKPEPAGAARRSGSA 202

Query: 180 FVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSED--LIDPFARKTYQ 237
            +      +T     S  ++  PQ  +L     +L++   +  QS D         +   
Sbjct: 203 LIC--RFRLTAFGAESEALVTFPQG-VLDPLREALAADPATTIQSADPLWAQRMKDRITA 259

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             V++   +  +  TL DV   ++GQ++           L   G+ ++ CE+G+    YT
Sbjct: 260 TEVSLTAVMERRDLTLGDVARFEVGQIVELPVSPTGLIALECEGQTLFWCEIGQKDGAYT 319

Query: 298 IRITDRINFDQKSLKNFL 315
           IRI D ++ +Q+ + + L
Sbjct: 320 IRIADFVDKEQEFIDDML 337


>gi|146282919|ref|YP_001173072.1| flagellar motor switch protein FliM [Pseudomonas stutzeri A1501]
 gi|145571124|gb|ABP80230.1| flagellar motor switch protein FliM [Pseudomonas stutzeri A1501]
          Length = 342

 Score =  184 bits (468), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 44/273 (16%), Positives = 100/273 (36%), Gaps = 20/273 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D+S    Q  KF   +HS       +   +           
Sbjct: 78  ERFARYTRISMFNLLRRSADVSVGGVQVMKFGEYVHSLYVPTSLNLVKMKPLRGTALFIL 137

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q  A L +      +    
Sbjct: 138 DAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLDQAFADLKEAWHAVLDV--- 193

Query: 160 LEDFYDIDYLKKNTNR-LSN-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                + +Y+    N  L+N     E V     ++ +++      + +P   +++     
Sbjct: 194 -----NFEYVNSEVNPALANIVSPSEVVVVSTFHIELDSGGGDLHVTMPYS-MIEPIREM 247

Query: 214 LSSQNKSE--NQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+  +Q E  +         +NV +   +  ++  L+D++ ++ G VIP    E
Sbjct: 248 LDAGFQSDVSDQDERWVKALREDILDVNVPLGATVVRRQLKLRDILNMQPGDVIPVEMPE 307

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
               I+ ANG   +  +LG    N  +++ + +
Sbjct: 308 D--MIMRANGMPAFKVKLGAHKGNLALQVLEPV 338


>gi|319787093|ref|YP_004146568.1| flagellar motor switch protein FliM [Pseudoxanthomonas suwonensis
           11-1]
 gi|317465605|gb|ADV27337.1| flagellar motor switch protein FliM [Pseudoxanthomonas suwonensis
           11-1]
          Length = 339

 Score =  184 bits (466), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 43/309 (13%), Positives = 101/309 (32%), Gaps = 25/309 (8%)

Query: 12  PLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFS 71
           P       R+    G   T+E ++     L++  L  + +       DIS       KF 
Sbjct: 38  PYDFASQDRIIR--GRMPTLEMVNERFARLWRIGLFNLIR----RSADISVRGIDMIKFG 91

Query: 72  HIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVE 131
             +HS       +            +     LV  +++N  G       ++  R  +  E
Sbjct: 92  EYMHSLYVPTNLNLVRFKPLRGMGLVVFEPKLVFAVVDNFFGGDGRYPTRIEGREFTVTE 151

Query: 132 KKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNR------LSNEFVTTIN 185
            ++ +  + Q  A L +  +   +           +Y+    N          E+V    
Sbjct: 152 MRVIQLMLRQTFADLVEAWAPVMDVE--------FEYINSEINPHFANIVTPREYVVVSR 203

Query: 186 MNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSED--LIDPFARKTYQLNVNID 243
            ++ ++       + +P   +L+     L +  +S+    D         +     V + 
Sbjct: 204 FHVELDGGGGEIHVTLPYS-MLEPIRELLDAGIQSDRIDRDESWNTTLREQLQLAEVTVS 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
           + +  K+  L+ +  LK+G ++P      T   +      +++ + G       ++IT  
Sbjct: 263 SVLAQKRIDLRQLTRLKVGDILPIDLS--TTVPVCVENIPVFTGQFGVSNGCNAVKITRT 320

Query: 304 INFDQKSLK 312
                ++ +
Sbjct: 321 HPPGSETAR 329


>gi|330880582|gb|EGH14731.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 242

 Score =  184 bits (466), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 42/253 (16%), Positives = 90/253 (35%), Gaps = 20/253 (7%)

Query: 63  TSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQL 122
              Q  KF   +HS       + A +              LV  L++N  G       ++
Sbjct: 2   GGVQVMKFGEYVHSLYVPTSLNLAKIKPLRGTALFILDAKLVFKLVDNFFGGDGR-HAKI 60

Query: 123 YNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRL------ 176
             R  +  E ++ +  + Q    L +      E         + +Y+    N        
Sbjct: 61  EGREFTPTELRVVRMVLDQAFIDLKEAWQAIMEV--------NFEYINSEVNPAMANIVG 112

Query: 177 SNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKS--ENQSEDLIDPFARK 234
            +E       ++ ++       + +P   +++     L +  +S  ++Q E  I+     
Sbjct: 113 PSEAGVISTFHIELDGGGGDLHVTMPYS-MIEPIREMLDAGFQSDLDDQDERWINALKED 171

Query: 235 TYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGK 294
              +NV + T I  ++  L+D++ ++ G VIP    E    ++ ANG   +  +LG    
Sbjct: 172 VLDVNVPLTTTIAQRQLPLRDILHMRPGDVIPVELSES--LVMRANGVPSFKVKLGSHKG 229

Query: 295 NYTIRITDRINFD 307
              +++ + I   
Sbjct: 230 KMALQVIEPIARR 242


>gi|146307837|ref|YP_001188302.1| flagellar motor switch protein FliM [Pseudomonas mendocina ymp]
 gi|145576038|gb|ABP85570.1| flagellar motor switch protein FliM [Pseudomonas mendocina ymp]
          Length = 323

 Score =  183 bits (465), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 43/277 (15%), Positives = 99/277 (35%), Gaps = 20/277 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D++    Q  KF   +HS       +   +           
Sbjct: 59  ERFARYTRISMFNLLRRSADVAVGGVQVMKFGEYVHSLYVPTSLNLVKMKPLRGTGLFIL 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q    L +      +    
Sbjct: 119 DAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLDQAFVDLREAWHAVMD---- 173

Query: 160 LEDFYDIDYLKKNTNR-LSN-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                + +Y+    N  L+N     E V     ++ ++       + +P   +++     
Sbjct: 174 ----INFEYVNSEVNPALANIVSPSEVVVVSTFHIELDGGGGDLHITMPYS-MIEPIREM 228

Query: 214 LSSQNKS--ENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S  ++Q E  I         ++V +   +  ++  L+D++ ++ G VIP    E
Sbjct: 229 LDAGFQSDVDDQDERWIKALREDILDVSVPLAATVARRQLKLRDILHMQPGDVIPVELPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
               I+ ANG   +  +LG    N  +++ + I   +
Sbjct: 289 N--VIMRANGVPTFKVKLGAHKGNLALQVLEPIERQR 323


>gi|114320135|ref|YP_741818.1| flagellar motor switch protein FliM [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114226529|gb|ABI56328.1| flagellar motor switch protein FliM [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 395

 Score =  183 bits (464), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 38/272 (13%), Positives = 91/272 (33%), Gaps = 7/272 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + +         +    ++S    +  KF   +H+       +   +           
Sbjct: 58  ERFARLFRIGLFNMLRRTPEVSVVGVEMMKFGEYVHTLFVPTSLNLMRVHPLRGTGLFII 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  +++N  G       ++  R  +  E ++ +  I Q    L +  +    +   
Sbjct: 118 DPKLVFIVVDNFFGGDGRFFVKIEGREFTPTELRVIRMLIDQAFENLEEAWNPVMNAEF- 176

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK 219
            E  +     +       +E V     ++ ++       + +P  T+++     L +  +
Sbjct: 177 -EYMHSEVNPQFANIVSPSEVVVVSKFHVELDGGGGDIHVTLPY-TMIEPIRELLDAGVQ 234

Query: 220 SEN--QSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
           S+     E        +     V + + +   + +L+DV+ +K G +IP    E     +
Sbjct: 235 SDRNEVDERWTRSLREEMKFAEVELSSVLTEVEVSLRDVMNMKPGDIIPVELPE--AVKV 292

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
            A    ++    G    N  I+IT+RI    +
Sbjct: 293 YAEDMPVFRGRYGVRHGNTAIKITERIQPRAE 324


>gi|163794148|ref|ZP_02188121.1| flagellar motor switch protein FliM [alpha proteobacterium BAL199]
 gi|159180762|gb|EDP65281.1| flagellar motor switch protein FliM [alpha proteobacterium BAL199]
          Length = 341

 Score =  183 bits (464), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 44/269 (16%), Positives = 106/269 (39%), Gaps = 6/269 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + +    +     +V++S  +  S +F   ++S     + S      W +   +   
Sbjct: 75  RLVRMMSTSLRNFTSDNVEVSLDNITSIRFGDYLNSIPLPAMLSVFKAEEWDNFGLLVVD 134

Query: 101 NNLVITLLENLLGASHETIP-QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           + L+ ++++ LLG    T   ++  R  +T+E+ L +R +  + + L+         +  
Sbjct: 135 SALIYSIVDVLLGGRRGTAAMRIEGRPYTTIERNLVERMVTVVLSDLSAAFDPLSPVTFR 194

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
            +     +       R +N  V    + + +E+      L++P  TL  ++  L+ +   
Sbjct: 195 FDRLET-NPRFATIARPANAAVLA-RLRIDMEDRGGRLELMLPYATLEPVRELLLQMFMG 252

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K   +        A + +  +V +D  ++     L DV+ LK G  I       +   +
Sbjct: 253 EKFG-RDSIWETHLANELWNTDVELDAVLDEIVMPLHDVLNLKPGSRILLNAMPNSTIDM 311

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINF 306
                 ++S ++GR   +  +RI++R+  
Sbjct: 312 RCGNVSLFSGKMGRKNGSIAVRISNRLRK 340


>gi|330502773|ref|YP_004379642.1| flagellar motor switch protein FliM [Pseudomonas mendocina NK-01]
 gi|328917059|gb|AEB57890.1| flagellar motor switch protein FliM [Pseudomonas mendocina NK-01]
          Length = 323

 Score =  182 bits (463), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 42/277 (15%), Positives = 99/277 (35%), Gaps = 20/277 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D++    Q  KF   +HS       +   +           
Sbjct: 59  ERFARYTRISMFNLLRRSADVAVGGVQVMKFGEYVHSLYVPTSLNLVKMKPLRGTGLFIL 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q    L +      +    
Sbjct: 119 DAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLDQAFVDLREAWHAVMD---- 173

Query: 160 LEDFYDIDYLKKNTNR-LSN-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                + +Y+    N  L+N     E V     ++ ++       + +P   +++     
Sbjct: 174 ----INFEYVNSEVNPALANIVSPSEVVVVSTFHIELDGGGGDLHITMPYS-MIEPIREM 228

Query: 214 LSSQNKS--ENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S  ++Q E  I         ++V +   +  ++  L+D++ ++ G VIP    E
Sbjct: 229 LDAGFQSDVDDQDERWIKALREDILDVSVPLAATVARRQLKLRDILHMQPGDVIPVELPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
               ++ ANG   +  +LG    N  +++ + I   +
Sbjct: 289 N--VVMRANGVPTFKVKLGAHKGNLALQVLEPIERQR 323


>gi|288962686|ref|YP_003452980.1| flagellar motor switch protein [Azospirillum sp. B510]
 gi|288914952|dbj|BAI76436.1| flagellar motor switch protein [Azospirillum sp. B510]
          Length = 374

 Score =  182 bits (463), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 36/318 (11%), Positives = 114/318 (35%), Gaps = 26/318 (8%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           +   +++K+  P+  ++  R+                        L    ++    +V+ 
Sbjct: 80  VSSTTVNKDRLPMLDVVFDRMVR---------------------MLNTSLRQFASTNVEA 118

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S +  +  +++    + +   +   A    W +   +   + L+  +++ LLG       
Sbjct: 119 SLSKIEWLRYTDFQDAIELPALIGVARAEPWDNQMLVTIDSALIYCMMDVLLGGRRSRPG 178

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++  R+ +++E+K+ +R +  +   L Q      +     +           T   +   
Sbjct: 179 RIDGRAYTSIERKMTERMMKVVLQDLGQSFDPLAQVDFVFDRLEVNPQFATITRATN--A 236

Query: 181 VTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLIDPFARKTYQL 238
           +  + + + +E       ++IP  TL  ++  L+ +    K  +           +  + 
Sbjct: 237 IIRVRIAVEVERRTGHIDIVIPYATLEPIRGKLVQMFMGEKFGH-DTVWESHLKNELMRS 295

Query: 239 NVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTI 298
            + +   +   K  L +V+  + GQ +       +  ++ +    +++  +G+   N  +
Sbjct: 296 KLELVAVLAETKVPLGEVLAWQKGQSLKLRISPDSTVMVFSKTIPLFAGHMGQRNDNIAV 355

Query: 299 RITDRINFDQKSLKNFLH 316
           +I   ++  Q+ +   L 
Sbjct: 356 KIDTDLDTKQELIDGLLS 373


>gi|118588708|ref|ZP_01546116.1| flagellar motor switch protein M [Stappia aggregata IAM 12614]
 gi|118438694|gb|EAV45327.1| flagellar motor switch protein M [Stappia aggregata IAM 12614]
          Length = 412

 Score =  182 bits (463), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 46/277 (16%), Positives = 104/277 (37%), Gaps = 6/277 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              +      +     +V++S  S  S +F   ++S     +        W     I   
Sbjct: 128 RLVRLTTTSLRNFTSDNVEVSLDSISSVRFGDYLNSIPLPAILGVFKAEEWDGFGLITVE 187

Query: 101 NNLVITLLENLL-GASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           ++L+ ++++ LL G    +  ++  R  +T+E  L ++ +A I        +       N
Sbjct: 188 SSLIYSIIDVLLGGGRGTSAVRVEGRPYTTIETGLVQQMVALILQDAEHAFAPLSPVHFN 247

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
           LE     +      +R +N     + + + +E+   S  +++P  TL  ++  L+ +   
Sbjct: 248 LERLET-NPRFAAISRPAN-AAILVELRIDMEDRGGSVEIMMPYATLEPIRDLLLQMFMG 305

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K   +        A + +   V +D  +      L  V++L +GQ + F        ++
Sbjct: 306 EKFG-RDPIWEGHLATEIHAAEVEVDAVLYETYLPLGRVLSLDVGQTLVFDKEPTDPVMI 364

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
                 +    LG+V  +  IR+   +   + +L  F
Sbjct: 365 KCGNIPLTEGTLGKVDDSIAIRVAKNLRKPKMTLAAF 401


>gi|15596640|ref|NP_250134.1| flagellar motor switch protein FliM [Pseudomonas aeruginosa PAO1]
 gi|107100877|ref|ZP_01364795.1| hypothetical protein PaerPA_01001907 [Pseudomonas aeruginosa PACS2]
 gi|116049388|ref|YP_791809.1| flagellar motor switch protein FliM [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218892684|ref|YP_002441553.1| flagellar motor switch protein FliM [Pseudomonas aeruginosa LESB58]
 gi|254234542|ref|ZP_04927865.1| flagellar motor switch protein FliM [Pseudomonas aeruginosa C3719]
 gi|254239793|ref|ZP_04933115.1| flagellar motor switch protein FliM [Pseudomonas aeruginosa 2192]
 gi|296390190|ref|ZP_06879665.1| flagellar motor switch protein FliM [Pseudomonas aeruginosa PAb1]
 gi|313106442|ref|ZP_07792673.1| flagellar motor switch protein FliM [Pseudomonas aeruginosa 39016]
 gi|12230925|sp|Q51465|FLIM_PSEAE RecName: Full=Flagellar motor switch protein FliM
 gi|9947394|gb|AAG04832.1|AE004574_3 flagellar motor switch protein FliM [Pseudomonas aeruginosa PAO1]
 gi|115584609|gb|ABJ10624.1| flagellar motor switch protein FliM [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126166473|gb|EAZ51984.1| flagellar motor switch protein FliM [Pseudomonas aeruginosa C3719]
 gi|126193171|gb|EAZ57234.1| flagellar motor switch protein FliM [Pseudomonas aeruginosa 2192]
 gi|218772912|emb|CAW28724.1| flagellar motor switch protein FliM [Pseudomonas aeruginosa LESB58]
 gi|310879175|gb|EFQ37769.1| flagellar motor switch protein FliM [Pseudomonas aeruginosa 39016]
          Length = 323

 Score =  182 bits (463), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 42/277 (15%), Positives = 98/277 (35%), Gaps = 20/277 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D++    Q  KF   +HS       +   +           
Sbjct: 59  ERFARYTRISMFNLLRRSADVAVGGVQVMKFGEYVHSLYVPTSLNLVKMKPLRGTALFIL 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q    L +      E    
Sbjct: 119 DAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLEQAFVDLKEAWQAVLE---- 173

Query: 160 LEDFYDIDYLKKNTNR-LSN-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                + +Y+    N  ++N     E V     ++ ++       + +P   +++     
Sbjct: 174 ----MNFEYVNSEVNPAMANIVSPSEVVVVSTFHIELDGGGGDLHITMPYS-MIEPIREM 228

Query: 214 LSSQNKS--ENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S  ++Q E  I         + V +   +  ++  L+D++ ++ G VIP    E
Sbjct: 229 LDAGFQSDHDDQDERWIKALREDVLDVQVPLGATVVRRQLKLRDILHMQPGDVIPVEMPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
               ++ ANG   +  +LG    N  ++I + +   +
Sbjct: 289 H--MVMRANGVPAFKVKLGAHKGNLALQILEAVERSR 323


>gi|152984239|ref|YP_001349238.1| flagellar motor switch protein FliM [Pseudomonas aeruginosa PA7]
 gi|150959397|gb|ABR81422.1| flagellar motor switch protein FliM [Pseudomonas aeruginosa PA7]
          Length = 323

 Score =  182 bits (463), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 42/277 (15%), Positives = 98/277 (35%), Gaps = 20/277 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D++    Q  KF   +HS       +   +           
Sbjct: 59  ERFARYTRISMFNLLRRSADVAVGGVQVMKFGEYVHSLYVPTSLNLVKMKPLRGTALFIL 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q    L +      E    
Sbjct: 119 DAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLEQAFVDLKEAWQAVLE---- 173

Query: 160 LEDFYDIDYLKKNTNR-LSN-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                + +Y+    N  ++N     E V     ++ ++       + +P   +++     
Sbjct: 174 ----MNFEYVNSEVNPAMANIVSPSEVVVVSTFHIELDGGGGDLHITMPYS-MIEPIREM 228

Query: 214 LSSQNKS--ENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S  ++Q E  I         + V +   +  ++  L+D++ ++ G VIP    E
Sbjct: 229 LDAGFQSDHDDQDERWIKALREDVLDVQVPLGATVVRRQLKLRDILHMQPGDVIPVEMPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
               ++ ANG   +  +LG    N  ++I + +   +
Sbjct: 289 H--MVMRANGVPAFKVKLGAHKGNLALQIVEAVERSR 323


>gi|120554904|ref|YP_959255.1| flagellar motor switch protein FliM [Marinobacter aquaeolei VT8]
 gi|120324753|gb|ABM19068.1| flagellar motor switch protein FliM [Marinobacter aquaeolei VT8]
          Length = 332

 Score =  182 bits (463), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 48/272 (17%), Positives = 100/272 (36%), Gaps = 20/272 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +  + D+S    Q  KF   IH+       +   +           
Sbjct: 57  ERFARYTRISLFNLLRRNADVSTGGVQIMKFGEYIHTLYVPTSLNLCKVRPLRGTSLFVL 116

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q+   + +      +    
Sbjct: 117 DAKLVFKLVDNFFGGEGR-HAKIEGREFTPTETRIVQMVLNQVFHDMKEAWHAVLQVE-- 173

Query: 160 LEDFYDIDYLKKNTNR-LSN-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                  +YL    N  ++N     E V     ++ ++         +P   +++     
Sbjct: 174 ------FEYLSSEVNPAMANIVSPSEVVVVSTFHIELDGGGGELHFALPYS-MIEPIRDV 226

Query: 214 LSSQNKS--ENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S  ++  E  ++       ++NV I+T +  ++ +L+D+  +K G VIP    E
Sbjct: 227 LDAGVQSDIDDVDERWVNALQEDIKEVNVPINTTVCRRRISLRDIARMKAGDVIPVEIPE 286

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                ++ANG  IY   LG       +RI DR
Sbjct: 287 H--LTVTANGIPIYKATLGTRDGKLALRIHDR 316


>gi|311695206|gb|ADP98079.1| flagellar motor switch protein FliM-like protein [marine bacterium
           HP15]
          Length = 332

 Score =  182 bits (462), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 47/277 (16%), Positives = 103/277 (37%), Gaps = 20/277 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        M  + D+S    Q  KF   IH+       +   +           
Sbjct: 57  ERFARYTRISLFNLMRRNADVSTGGVQIMKFGEYIHTLYVPTSLNLCKVRPLRGTSLFVL 116

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q+   + +      +    
Sbjct: 117 DAKLVFKLVDNFFGGEGR-HAKIEGREFTPTETRIVQMVLDQVFHDMKEAWHAVLKV--- 172

Query: 160 LEDFYDIDYLKKNTNR-LSN-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                D +YL    N  ++N     E V     ++ ++         +P   +++     
Sbjct: 173 -----DFEYLSSEVNPAMANIVSPSEVVVVSTFHIELDGGGGELHFALPYS-MIEPIRDV 226

Query: 214 LSSQNKS--ENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S  ++  E  ++       +++V I+T +  ++ +L+D+  +K G +IP    E
Sbjct: 227 LDAGVQSDIDDVDERWVNALQEDIKEVSVPINTTVCRRRISLRDIAKMKAGDIIPVEIPE 286

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
                ++ANG  IY   LG       +RI +R +  +
Sbjct: 287 H--LTVTANGIPIYKATLGTRDGKLALRIHERASVPK 321


>gi|327481259|gb|AEA84569.1| flagellar motor switch protein FliM [Pseudomonas stutzeri DSM 4166]
          Length = 323

 Score =  182 bits (461), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 44/273 (16%), Positives = 100/273 (36%), Gaps = 20/273 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D+S    Q  KF   +HS       +   +           
Sbjct: 59  ERFARYTRISMFNLLRRSADVSVGGVQVMKFGEYVHSLYVPTSLNLVKMKPLRGTALFIL 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q  A L +      +    
Sbjct: 119 DAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLDQAFADLKEAWHAVLDV--- 174

Query: 160 LEDFYDIDYLKKNTNR-LSN-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                + +Y+    N  L+N     E V     ++ +++      + +P   +++     
Sbjct: 175 -----NFEYVNSEVNPALANIVSPSEVVVVSTFHIELDSGGGDLHVTMPYS-MIEPIREM 228

Query: 214 LSSQNKSE--NQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+  +Q E  +         +NV +   +  ++  L+D++ ++ G VIP    E
Sbjct: 229 LDAGFQSDVSDQDERWVKALREDILDVNVPLGATVVRRQLKLRDILNMQPGDVIPVEMPE 288

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
               I+ ANG   +  +LG    N  +++ + +
Sbjct: 289 D--MIMRANGMPAFKVKLGAHKGNLALQVLEPV 319


>gi|74317625|ref|YP_315365.1| flagellar motor switch protein FliM [Thiobacillus denitrificans
           ATCC 25259]
 gi|74057120|gb|AAZ97560.1| flagellar motor switch protein FliM [Thiobacillus denitrificans
           ATCC 25259]
          Length = 334

 Score =  182 bits (461), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 43/270 (15%), Positives = 98/270 (36%), Gaps = 7/270 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       +   V+IS    +  K+S  I +       +            +  
Sbjct: 59  ERFARLLRIGLYNFLRRGVEISVGPVRVSKYSEFIRNLVVPTNLNLVQFKPLRGTALMIF 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           + +LV  +++NL G       ++  R  +  E ++ +R +  +     +           
Sbjct: 119 NPDLVFLMVDNLFGGDGRFHTRVEGRDFTQTEHRIIQRILNIVFEAYGKSWEPVYPIEFE 178

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK 219
                +++    N     NE V  +   + +  ++      +P   +++     L+S  +
Sbjct: 179 FIR-SEMNTQFANI-ATPNEVVVAVTFAIELGQISGEMHFCMPYS-MIEPIKDLLTSSLQ 235

Query: 220 SEN--QSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
           +EN    +  I    ++     V I   +   + +L+D+V LK+G VIP        A +
Sbjct: 236 AENLEVDKRWIRLMRQQIQLAEVEIVADLGTAEVSLRDIVNLKVGDVIPLDIPPTIEAKV 295

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFD 307
             +G  +  C  G+    YT+R+   ++  
Sbjct: 296 --DGVPVMECAYGKFNGQYTLRVEKLLSTS 323


>gi|149377878|ref|ZP_01895607.1| flagellar motor switch protein M [Marinobacter algicola DG893]
 gi|149357820|gb|EDM46313.1| flagellar motor switch protein M [Marinobacter algicola DG893]
          Length = 332

 Score =  181 bits (460), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 48/272 (17%), Positives = 100/272 (36%), Gaps = 20/272 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +  + D+S    Q  KF   IH+       +   +           
Sbjct: 57  ERFARYTRISLFNLLRRNADVSTGGVQIMKFGEYIHTLYVPTSLNLCKVRPLRGTSLFVL 116

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q+   + +      +    
Sbjct: 117 DAKLVFKLVDNFFGGEGR-HAKIEGREFTPTETRIVQMVLDQVFHDMREAWHAVLKV--- 172

Query: 160 LEDFYDIDYLKKNTNR-LSN-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                D +YL    N  ++N     E V     ++ ++       + +P   +++     
Sbjct: 173 -----DFEYLSSEVNPAMANIVSPSEVVVVSTFHIELDGGGGELHMALPYS-MIEPIRDV 226

Query: 214 LSSQNKS--ENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S  ++  E  +         +NV I+T +  ++ +L+D+  LK G +IP    E
Sbjct: 227 LDAGVQSDIDDVDERWVSALQEDIKDVNVPINTTVCRRRISLRDIAKLKEGDIIPVEIPE 286

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                L+ANG  +Y   +G       +RI DR
Sbjct: 287 --LLTLTANGIPVYKATMGTRDGKLALRIHDR 316


>gi|88800464|ref|ZP_01116028.1| flagellar motor switch protein FliM [Reinekea sp. MED297]
 gi|88776794|gb|EAR08005.1| flagellar motor switch protein FliM [Reinekea sp. MED297]
          Length = 360

 Score =  181 bits (459), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 40/286 (13%), Positives = 102/286 (35%), Gaps = 20/286 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D++    Q  KF   +H+       +   +           
Sbjct: 57  ERFARYTRISMFNFLRRSADVATGGIQILKFGEYVHTLYVPTSLNLVKVRPLRGTALFIL 116

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  ++Q+   + +      +    
Sbjct: 117 DAKLVFKLVDNFFGGDGR-HAKIEGREFTPTEIRVVQMILSQVFQDMKEAWGAVLDV--- 172

Query: 160 LEDFYDIDYLKKNTNR-LSN-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                D +Y+    N  ++N     E V     ++ ++       + +P   +++     
Sbjct: 173 -----DFEYMSSEVNPAMANIVSPSEVVVVSTFHIELDGGGGDLHMTLPYS-MIEPVRDV 226

Query: 214 LSSQNKS--ENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S  +   E  ++          V  +  +  ++  L+++V L+ G VIP    E
Sbjct: 227 LDAGVQSDVDEIDERWVESLRHDILGAKVPTNAVVAEREIKLRELVDLQAGDVIPIDLPE 286

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLHK 317
                 +ANG  ++  +LG+ G N  +R+   +    + + +   +
Sbjct: 287 --TIKFTANGIPLFETKLGQCGDNLALRVERPVRKMSRDIGDMKTR 330


>gi|209964207|ref|YP_002297122.1| flagellar motor switch protein FliM [Rhodospirillum centenum SW]
 gi|7025351|gb|AAF35843.1|AF220001_1 polar motor switch protein FpiM [Rhodospirillum centenum]
 gi|209957673|gb|ACI98309.1| flagellar motor switch protein FliM [Rhodospirillum centenum SW]
          Length = 362

 Score =  181 bits (459), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 41/272 (15%), Positives = 102/272 (37%), Gaps = 6/272 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + +    +     +V++S     S +F   ++S     + +      W +   +   
Sbjct: 92  RLVRMMSTSLRNFTSDNVEVSLDQISSVRFGDYLNSIPLPAMLAVFKAEEWDNYGLMVID 151

Query: 101 NNLVITLLENLLGASHETIP-QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           + L+ ++++ LLG    T   ++  R  +T+E+ L +R +  + + L+         +  
Sbjct: 152 SALIYSIVDVLLGGRRGTAAMRIEGRPYTTIERNLVERMVHVVLSDLSAAFDPLSPVTFR 211

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
            +     +       R +N     + + + +E+      L+IP  TL  ++  L+ +   
Sbjct: 212 FDRLET-NPRFATIARQAN-AAVLVKLRIDMEDRGGRLELLIPYATLEPVRELLLQMFMG 269

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K   +        A + +  +V++   ++    +L DV+  +IG  +           L
Sbjct: 270 EKFG-RDSIWETHLASELWMTDVHLSAVLDEITLSLYDVLNWRIGSRVLLNVAPDDTIEL 328

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
                 ++   +GR G N  +RI       ++
Sbjct: 329 RCGDVPMFLGRMGRKGGNIAVRIDREAPKPEQ 360


>gi|126665008|ref|ZP_01735991.1| flagellar motor switch protein M [Marinobacter sp. ELB17]
 gi|126630378|gb|EBA00993.1| flagellar motor switch protein M [Marinobacter sp. ELB17]
          Length = 331

 Score =  180 bits (457), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 44/272 (16%), Positives = 97/272 (35%), Gaps = 20/272 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D+S +  Q  KF   +H+       +   +           
Sbjct: 57  ERFARYTRISLFNLLRRTADVSTSGVQIMKFGEYVHTLYVPTSLNLCKIRPLRGTSLFVL 116

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q+   + +   T  +    
Sbjct: 117 DAKLVFKLVDNFFGGQGR-HAKIEGREFTPTENRIVQMMLNQVFHDMQEAWQTVLKV--- 172

Query: 160 LEDFYDIDYLKKNTNR-LSN-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                + +YL    N  ++N     E V     ++ ++         +P   +++     
Sbjct: 173 -----NFEYLSSEVNPSMANIVSPSEVVVVSTFHIELDGGGGELHFALPYS-MIEPIRDV 226

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+    D   +         ++V +++ I  +  +L++V   K G +IP    E
Sbjct: 227 LDAGVQSDIDDTDERWVSALQEDIKTVSVAVNSTICRRHISLREVAKFKAGDIIPIEMAE 286

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                ++ANG  IY+  LG       +RI  R
Sbjct: 287 H--LTVTANGIPIYTATLGTRDDKLALRIHGR 316


>gi|152997440|ref|YP_001342275.1| flagellar motor switch protein FliM [Marinomonas sp. MWYL1]
 gi|150838364|gb|ABR72340.1| flagellar motor switch protein FliM [Marinomonas sp. MWYL1]
          Length = 324

 Score =  180 bits (457), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 39/271 (14%), Positives = 98/271 (36%), Gaps = 20/271 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D+S    Q  KF   +H+       +        S      
Sbjct: 58  ERFARYTRISLFNMLRRTADVSSGGLQVMKFGEYVHTLYVPTSLNLVKFRPLRSTALFIL 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q+   L +  +   +    
Sbjct: 118 DAKLVFKLVDNFFGGDGR-HAKIEGREFTPTEIRIVQLMLEQVFKDLTEAWAPVLKLE-- 174

Query: 160 LEDFYDIDYLKKNTNR-LSN-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                 ++Y+    N  ++N     E V     ++ ++       + +P   +++     
Sbjct: 175 ------LEYISSEVNPAMANIVSPSEVVVVSTFHIELDGGGGELHITLPYS-MIEPVREL 227

Query: 214 LSSQNKS--ENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S  + + +       +    ++V +   +  +K +L +V+  K G +IP    E
Sbjct: 228 LDAGVQSDVDEKDDRWGKSLEQDVKDIDVRLSVSVANRKISLGEVLKFKAGDIIPIEMPE 287

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITD 302
                + ANG   +  +LG   + Y++++ +
Sbjct: 288 --FVTVRANGVPTFKGKLGVSNERYSVQMQE 316


>gi|254418956|ref|ZP_05032680.1| flagellar motor switch protein FliM [Brevundimonas sp. BAL3]
 gi|196185133|gb|EDX80109.1| flagellar motor switch protein FliM [Brevundimonas sp. BAL3]
          Length = 346

 Score =  180 bits (456), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 39/270 (14%), Positives = 99/270 (36%), Gaps = 6/270 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + +    +     +V++S  +  S +F   ++S     + +        +   +   
Sbjct: 71  RLVRLMTTSLRNFTSDNVEVSLDNISSIRFGDYLNSIPLPAILAVFRAEELDNYGLLTVD 130

Query: 101 NNLVITLLENLLGASHETIP-QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           +NL+ ++++ LLG    T   ++  R  +T+E+ L +R +  +              + N
Sbjct: 131 SNLIYSIVDVLLGGRRGTAALRIEGRPYTTIERVLVQRMVEVVLNDARLAFEPLTPVTFN 190

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
           L+               +      I + + +E+      L++P  TL  ++  L+     
Sbjct: 191 LDRLETNPRFAAIARPANAA--ILIKLRIDMEDRGGRIELLLPYATLEPIRKMLLQQFMG 248

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K   +        A + +     +   ++ +   L  V+ LK+G  +       +   +
Sbjct: 249 EKFG-RDNIWEGHLATELWTTETEVRAVLDEQMMPLSTVLNLKVGDTMMLNATPDSEVSI 307

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFD 307
            A    + +  +GR G++  +RI   +N +
Sbjct: 308 RAGAIPLTTGRMGRKGQHIAVRIEGPVNPE 337


>gi|170747253|ref|YP_001753513.1| flagellar motor switch protein FliM [Methylobacterium radiotolerans
           JCM 2831]
 gi|170653775|gb|ACB22830.1| flagellar motor switch protein FliM [Methylobacterium radiotolerans
           JCM 2831]
          Length = 404

 Score =  179 bits (455), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 39/274 (14%), Positives = 98/274 (35%), Gaps = 6/274 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + L    +     +V+++  +  S +F   +++     +        W ++  +   
Sbjct: 121 RMIRLLSTSLRNLFQDNVEVTLDNITSVRFGDYLNAIPLPTLLGVFRAEQWENSGLVTVD 180

Query: 101 NNLVITLLENLLGA-SHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           +NL     + LLG     +  +L  R  + +E  L +R +  +   L          S  
Sbjct: 181 SNLAYATFDLLLGGKRGGSSSRLDGRPFTAIEMTLVRRLVEIVLGDLEMSFQPLSPVSFG 240

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK 219
           ++           T          I++ + ++       ++ P  T ++     L+    
Sbjct: 241 IDRIETNPRFATIT--RPGNAAILISLRLDVDGRGGMLQILFPYAT-IEPIRELLTQSFM 297

Query: 220 SENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            E    D       A + +Q +V +D  ++     LK V++LK+G+ + F  +      +
Sbjct: 298 GEKLGRDHVWEGHLATEIWQADVTMDAVLHEMMLPLKQVMSLKVGETLMFDAKPSDLITV 357

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQKSL 311
                 +    +GRV  +  +++T  +   + ++
Sbjct: 358 RCGDWALTQGRIGRVDGHIAVQVTRPLRRSRTTI 391


>gi|296122747|ref|YP_003630525.1| flagellar motor switch protein FliM [Planctomyces limnophilus DSM
           3776]
 gi|296015087|gb|ADG68326.1| flagellar motor switch protein FliM [Planctomyces limnophilus DSM
           3776]
          Length = 375

 Score =  179 bits (454), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 54/289 (18%), Positives = 106/289 (36%), Gaps = 9/289 (3%)

Query: 33  KISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWS 92
           +   +L   + +         +   V++   S     +S  + S +    F+        
Sbjct: 65  RAFQALHEGFSREFGAALSGMLRAIVEVKLISVDQLTYSEFVFSLENPTCFNLLESKGLE 124

Query: 93  SNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCIST 152
            +  +  S +++  +++ LLG   E+IP + +R L+ +E +L  R    +   L      
Sbjct: 125 GHLILDLSPSIIFPIVDRLLGGGKESIPSIPSRPLTEIELQLVSRITLLVINGLENAWHN 184

Query: 153 TQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLI 212
                  +        L +      NE +  ++  +T+  V     L IP  T ++    
Sbjct: 185 VCSLGLKVTQIESNPQLVQIV--PPNEVIVLVSFEITMGEVRGIMNLCIPFNT-IEPLSG 241

Query: 213 SLSSQNKSENQSEDLIDPFARKTYQ---LNVNIDTRINLKK--TTLKDVVTLKIGQVIPF 267
            LSS   S  Q + L DP  R   +       +   +NL     T +D+  L +G VI  
Sbjct: 242 KLSSDTWSAYQKKGL-DPKQRVILEDGLSKAAVKMIVNLAHTRLTARDLAHLAVGDVIMT 300

Query: 268 LHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLH 316
            H ++    +   G  ++  + G V     IR+T  +   +  L+  L 
Sbjct: 301 EHPKEDGLEVVVEGCPMFMAKPGAVKGKKAIRVTGMVAHSRDILREKLQ 349


>gi|315498450|ref|YP_004087254.1| flagellar motor switch protein flim [Asticcacaulis excentricus CB
           48]
 gi|315416462|gb|ADU13103.1| flagellar motor switch protein FliM [Asticcacaulis excentricus CB
           48]
          Length = 387

 Score =  179 bits (454), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 40/272 (14%), Positives = 101/272 (37%), Gaps = 6/272 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + +    +     +V++S  +  S +F   ++S     + +        +   +   
Sbjct: 110 RLVRLMTTSLRNFTSDNVEVSLDNISSIRFGDYLNSIPLPAILAVFRAEELDNYGLLTVD 169

Query: 101 NNLVITLLENLLGASHETIP-QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           +NL+ ++++ LLG    T   ++  R  +T+E+ L +R +  I              + N
Sbjct: 170 SNLIYSIVDVLLGGRRGTAALRIEGRPYTTIERVLVQRMVEVILHDAKMAFEPLTPVNFN 229

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
           L+               +      + + + +E+      L++P  TL  ++  L+     
Sbjct: 230 LDRLETNPRFAAIARPANAA--ILVKLRIDMEDRGGRVELLLPYATLEPIRKMLLQQFMG 287

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K   +        A + +   + +   ++ ++  L +V+ LK+G+ I       +   L
Sbjct: 288 EKFG-RDNIWESHLATELWTTQMEVRAVLDEQQMPLSEVLNLKVGETIVLNATADSPIEL 346

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
                 + + ++GR G N  +R+   +    K
Sbjct: 347 RCGTIPLTNGKMGRKGHNIAVRVDHPLAASTK 378


>gi|331006682|ref|ZP_08329960.1| Flagellar motor switch protein FliM [gamma proteobacterium
           IMCC1989]
 gi|330419514|gb|EGG93902.1| Flagellar motor switch protein FliM [gamma proteobacterium
           IMCC1989]
          Length = 340

 Score =  179 bits (454), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 47/277 (16%), Positives = 102/277 (36%), Gaps = 20/277 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D+S       KF   +H+       +            +  
Sbjct: 57  ERFARYTRISMFNLLRRTADVSVGGINIQKFGEYVHTLYVPTSLNMVKFRPLRGTALVVF 116

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q    + +           
Sbjct: 117 DAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLEQAFIDMKEAWRAVL----- 170

Query: 160 LEDFYDIDYLKKNTNR-LSN-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                D +++    N  ++N     E V   + ++ ++       + IP   +++     
Sbjct: 171 ---PIDFEHVNSEVNPSMANIVSPSEVVVVSSFHVELDGGGGEMHITIPYS-MIEPIREM 226

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S++   D   ++       Q NV +DT     K  LKD+V LK G VIP    E
Sbjct: 227 LDAGLQSDSDERDDRWVNSLREDIMQANVRLDTNFVQSKILLKDIVDLKEGDVIPIELPE 286

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
           +   I +ANG  ++  ++G+   N+ +++ + I   +
Sbjct: 287 E--YITNANGVPMFKVDIGQSNGNFALKVNEVIERTK 321


>gi|329888223|ref|ZP_08266821.1| flagellar motor switch protein FliM [Brevundimonas diminuta ATCC
           11568]
 gi|328846779|gb|EGF96341.1| flagellar motor switch protein FliM [Brevundimonas diminuta ATCC
           11568]
          Length = 352

 Score =  179 bits (453), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 40/270 (14%), Positives = 100/270 (37%), Gaps = 6/270 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + +    +     +V++S  +  S +F   ++S     + +        +   +   
Sbjct: 76  RLVRLMTTSLRNFTSDNVEVSLDTISSIRFGDYLNSIPLPAILAVFRAEELDNYGLLTVD 135

Query: 101 NNLVITLLENLLGASHETIP-QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           +NL+ ++++ LLG    T   ++  R  +T+E+ L +R +  I     Q          N
Sbjct: 136 SNLIYSIVDVLLGGRRGTAALRIEGRPYTTIERVLVQRMVEVILNDARQAFEPLTPVHFN 195

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
           L+                      + + + +E+      L++P  TL  ++  L+     
Sbjct: 196 LDRLETNPRFAAIARPA--NAAILVKLRIDMEDRGGRVELLLPYSTLEPIRKMLLQQFMG 253

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K   +        A + +     +   ++ ++  L  V+ LK+G  +      ++   +
Sbjct: 254 EKFG-RDNIWEGHLATELWTTETEVRCVLDEQQMPLSKVLDLKVGDTLMLNVTPESEVSV 312

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFD 307
            A    + +  +GR G++  +R+   I+ D
Sbjct: 313 RAGSIPLTTGRMGRKGQHIAVRVEGPISTD 342


>gi|226941271|ref|YP_002796345.1| flagellar motor switch protein FliM [Laribacter hongkongensis
           HLHK9]
 gi|226716198|gb|ACO75336.1| FliM [Laribacter hongkongensis HLHK9]
          Length = 329

 Score =  178 bits (452), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 41/273 (15%), Positives = 96/273 (35%), Gaps = 7/273 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       +  + +IS    +  K+S  I +       +   +        +  
Sbjct: 57  ERFARNLRIGLFNFIRRNAEISVGPVKVQKYSEFIRNLVVPTNLNLCHVKPLRGTALLIF 116

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
             +LV  +++NL G+      ++  R  +  E+++ +R +  + +   +           
Sbjct: 117 DPDLVFLVVDNLFGSDGRYHVRVEGRDFTPTEQRIIRRLLDVVFSEYQKAWEPVYPIEFL 176

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK 219
                +++    N      E V ++   + +      F + +P   +++     LSS   
Sbjct: 177 YMR-SEMNTQFANI-ATPTEVVVSMTFRIELGAGGGDFHVCMPYS-MVEPIRDQLSSTMA 233

Query: 220 SENQ--SEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
           ++        +   +R+     V +   +   + TL D++ LK G VIP    E   A +
Sbjct: 234 ADRTEIDNRWVSLLSRQVQIAEVELVATLAEAQITLGDILNLKTGDVIPVEIPESIVADV 293

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
           S  G  +  C  G     Y +R+   +    + 
Sbjct: 294 S--GIPVLDCRYGTANGQYALRVERLLAGAHEL 324


>gi|114570494|ref|YP_757174.1| flagellar motor switch protein FliM [Maricaulis maris MCS10]
 gi|114340956|gb|ABI66236.1| flagellar motor switch protein FliM [Maricaulis maris MCS10]
          Length = 376

 Score =  178 bits (452), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 39/269 (14%), Positives = 101/269 (37%), Gaps = 6/269 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + +    +     +V++S  +  S +F   ++S     + +        +   +   
Sbjct: 101 RLVRLMTTSLRNFTSDNVEVSLDNISSIRFGDYLNSIPLPAILAVFRAQQLDNYGLLTVD 160

Query: 101 NNLVITLLENLLGASHETIP-QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           +NL+ ++++ LLG    T   ++  R  +T+E+ L +R I  +     Q  +   +   +
Sbjct: 161 SNLIYSIVDVLLGGRRGTSAMRIEGRPYTTIERMLVQRMIEVVLGDAKQAFAPLTDVEFD 220

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
           LE               +      + + + +E+      L++P  TL  ++  L+     
Sbjct: 221 LERVETNPRFAAIARPANAA--ILVKLRIDMEDRGGRIELLLPYATLEPIRKMLLQQFMG 278

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K   +        A + +   + +   ++ ++ +L  V  LK+G  +       +   L
Sbjct: 279 EKFG-RDNIWEGHLATELWSTKMEVQAVLDEQRVSLGTVANLKVGDTLYLDASPSSDVEL 337

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINF 306
                 +    +GR+G N  +R++  ++ 
Sbjct: 338 RCGQVPLTRGRMGRIGHNVALRLSGPLSP 366


>gi|302383953|ref|YP_003819776.1| flagellar motor switch protein FliM [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302194581|gb|ADL02153.1| flagellar motor switch protein FliM [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 356

 Score =  178 bits (452), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 39/270 (14%), Positives = 99/270 (36%), Gaps = 6/270 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + +    +     +V++S  +  S +F   ++S     + +        +   +   
Sbjct: 80  RLVRLMTTSLRNFTSDNVEVSLDNISSIRFGDYLNSIPLPAILAVFRAEELDNYGLLTVD 139

Query: 101 NNLVITLLENLLGASHETIP-QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           +NL+ ++++ LLG    T   ++  R  +T+E+ L +R +  I A              N
Sbjct: 140 SNLIYSIVDVLLGGRRGTAALRIEGRPYTTIERVLVQRMVEVILADAQAAFEPLTPVHFN 199

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
           L+               +      + + + +E+      L++P  TL  ++  L+     
Sbjct: 200 LDRLETNPRFAAIARPANAA--ILVKLRIDMEDRGGRVELLLPYATLEPIRKMLLQQFMG 257

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K   +        A + +  +  +   ++ +   L  V+ LK+G  +       +   +
Sbjct: 258 EKFG-RDNIWEGHLATELWTTDTEVRAVLDEQSCPLSTVLNLKVGDTLMLNATPDSDISI 316

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFD 307
                 + +  +GR G++  IR+   I+ +
Sbjct: 317 RCGSIPVTTGRMGRKGQHIAIRVEGPISVE 346


>gi|330721397|gb|EGG99462.1| Flagellar motor switch protein FliM [gamma proteobacterium
           IMCC2047]
          Length = 329

 Score =  177 bits (449), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 52/275 (18%), Positives = 103/275 (37%), Gaps = 20/275 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + +F  +     +     ++    ++ KFS            S   +           
Sbjct: 63  ERFARFTEQSMFNLLRETPVVTAAKIENIKFSEYTQMLGIPSSLSLVKIHPLRGTAMFVL 122

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
             +LV+ L++   G        +  R  +  E+++ ++ ++Q+   + Q   T  +    
Sbjct: 123 DADLVVNLVDRFFGG-GVHDNAIGEREFTVTEQRIIQKVLSQVFVDMKQAWQTIMD---- 177

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                D +YL    N         +E V      + IE       + IP   +L+    +
Sbjct: 178 ----IDFEYLSNEENPAMIKAISPSEVVVLSTFEIKIEEKGGRIQVAIPYS-MLEPVREA 232

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L S  + +N+  D    +   R     +V I  R+  +K TL++++  K G VIP    E
Sbjct: 233 LDSGVQVDNEYTDGNWAEALQRDLRYASVPISCRVAERKITLREILNFKAGDVIPIDMPE 292

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
            +  IL ANG  IY   +G   ++  ++I  +I+ 
Sbjct: 293 SS--ILMANGVPIYEAAVGASNEHLALKIKRQIDR 325


>gi|289208344|ref|YP_003460410.1| flagellar motor switch protein FliM [Thioalkalivibrio sp. K90mix]
 gi|288943975|gb|ADC71674.1| flagellar motor switch protein FliM [Thioalkalivibrio sp. K90mix]
          Length = 324

 Score =  177 bits (448), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 33/267 (12%), Positives = 86/267 (32%), Gaps = 7/267 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       +    ++S    +  KFS  +HS       +               
Sbjct: 60  ERFARHLRVRLFNMLRRSAELSVVGTRVSKFSEYMHSLFVPTSLNLVRAHPLHGTGLFVF 119

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  + +E ++    +      + +      +    
Sbjct: 120 DPKLVFILVDNFFGGDGRYHTRIEGRDFTPMEMRVVHGILEGAFEDMVKAWQPVMDLRFE 179

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK 219
             +       +        E V     ++ ++    +    +P   +++     L +  +
Sbjct: 180 FLNSEV--NPQFANIVSPTEIVVISEFHIELDGGGGNLHFTLPYS-MIEPIREQLDTGLQ 236

Query: 220 SENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
           S+    D   +     +     V + + +   + T+++++ ++ G +IP    E     L
Sbjct: 237 SDRSDVDQRWMKALEEEIQDAEVEVSSTLTETEVTVQELLDIQPGDIIPINLPE--TVTL 294

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRI 304
                 ++  + G       I++TDRI
Sbjct: 295 KVEDIPLFRGKFGVSDGKNAIQVTDRI 321


>gi|87119476|ref|ZP_01075373.1| flagellar motor switch protein FliM [Marinomonas sp. MED121]
 gi|86164952|gb|EAQ66220.1| flagellar motor switch protein FliM [Marinomonas sp. MED121]
          Length = 322

 Score =  176 bits (447), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 42/277 (15%), Positives = 96/277 (34%), Gaps = 20/277 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D+S    Q  KF   +H+       +        S      
Sbjct: 58  ERFARYTRISLFNLLRRTADVSSGGLQIMKFGEYVHTLYVPTSLNLVKFRPLRSTALFIL 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q+   L +  +        
Sbjct: 118 DAKLVFKLVDNFFGGDGR-HAKIEGREFTPTEIRIVQLMLEQVFVDLTEAWAPVLSVE-- 174

Query: 160 LEDFYDIDYLKKNTNR-LSN-----EFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                 +DY+    N  ++N     E V     ++ ++       + +P   +++     
Sbjct: 175 ------LDYIGSEVNPAMANIVSPSEVVVVSTFHIELDGGGGELHITLPYS-MIEPVREL 227

Query: 214 LSSQNKS--ENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S  + + +       +   +LNV +   +      L+DV+  K G +IP    E
Sbjct: 228 LDAGVQSDVDEKDDRWGKSLQQDVKELNVELSAAVAHVDVPLQDVLKFKAGDIIPVDIPE 287

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
                + ANG      +LG   + Y++++ +     +
Sbjct: 288 --FITVRANGLPTIKGKLGVSNEKYSVQVVENYKLPK 322


>gi|188582489|ref|YP_001925934.1| flagellar motor switch protein FliM [Methylobacterium populi BJ001]
 gi|179345987|gb|ACB81399.1| flagellar motor switch protein FliM [Methylobacterium populi BJ001]
          Length = 405

 Score =  176 bits (447), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 36/273 (13%), Positives = 94/273 (34%), Gaps = 4/273 (1%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + L    +     +V+++  +  S +F   +++     +       SW  +  +   
Sbjct: 122 RMIRLLSTSLRNFFQDNVEVTLDNITSVRFGDYLNAIPLPTLLGVFKADSWEGSGLVTVE 181

Query: 101 NNLVITLLENLLGA-SHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
             L  + ++ LLG     +  +L  R  +T+E  L +R +  I   L             
Sbjct: 182 QTLAYSTMDLLLGGKRGGSSSRLDGRPFTTIEMSLVRRLVEIILTDLEMSFQPLSPVRFG 241

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISL-SSQN 218
           ++           T          I + + ++       ++ P  T+     + + S   
Sbjct: 242 IDRIETNPRFATIT--RPGNAAILITLKLDMDGRGGGMQILFPYATVEPIRDLLMQSFMG 299

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           +   + +      A + +Q +V ++  ++     LK V+ LK+G  + F  +      + 
Sbjct: 300 ERLGRDQVWESHLATEIWQADVEMEAVLHEVTLPLKRVLNLKVGDTLMFDRKPSDLITVR 359

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQKSL 311
                +    +GR+     +++   +   + +L
Sbjct: 360 CGDWALTQGRIGRIDDAIAVQVARPLRQSRTTL 392


>gi|121997289|ref|YP_001002076.1| flagellar motor switch protein FliM [Halorhodospira halophila SL1]
 gi|121588694|gb|ABM61274.1| flagellar motor switch protein FliM [Halorhodospira halophila SL1]
          Length = 381

 Score =  175 bits (445), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 46/308 (14%), Positives = 113/308 (36%), Gaps = 18/308 (5%)

Query: 8   KNTSPLHPILL---ARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           +++  L P       R+    G   T+E I+   G L++  L  + +       ++S T 
Sbjct: 30  EDSGELRPYTFTAEERIVR--GRMPTLEMINERFGRLFRIGLFNMLR----RTPEVSVTG 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +  KF   +H+       +   +     +        LV  +++N  G       ++  
Sbjct: 84  VEMMKFGEYVHTLFVPTSLNIIRVPPLRGSGLFVIDPKLVFLVVDNFFGGGGHFYLKVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTN-RLSNEFVTT 183
           R  +  E+++ +  + Q    L +  +          ++ +++   +  N     E V  
Sbjct: 144 REFTPTEQRVIRLMLDQAFDDLREAWNPVLGVDF---EYVNMEVNPQFANIVSPTEVVVV 200

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSED--LIDPFARKTYQLNVN 241
              ++ ++       + +P  T+++     L +  +S+    D         +     V 
Sbjct: 201 SKFHVELDGGGGDIHVTLPY-TMVEPIREILDAGVQSDRNDVDDRWAKALREEMKTAPVT 259

Query: 242 IDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
           + + +   + TL+D++ LK G VIP    E+    +      ++    G    N  +RI 
Sbjct: 260 LHSTLARSEITLRDLMHLKAGDVIPIEMPERVVVEVE--EVPVFYGTYGVCEGNAALRID 317

Query: 302 DRINFDQK 309
           +++   ++
Sbjct: 318 EKVQAPER 325


>gi|163852467|ref|YP_001640510.1| flagellar motor switch protein FliM [Methylobacterium extorquens
           PA1]
 gi|218531223|ref|YP_002422039.1| flagellar motor switch protein FliM [Methylobacterium
           chloromethanicum CM4]
 gi|240139804|ref|YP_002964281.1| flagellar motor switch protein FliM [Methylobacterium extorquens
           AM1]
 gi|254562219|ref|YP_003069314.1| flagellar motor switch protein FliM [Methylobacterium extorquens
           DM4]
 gi|163664072|gb|ABY31439.1| flagellar motor switch protein FliM [Methylobacterium extorquens
           PA1]
 gi|218523526|gb|ACK84111.1| flagellar motor switch protein FliM [Methylobacterium
           chloromethanicum CM4]
 gi|240009778|gb|ACS41004.1| flagellar motor switch protein FliM [Methylobacterium extorquens
           AM1]
 gi|254269497|emb|CAX25463.1| flagellar motor switch protein FliM [Methylobacterium extorquens
           DM4]
          Length = 406

 Score =  175 bits (445), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 36/273 (13%), Positives = 95/273 (34%), Gaps = 4/273 (1%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + L    +     +V+++  +  S +F   +++     +       +W  +  +   
Sbjct: 123 RMIRLLSTSLRNFFQDNVEVTLDNITSVRFGDYLNAIPLPTLLGVFKADAWEGSGLVTVE 182

Query: 101 NNLVITLLENLLGA-SHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
             L  + ++ LLG     +  +L  R  +T+E  L +R +  I   L             
Sbjct: 183 QTLAYSTMDLLLGGKRGGSSSRLDGRPFTTIEMSLVRRLVEIILTDLELSFQPLSPVRFG 242

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISL-SSQN 218
           ++           T          I + + ++       ++ P  T+     + + S   
Sbjct: 243 IDRIETNPRFATIT--RPGNAAILITLKLDMDGRGGGMQILFPYATVEPIRDLLMQSFMG 300

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           +   + +      A + +Q +V+++  ++     LK V+ LK+G  + F  +      + 
Sbjct: 301 ERLGRDQVWESHLATEIWQADVDMEAVLHEVTLPLKRVLNLKVGDTLMFDRKPSDLITVR 360

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQKSL 311
                +    +GR+     ++I   +   + +L
Sbjct: 361 CGDWALTQGRIGRIDDAIAVQIARPLRQSRTTL 393


>gi|149928155|ref|ZP_01916401.1| flagellar motor switch protein M [Limnobacter sp. MED105]
 gi|149823140|gb|EDM82378.1| flagellar motor switch protein M [Limnobacter sp. MED105]
          Length = 348

 Score =  175 bits (443), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 48/312 (15%), Positives = 108/312 (34%), Gaps = 11/312 (3%)

Query: 6   IHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSC 65
            H+   P +     R+    G   T+E I       + + +       M    +IS    
Sbjct: 30  THEGVRPYNLATQERIVR--GRMPTLEII----NERFARLIRIGLFNFMRRSPEISVGPV 83

Query: 66  QSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNR 125
           +  K++  I +       +  ++     N       +LV  +++NL G       ++  R
Sbjct: 84  KVLKYNEFIRNLVVPTNLNIMAMKPLRGNALFIFDPSLVFAVIDNLFGGDGRFHTRVEGR 143

Query: 126 SLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTIN 185
             +  E+++  R +  I     +  +      P                   +E V T +
Sbjct: 144 DFTQTEQRIIARMLEVIREEFVKAWAPVFPLKPEYLRSEMHTQFA--NIATPSEIVVTTS 201

Query: 186 MNMTIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNIDT 244
            ++ +     S  + IP  T+     L+  S Q       +  +    ++     V++  
Sbjct: 202 FSIELGAGGGSLHICIPYSTMEPIRDLLYSSMQGDQAEPDKRWVTMLKKQVQMAEVDLVA 261

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
            +   + T+ D++ L+IG VIP             +   +++C  G  G  Y +++ + +
Sbjct: 262 SLASTQLTVADIMELRIGDVIPIEI--DKVIEARVDNVPVFNCSYGTSGGQYALKVEEVL 319

Query: 305 NFDQKSLKNFLH 316
               +S  + L+
Sbjct: 320 AVSNESHADALN 331


>gi|332296623|ref|YP_004438546.1| flagellar motor switch protein FliM [Thermodesulfobium narugense
           DSM 14796]
 gi|332179726|gb|AEE15415.1| flagellar motor switch protein FliM [Thermodesulfobium narugense
           DSM 14796]
          Length = 323

 Score =  175 bits (443), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 60/282 (21%), Positives = 116/282 (41%), Gaps = 14/282 (4%)

Query: 29  KTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASL 88
           +T+E I  + G L    L  + +  M LD    +++     +   I+S     +    S 
Sbjct: 52  RTLELIHETYGRLVATSLSSLVRGSMRLD----FSAIDQVPYEEFINSLIPPAMIVIISW 107

Query: 89  SSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQ 148
            +   +  +  + N+ + L++ LLG S   +P    R+ + +E  L  + + +    L +
Sbjct: 108 ENTGLSMVLEMNLNITLALVDRLLGGSG--LPPPSPRAPTDIENALIAKLVDRHLVALEE 165

Query: 149 CISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLK 208
              T    S             +     +NE V  I M++ I +++    L IP   LL+
Sbjct: 166 AWRTVYPVSLTFVGTETNPEFAQIV--PANEMVVLITMDIGIGDLSGIMSLAIPYS-LLE 222

Query: 209 TTLISLSSQNKSENQSEDLIDPFARKTYQ--LNVNIDTRINLKKT--TLKDVVTLKIGQV 264
             +  LS+Q     +  +  D      YQ  LNV ++ ++ L      L+D++ L++G  
Sbjct: 223 PIVNHLSAQRFFVKKKAE-NDIEREYVYQHVLNVMVNLQVCLGHMHIPLRDLINLRVGDT 281

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
           +    +      +    K+ +    GRVGKN  I+IT+ +  
Sbjct: 282 LLLDTKVDKPLDVKIEKKQKFLGVPGRVGKNLAIKITEVLRE 323


>gi|197104384|ref|YP_002129761.1| flagellar motor switch protein FliM [Phenylobacterium zucineum
           HLK1]
 gi|196477804|gb|ACG77332.1| flagellar motor switch protein FliM [Phenylobacterium zucineum
           HLK1]
          Length = 358

 Score =  175 bits (443), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 39/269 (14%), Positives = 102/269 (37%), Gaps = 6/269 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + +    +     +V++S  +  S +F   ++S     + S       ++   +   
Sbjct: 83  RLVRLMTTSLRNFTSDNVEVSLDNISSIRFGDYLNSIPLPAILSVFRAEELNNYGLLTVD 142

Query: 101 NNLVITLLENLLGASHETIP-QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           +NL+ ++++ LLG    T   ++  R  +T+E+ L +R +  + A   +        S  
Sbjct: 143 SNLIYSIVDVLLGGRRGTAAMRIEGRPYTTIERVLVQRMVEVVLADAREAFEPLTPVSFT 202

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
           L+               +      + + + +E+      L++P  TL  ++  L+     
Sbjct: 203 LDRLETNPRFAAIARPANAA--ILVKLRIDMEDRGGRIELLLPYATLEPIRKMLLQQFMG 260

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K   +        A + +  N+ +   ++ ++ +L+ V+ LK+G  +       +   L
Sbjct: 261 EKFG-RDNIWESHLATELWTTNMEVRAVLDEQQVSLQKVLDLKVGDTLMLNATPDSLIEL 319

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINF 306
            A    +    +GR   +  +R+   ++ 
Sbjct: 320 RAGAIPLTRGRMGRRNHHIAVRVEAPLSP 348


>gi|82702481|ref|YP_412047.1| flagellar motor switch protein FliM [Nitrosospira multiformis ATCC
           25196]
 gi|82410546|gb|ABB74655.1| flagellar motor switch protein FliM [Nitrosospira multiformis ATCC
           25196]
          Length = 326

 Score =  174 bits (441), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 46/308 (14%), Positives = 99/308 (32%), Gaps = 14/308 (4%)

Query: 2   RGQSI-HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
             QS  +    P +     R+    G   T+E I       + + L       M    ++
Sbjct: 25  SEQSTANPGFRPYNLATQERIVR--GRMPTLEII----NERFARLLRLGLFNFMRRSANV 78

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           +    +  KFS  + +       +   +              LV  +++NL G     +P
Sbjct: 79  TAGPVRVMKFSEFVRNLAAPSNLNLVHIKPLRGTSLFVFDPTLVFLVVDNLFGGDGRFLP 138

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           +   R  +  E+++ +R +  +     +                     +       NE 
Sbjct: 139 KTEGRDFTQTEQRIIQRLLNLVFDSYGKSWHPVYPIEFEYLRAET--NTQFANVATPNEV 196

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSE--NQSEDLIDPFARKTYQL 238
           V      +   +V     + +P   +L+     LSS  + E     +  +   +++    
Sbjct: 197 VVATTFEVNFGSVVGEMHICMPYS-ILEPIRDLLSSTLQGEALEVDKRWVGRLSKQVQSA 255

Query: 239 NVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTI 298
            V +   +   +  L  ++ +K+G VIP    E      S +G  +  C+ G     Y +
Sbjct: 256 EVTLLANLTHAQVRLDQILNMKVGDVIPLDIPE--FVTASVDGVPVMECKYGISNGRYAL 313

Query: 299 RITDRINF 306
           R+   +  
Sbjct: 314 RMEKMLAS 321


>gi|292493590|ref|YP_003529029.1| flagellar motor switch protein FliM [Nitrosococcus halophilus Nc4]
 gi|291582185|gb|ADE16642.1| flagellar motor switch protein FliM [Nitrosococcus halophilus Nc4]
          Length = 349

 Score =  174 bits (440), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 41/280 (14%), Positives = 96/280 (34%), Gaps = 24/280 (8%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L +         +D++ +  Q  KFS  IH+       +   +S          
Sbjct: 61  ERFVRQLRRSLFNLFRRAIDVTVSGMQMVKFSEYIHTLFVPTSLNMVQMSPLQGTSLFVF 120

Query: 100 SNNLVITLLENLLGASH-----ETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQ 154
              LV  +++N  G S       +  ++  R  +  E ++ +  + ++ A L Q      
Sbjct: 121 DPKLVFMMVDNYFGGSGRAYARRSYARIEGREFTPTEVRVVQLVLEKVFADLEQAWEPVL 180

Query: 155 ESSPNLEDFYDIDYLKKNTNRL------SNEFVTTINMNMTIENVASSFVLIIPQETLLK 208
                       +YL+   N         +E V      +  +     F + +P   +L+
Sbjct: 181 AV--------HFEYLQAEPNPQFATIVSPSEVVVVSTFFVEFDGGGGEFHITLPYA-MLE 231

Query: 209 TTLISLSSQNKSEN--QSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIP 266
                L    +S +    E        K  +  V +   +   + +L++++ L+ G ++P
Sbjct: 232 PIRELLEVGRQSGSSQVDERWDQALQEKILEAEVELSCTLAETQLSLREILALEPGDILP 291

Query: 267 FLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                 +     A+G  ++    G    NY +++ + +  
Sbjct: 292 IELP--SILTAQADGVPVFRARYGVHNDNYALKVVEPLPH 329


>gi|220924581|ref|YP_002499883.1| flagellar motor switch protein FliM [Methylobacterium nodulans ORS
           2060]
 gi|219949188|gb|ACL59580.1| flagellar motor switch protein FliM [Methylobacterium nodulans ORS
           2060]
          Length = 403

 Score =  173 bits (439), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 39/276 (14%), Positives = 101/276 (36%), Gaps = 4/276 (1%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + L    +     +V+++  +  S +F   +++     +        W ++  +   
Sbjct: 120 RMIRLLSTSLRNFFQDNVEVTLDNITSVRFGDYLNAIPMPTLLGVFKADLWENSGLLTVD 179

Query: 101 NNLVITLLENLLGA-SHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           ++L    L+ LLG     T  +L  R  +++E  L +R +  I   L             
Sbjct: 180 SSLAYATLDLLLGGKRGTTTIRLDGRPFTSIEMSLVRRMLEIILGDLEASFQPLSPVRFQ 239

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISL-SSQN 218
           ++     +       R +N     I++ + +E       ++ P  T+     + L S   
Sbjct: 240 IDRIES-NPRFATITRPAN-AAILIDLKLDMEGRGGLLQILFPYATIEPIRDLLLQSFMG 297

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           +   +        A + +Q ++ ++  ++     L+ V++L++G  I F  +      L 
Sbjct: 298 EKLGRDHVWEGHLATEIWQADLAVEAVLHEMTLPLRRVLSLEVGDTIMFDAKPTDLITLR 357

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
                +    +GR+  +  +++T  +   + +   F
Sbjct: 358 CGDWALTQGRIGRLDDSIAVQVTRPLRRARTTFAAF 393


>gi|221235077|ref|YP_002517513.1| flagellar motor switch protein FliM [Caulobacter crescentus NA1000]
 gi|300680949|sp|B8GXB5|FLIM_CAUCN RecName: Full=Flagellar motor switch protein FliM
 gi|220964249|gb|ACL95605.1| flagellar motor switch protein fliM [Caulobacter crescentus NA1000]
          Length = 374

 Score =  173 bits (439), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 44/315 (13%), Positives = 110/315 (34%), Gaps = 20/315 (6%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLP--------------KIFKEKM 54
           N   +  +L   L+G   D +T  +   +   +  + LP                 +   
Sbjct: 53  NQDEIDSLLGFDLSGDGSDDRTGIRAIINSALVSYERLPMLEIVFDRLVRLMTTSLRNFT 112

Query: 55  DLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGA 114
             +V++S  +  S +F   ++S     + +        +   +   +NL+ ++++ LLG 
Sbjct: 113 SDNVEVSLDNISSIRFGDYLNSIPLPAILAVFRAEELDNYGLLTVDSNLIYSIVDVLLGG 172

Query: 115 SHETIP-QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNT 173
              T   ++  R  +T+E+ L +R I  +   L          S +L+            
Sbjct: 173 RRGTAAMRIEGRPYTTIERVLVQRMIEVVLHDLKSAFEPLHPVSFSLDRLETNPRFAAIA 232

Query: 174 NRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLIDPF 231
              +      + + + +E+      L++P  TL  ++  L+      K   +        
Sbjct: 233 RPANAA--ILVKLRIDMEDRGGRIELLLPYATLEPIRKMLLQQFMGEKFG-RDNIWEGHL 289

Query: 232 ARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGR 291
           A + +   + +   ++ ++  L  V+ +++G  +       +   L A    +    +GR
Sbjct: 290 ATELWTTQMEVRAVLDEQQVPLSRVLNMQVGDTLMLNATPDSLVELRAGAIPLTRGRMGR 349

Query: 292 VGKNYTIRITDRINF 306
              +  +R    +  
Sbjct: 350 RNHSIAVRAEAPLTP 364


>gi|71906405|ref|YP_283992.1| flagellar motor switch protein FliM [Dechloromonas aromatica RCB]
 gi|71846026|gb|AAZ45522.1| Flagellar motor switch protein FliM [Dechloromonas aromatica RCB]
          Length = 338

 Score =  173 bits (439), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 40/273 (14%), Positives = 97/273 (35%), Gaps = 7/273 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++L       M  + +IS    +  K+S  I +       +               
Sbjct: 59  ERFARYLRIGLFNYMHRNAEISVGPIRVQKYSEFIRNLVVPTNLNLVIAKPLRGTALFVF 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
             NLV  +++N+ G       ++  R  +  E+++ +  +  +    ++      + +  
Sbjct: 119 DPNLVFLVVDNMFGGDGRFHTRVEGRDFTPTEQRIIQGLLNVVFTEYSKSWKPVYDINFE 178

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK 219
                +++    N     +E V +    +      +   +  P   +L+     L S  +
Sbjct: 179 YIR-SEMNSQFANI-ATPSEIVVSTTFTLEFGGATADMHICFPYS-MLEPIRDLLYSTMQ 235

Query: 220 SE--NQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
           S+  +  +  I    ++     V I   +   K TL  ++ LK+G VIP    +K  A++
Sbjct: 236 SDQLSSDKRWIGTLRKQLQGAEVEIVALLGSGKITLGQILKLKVGDVIPLHIPDKIEALV 295

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
             +   +  C  G+    Y +++   I    ++
Sbjct: 296 --DSVPLMECTYGQQSGQYALKVDRFIASSPET 326


>gi|253998475|ref|YP_003050538.1| flagellar motor switch protein FliM [Methylovorus sp. SIP3-4]
 gi|313200550|ref|YP_004039208.1| flagellar motor switch protein flim [Methylovorus sp. MP688]
 gi|253985154|gb|ACT50011.1| flagellar motor switch protein FliM [Methylovorus sp. SIP3-4]
 gi|312439866|gb|ADQ83972.1| flagellar motor switch protein FliM [Methylovorus sp. MP688]
          Length = 334

 Score =  173 bits (439), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 36/270 (13%), Positives = 96/270 (35%), Gaps = 7/270 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       M   V++S    +  K+S  + +       +   ++       +  
Sbjct: 58  ERFARLLRIGLFNFMRRSVEVSVGPVRISKYSEFVRNLVVPTNLNLVHMNPLRGTGLMVF 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
             +LV ++++N+ G       ++  R  +  E+++ +R +A +     +      +    
Sbjct: 118 DPSLVFSIVDNMFGGDGRFHTRIEGRDFTQTEQRIIQRVLAIVIENYEKSWEPVYQVKFE 177

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK 219
                +++    N     NE +     ++ +           P   +++     L+S  +
Sbjct: 178 YLR-SEMNTQFANI-ATPNEVIVATTFSIELGPAGGEIHFCFPYS-MIEPVRDLLTSSLQ 234

Query: 220 SE--NQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            E     +  +    ++     V +   +   +  L DV+ +K+G VIP    E   A +
Sbjct: 235 GEVLGVDKRWVRLMTQQIQAAEVELVANLAKARMQLGDVLNMKVGDVIPLNISETIEAHV 294

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFD 307
             +   +  C+ G     Y++R+   +  +
Sbjct: 295 --DNVPVMECKYGVFNGQYSLRVEKLLRAN 322


>gi|134095084|ref|YP_001100159.1| flagellar motor switch protein FliM [Herminiimonas arsenicoxydans]
 gi|55977142|gb|AAV68363.1| FliM [Herminiimonas arsenicoxydans]
 gi|133738987|emb|CAL62035.1| Flagellar motor switch protein FliM [Herminiimonas arsenicoxydans]
          Length = 332

 Score =  173 bits (438), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 44/266 (16%), Positives = 91/266 (34%), Gaps = 5/266 (1%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       +    ++S    +  K+S  I +       +   +        I  
Sbjct: 58  ERFSRLLRIGLFNFLHRSAEVSIGPVRVSKYSEFIRNLVVPTNLNLIHMKPLRGIGLIVL 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
             NLV  L++NL G       ++  R  +  E+++ +R +  I     +           
Sbjct: 118 DPNLVFLLVDNLFGGDGRFHTRVEGRDFTQTEQRIIQRILGIIFETYAKSWEPVYPVEFE 177

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTT-LISLSSQN 218
                +++    N     NE V      + +  V+      +P   +     L++ S Q 
Sbjct: 178 YIR-SEMNTQFANI-ATPNEVVVATTFTIELGPVSGDLHFCVPYSMIEPIRDLLTSSMQG 235

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           ++    +  I    ++     V I   +   K TL D++ +KIG +I     E       
Sbjct: 236 ETLEMDKRWIRLMTQQIQTAEVEILANMGSAKVTLGDILNMKIGDIISIAVPE--QVTAE 293

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRI 304
            +G  +  C  G++   Y +R+   I
Sbjct: 294 VDGVPVMECSYGKLNGQYALRVEKLI 319


>gi|295688787|ref|YP_003592480.1| flagellar motor switch protein FliM [Caulobacter segnis ATCC 21756]
 gi|295430690|gb|ADG09862.1| flagellar motor switch protein FliM [Caulobacter segnis ATCC 21756]
          Length = 369

 Score =  172 bits (437), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 35/269 (13%), Positives = 95/269 (35%), Gaps = 6/269 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + +    +     +V++S  +  S +F   ++S     + +        +   +   
Sbjct: 94  RLVRLMTTSLRNFTSDNVEVSLDNISSIRFGDYLNSIPLPAILAVFRAEELDNYGLLTVD 153

Query: 101 NNLVITLLENLLGASHETIP-QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           +NL+ ++++ LLG    T   ++  R  +T+E+ L +R I  +   L          + +
Sbjct: 154 SNLIYSIVDVLLGGRRGTAAMRIEGRPYTTIERVLVQRMIEVVLHDLKSAFEPLHPVAFS 213

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
           L+                      + + + +E+      L++P  TL  ++  L+     
Sbjct: 214 LDRLETNPRFAAIARPA--NAAILVKLRIDMEDRGGRIELLLPYATLEPIRKMLLQQFMG 271

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K   +        A + +   + +   ++ ++  L  V+ +++G  +       +   L
Sbjct: 272 EKFG-RDNIWEGHLATELWTTQMEVRAVLDEQQLPLSRVLNMQVGDTLMLNATPDSLVEL 330

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINF 306
            A    +    +GR   +  +R    +  
Sbjct: 331 RAGAIPLTRGRMGRRNHSIAVRAEAPLTP 359


>gi|296283225|ref|ZP_06861223.1| flagellar motor switch protein FliM [Citromicrobium bathyomarinum
           JL354]
          Length = 339

 Score =  172 bits (437), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 46/272 (16%), Positives = 95/272 (34%), Gaps = 6/272 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
               +      +      +++S     S +F   ++      + +   + +W     +  
Sbjct: 69  ERMVRSFATSMRNLTSDAIEVSLDDIASVRFGDFMNRVPLPCMIAVFKVPAWQDYGLVTI 128

Query: 100 SNNLVITLLENLLGAS-HETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSP 158
             NL+  +++ LLG        ++  R+ +T+E  L  + I  +    +         + 
Sbjct: 129 EANLIYAVVDALLGGRKGAAPRKIEGRAFTTIETTLVSKMIELVLREFSTAFEPIAPITM 188

Query: 159 NLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQN 218
            LE               +    +     + ++    +F +++P  T L+     LS + 
Sbjct: 189 ELERIETSPRFAAIAGPTN--VASAATFAVDMDGRGGNFTILLPFAT-LEPVRGKLSQRF 245

Query: 219 KSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAI 276
             E    D    D    +  +  V I T +  ++  L DV +L+IGQ IPF         
Sbjct: 246 MGEKLGGDNTWRDHMRNEILRTEVEIYTVLGEREMRLADVHSLEIGQTIPFDVTPDDPFE 305

Query: 277 LSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
           +   G  +   ++GR   +  I I D I   Q
Sbjct: 306 VCCGGVPLARAQIGRQRNHVAIGIVDTIKQGQ 337


>gi|152980580|ref|YP_001353124.1| flagellar motor switch protein FliM [Janthinobacterium sp.
           Marseille]
 gi|151280657|gb|ABR89067.1| FliM flagellar motor switch protein [Janthinobacterium sp.
           Marseille]
          Length = 332

 Score =  172 bits (436), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 42/266 (15%), Positives = 91/266 (34%), Gaps = 5/266 (1%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       +    ++S    +  K+S  I +       +   +        I  
Sbjct: 58  ERFSRLLRIGLFNFLHRSAEVSIGPVRVSKYSEFIRNLVVPTNLNLIHMKPLRGTGLIVL 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
             NLV  L++NL G       ++  R  +  E+++ +R +  I     +           
Sbjct: 118 DPNLVFLLVDNLFGGDGRFHTRVEGRDFTQTEQRIIQRILGIIFETYAKSWEPVYPVEFE 177

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTT-LISLSSQN 218
                +++    N     NE V      + +  V+       P   +     L++ S Q 
Sbjct: 178 YIR-SEMNTQFANI-ATPNEVVVATTFTIELGPVSGDMHFCTPYAMIEPIRDLLTSSMQG 235

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           ++    +  I    ++     V I   +   K TL D++ ++ G +IP    +   A + 
Sbjct: 236 ETLEMDKRWIRLMTQQIQTAEVEILANMGSAKVTLGDILNMQKGDIIPIAVPDTITAEV- 294

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRI 304
            +   +  C  G++   Y +R+   I
Sbjct: 295 -DSVPVMECSYGKLNGQYALRVEKLI 319


>gi|34498585|ref|NP_902800.1| flagellar motor switch protein FliM [Chromobacterium violaceum ATCC
           12472]
 gi|34104439|gb|AAQ60797.1| flagellar motor switch protein [Chromobacterium violaceum ATCC
           12472]
          Length = 334

 Score =  172 bits (436), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 38/274 (13%), Positives = 95/274 (34%), Gaps = 7/274 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       +  + +IS    +  K+S  I +       +   +        +  
Sbjct: 58  ERFARNLRIGLFNFLRRNAEISVGPVRVQKYSEFIRNLVVPTNLNLVHVKPLRGTGLLIF 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
             +LV  +++NL G+      ++  R  +  E+++  R +  +     +           
Sbjct: 118 DPDLVFLIVDNLFGSDGRYHVRVEGRDFTPTEQRIIHRLLEVVFTECQKAWEPVYPIEFV 177

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK 219
                +++    N      E V  +  ++ +      F + +P   +++     LSS  +
Sbjct: 178 YLR-SEMNTQFANI-ATPTEVVVAMTFHIELGAGGGDFHICLPYS-MVEPIRDLLSSTMQ 234

Query: 220 SENQ--SEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
           ++        ++    +     V +   +   K TL  ++ LK G V+     E+  A +
Sbjct: 235 ADRTEVDNRWVNLMTHQVQAAEVELVASLAHAKVTLGQILNLKNGDVVMIEIPERVEADV 294

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQKSL 311
           S  G  ++    G V   Y +++   +    + L
Sbjct: 295 S--GIPVFEASYGTVQGRYALKVEKILAGTNEFL 326


>gi|23009967|ref|ZP_00050822.1| COG1868: Flagellar motor switch protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 316

 Score =  172 bits (435), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 36/274 (13%), Positives = 96/274 (35%), Gaps = 6/274 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + L    +     +V+++  +  S +F   +++     +        W  +  +   
Sbjct: 33  RMIRLLSTSLRNFFQDNVEVTLDNITSVRFGDYLNAIPLPTLLGVFKADPWEGSGIVTVE 92

Query: 101 NNLVITLLENLLGA-SHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
             L  + ++ LLG     +  +L  R  +T+E  L +R I  I + L             
Sbjct: 93  QTLAYSTMDLLLGGKRGGSSSRLDGRPFTTIEMNLVRRLIDIILSDLELSFQPLSPVRFG 152

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
           ++           T          I++ + ++       ++ P  T+  ++  L+     
Sbjct: 153 IDRLETNPRFATIT--RPGNAAILISLKLDMDGRGGGMQILFPYATVESIRDLLMQSFMG 210

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            +   + +      A + +Q ++ ++  ++     LK V+ LK+G  + F  +      +
Sbjct: 211 ER-LGRDQVWESHLATEIWQADLEMEAVLHEVTLPLKRVLGLKVGDTLMFDRKPTDLITV 269

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQKSL 311
                 +    +GR+     ++I   +   + +L
Sbjct: 270 RCGDWALTQGRIGRIDDAIAVQIARPLRQSRTTL 303


>gi|167645399|ref|YP_001683062.1| flagellar motor switch protein FliM [Caulobacter sp. K31]
 gi|167347829|gb|ABZ70564.1| flagellar motor switch protein FliM [Caulobacter sp. K31]
          Length = 377

 Score =  172 bits (435), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 43/313 (13%), Positives = 108/313 (34%), Gaps = 20/313 (6%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLP--------------KIFKEKM 54
           N   +  +L   ++G   D +T  +   +   +  + LP                 +   
Sbjct: 56  NQDEIDSLLGFDMSGDGNDDRTGIRAIINSALVSYERLPMLEIVFDRLVRLMTTSLRNFT 115

Query: 55  DLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGA 114
             +V++S  +  S +F   ++S     + +        +   +   +NL+ ++++ LLG 
Sbjct: 116 SDNVEVSLDNISSIRFGDYLNSIPLPAILAVFRAEELDNYGLLTVDSNLIYSIVDVLLGG 175

Query: 115 SHETIP-QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNT 173
              T   ++  R  +T+E+ L +R +  +              S  L+            
Sbjct: 176 RRGTAAMRIEGRPYTTIERVLVQRMVEVVLHDAKAAFEPLHPVSFTLDRLETNPRFAAIA 235

Query: 174 NRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLIDPF 231
              +      + + + +E+      L++P  TL  ++  L+      K   +        
Sbjct: 236 RPANAA--ILVKLRIDMEDRGGRIELLLPYATLEPIRKMLLQQFMGEKFG-RDNIWEGHL 292

Query: 232 ARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGR 291
           A + +   + +   ++ ++  L  V+ LK+G  +       +   L A    +    +GR
Sbjct: 293 ATELWTTQMEVRAVLDEQQLPLSRVLDLKVGDTLMLNATTDSLVELRAGSIPLTRGRMGR 352

Query: 292 VGKNYTIRITDRI 304
              +  +R    +
Sbjct: 353 RNHSIAVRAEAPL 365


>gi|23007978|ref|ZP_00049614.1| COG1868: Flagellar motor switch protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 269

 Score =  172 bits (435), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 45/243 (18%), Positives = 83/243 (34%), Gaps = 26/243 (10%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +  P+  ++  RL     D       SS+                       S     SG
Sbjct: 51  DRLPMLHVVFDRLATACSDAAKHLAASSTF---------------------YSLNGIASG 89

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           +F   + ++  N V        W  +  +G   + + T++E L G+     P    R+ S
Sbjct: 90  RFGEFLDAYDANAVVGIFHAPEWDGHILVGLDRDFLYTMVEVLFGSDGSEPPVEDERNFS 149

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
            +E ++A+    Q+   L        ++   LE   +         R SN+ V      +
Sbjct: 150 AIELRIAQMVFEQVGKALESSFGLVSQTPFRLER-METRMEFAVIGRRSNKAVQA-KFLL 207

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSED--LIDPFARKTYQLNVNIDTRI 246
              N      L+IPQ T+L     +LS     E+ + D    +  A +  + NV +   +
Sbjct: 208 QALNRGGEMFLVIPQ-TVLNPLRPALSKVLTGESAARDPHWAEQIAAEVQKTNVRLKAVL 266

Query: 247 NLK 249
             +
Sbjct: 267 EER 269


>gi|309779462|ref|ZP_07674223.1| flagellar motor switch protein FliM [Ralstonia sp. 5_7_47FAA]
 gi|308921703|gb|EFP67339.1| flagellar motor switch protein FliM [Ralstonia sp. 5_7_47FAA]
          Length = 336

 Score =  171 bits (434), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 39/254 (15%), Positives = 89/254 (35%), Gaps = 7/254 (2%)

Query: 54  MDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLG 113
           M  + +IS    +  K+S  I +       +   +             NL+  +++NL G
Sbjct: 74  MRRNAEISVGPVKVQKYSEFIRNLVVPTSLNLVHVKPLRGTALFVFDPNLIFLVVDNLFG 133

Query: 114 ASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNT 173
                  ++  R  + VE+++ +R +  +     +                         
Sbjct: 134 GDGRFHMRVEGRDFTDVEQRIIQRMLHLVFEHYAKAWQPVYPIDFEFLRMEMHTEFA--N 191

Query: 174 NRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSE--NQSEDLIDPF 231
               NE V T + ++ + +      + +P  T+++     L+S  + E     +  +   
Sbjct: 192 VATPNEVVITTSFSIELGSNGGDVHICMPY-TMIEPIRDRLTSAIQGEALEVDKRWLRLL 250

Query: 232 ARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGR 291
           +++     V +   +   K  + D++ +K+G VIP       C     +G  +  C  G 
Sbjct: 251 SQQVQTAEVELIADLATAKVQVSDILNMKVGDVIPLEL--DDCVTAKVDGVPVMECNYGT 308

Query: 292 VGKNYTIRITDRIN 305
               Y +R+   +N
Sbjct: 309 FNGQYALRVNRMLN 322


>gi|187926920|ref|YP_001893265.1| flagellar motor switch protein FliM [Ralstonia pickettii 12J]
 gi|241665249|ref|YP_002983608.1| flagellar motor switch protein FliM [Ralstonia pickettii 12D]
 gi|187728674|gb|ACD29838.1| flagellar motor switch protein FliM [Ralstonia pickettii 12J]
 gi|240867276|gb|ACS64936.1| flagellar motor switch protein FliM [Ralstonia pickettii 12D]
          Length = 335

 Score =  171 bits (434), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 38/254 (14%), Positives = 86/254 (33%), Gaps = 7/254 (2%)

Query: 54  MDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLG 113
           M  + +IS    +  K+S  I +       +   +             NL+  +++NL G
Sbjct: 73  MRRNAEISVGPVKVQKYSEFIRNLVVPTSLNLVHVKPLRGTALFVFDPNLIFLVVDNLFG 132

Query: 114 ASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNT 173
                  ++  R  + VE+++ +R +  +     +                         
Sbjct: 133 GDGRFHMRVEGRDFTDVEQRIIQRMLQLVFEHYARAWQPVYPIDFEFLRMEMHTEFA--N 190

Query: 174 NRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSE--NQSEDLIDPF 231
               NE V T   ++ + N      + +P  T+++     L+S  + E     +  +   
Sbjct: 191 VATPNEVVVTTTFSLELGNNGGDVHICMPY-TMIEPIRDRLTSAIQGEALEVDKRWLRLL 249

Query: 232 ARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGR 291
           +++     V +   +      + D++ +K+G VIP             +G  +  C  G 
Sbjct: 250 SQQVQTAEVELIADLATANVQVSDILNMKVGDVIPLEL--DDVVTAKVDGVPVMECNYGT 307

Query: 292 VGKNYTIRITDRIN 305
               Y +R+   +N
Sbjct: 308 FNGQYALRVNRMLN 321


>gi|83858803|ref|ZP_00952325.1| flagellar motor switch protein [Oceanicaulis alexandrii HTCC2633]
 gi|83853626|gb|EAP91478.1| flagellar motor switch protein [Oceanicaulis alexandrii HTCC2633]
          Length = 385

 Score =  171 bits (433), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 40/269 (14%), Positives = 100/269 (37%), Gaps = 6/269 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + +    +     +V++S  +  S +F   ++S     + +        +   +   
Sbjct: 110 RLVRLMTTSLRNFTSDNVEVSLDNISSIRFGDYLNSIPLPAILAVFRAKQLDNYGLLTVD 169

Query: 101 NNLVITLLENLLGASHETIP-QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           +NL+ ++++ LLG    T   ++  R  +T+E+ L +R I  + A   Q  +   E   +
Sbjct: 170 SNLIYSIVDVLLGGRRGTSAMRVEGRPYTTIERTLVQRMIEVVLADARQAFAPLTEVDFD 229

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
           L+               +      + + + +E+      L++P  TL  ++  L+     
Sbjct: 230 LDRVETNPRFAAIARPANAA--ILVKLRIDMEDRGGRIELLLPYATLEPIRKMLLQQFMG 287

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K   +        A + +   + +   ++  +  L +V+ LK+G  +           L
Sbjct: 288 EKFG-RDNIWESHLATELWSTKMEVSAVLDEMQKPLGEVMQLKVGDTLMLDAGPDGLIEL 346

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINF 306
                 +    +GR+G N  +R+   ++ 
Sbjct: 347 RCGTVPLAHGHMGRIGHNIGVRLDRPLSA 375


>gi|207728361|ref|YP_002256755.1| flagellar motor switch protein flim [Ralstonia solanacearum MolK2]
 gi|206591607|emb|CAQ57219.1| flagellar motor switch protein flim [Ralstonia solanacearum MolK2]
          Length = 335

 Score =  171 bits (433), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 36/254 (14%), Positives = 87/254 (34%), Gaps = 7/254 (2%)

Query: 54  MDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLG 113
           +  + +IS    +  K+S  I +       +   +             NL+  ++++L G
Sbjct: 73  LRRNAEISVGPVKVQKYSEFIRNLVVPAAINLVHVKPLRGTALFVFDPNLIFIVVDHLFG 132

Query: 114 ASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNT 173
                  ++  R  + VE+++ +R +A +     +                         
Sbjct: 133 GDGRFHMRVEGRDFTQVEQRIIQRMLALMFEHYGKAWQPIYPIEFEPLRMEMHTEFA--N 190

Query: 174 NRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSE--NQSEDLIDPF 231
               NE V +   +M + +      + +P  T+++     L+S  + E     +  +   
Sbjct: 191 VATPNEVVVSTRFSMELGSNGGDVHVCMPY-TMIEPIRDLLTSAIQGEALEVDKRWVRLL 249

Query: 232 ARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGR 291
           +++     V +   +      + D++ +K+G VIP             +G  +  C  G 
Sbjct: 250 SQQVQTAEVEVVAHLANANVHVSDILNMKVGDVIPLEL--DDSVTARVDGVPVMECAYGT 307

Query: 292 VGKNYTIRITDRIN 305
               Y +R+   +N
Sbjct: 308 FNGQYALRVNRMLN 321


>gi|224826626|ref|ZP_03699727.1| flagellar motor switch protein FliM [Lutiella nitroferrum 2002]
 gi|224601227|gb|EEG07409.1| flagellar motor switch protein FliM [Lutiella nitroferrum 2002]
          Length = 335

 Score =  171 bits (433), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 39/264 (14%), Positives = 94/264 (35%), Gaps = 7/264 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       +  + +IS    +  K+S  I +       +   +        +  
Sbjct: 58  ERFARNLRIGLFNFIRRNAEISVGPVRVQKYSEFIRNLVVPTNLNLVHVKPLRGTGLLIF 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
             +LV  +++NL G+      ++  R  +  E+++ +R +  +     +           
Sbjct: 118 DPDLVFLVVDNLFGSDGRYHVRVEGRDFTPTEQRIIRRLLEVVFTEYQKAWEPVYPIEFV 177

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK 219
                +++    N      E V  +  ++ +      F + +P   +++     LSS  +
Sbjct: 178 YLR-SEMNTQFANI-ATPTEVVVAMTFHIEMGAGGGEFHVCLPYS-MVEPIRDVLSSTMQ 234

Query: 220 SENQ--SEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
           ++        +   +R+     V++   +     TL  V+ LK G V+     E   A +
Sbjct: 235 ADRTEVDNRWVSLMSRQVQAAEVDLVATLAGTSVTLGQVLNLKQGDVVTLEIPEMIIADV 294

Query: 278 SANGKEIYSCELGRVGKNYTIRIT 301
           S  G  +  C  G V  +Y +++ 
Sbjct: 295 S--GIPVVECTYGTVQGHYALKVE 316


>gi|300113610|ref|YP_003760185.1| flagellar motor switch protein FliM [Nitrosococcus watsonii C-113]
 gi|299539547|gb|ADJ27864.1| flagellar motor switch protein FliM [Nitrosococcus watsonii C-113]
          Length = 336

 Score =  171 bits (433), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 46/299 (15%), Positives = 99/299 (33%), Gaps = 23/299 (7%)

Query: 24  KLGDKKTIEKISSSLGYLYKKFLPKIFKEKM----DLDVDISYTSCQSGKFSHIIHSFKE 79
               +  I +    L  +  +   + F+  +        +++    Q  KFS  +H+   
Sbjct: 41  DFSSEDRIARAYVPLLEMINERFARQFRLSLFNLLRRATEVTVGGVQVLKFSEYLHTLFM 100

Query: 80  NFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTI 139
               +   +              LV  L++   G S E   +L NR  +  E  + +  +
Sbjct: 101 PTSLNLVQIHPLRGAGLFVFDPKLVFMLVDRYFGGSGEFYNRLENREFTPTEMHIIQLVL 160

Query: 140 AQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRL------SNEFVTTINMNMTIENV 193
            +    L Q                + +YL+   N         +E V     ++  E  
Sbjct: 161 ERTFTDLKQAWEPVL--------AINFEYLQTEFNPRLATIASPSEIVVVSTFHVEFEGG 212

Query: 194 ASSFVLIIPQETLLKTTLISLSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKT 251
              F + +P  TLL+     L +  K +    D        +      V +   +   + 
Sbjct: 213 GGEFHIALPY-TLLEPVRELLDTGKKDDFTQADGGWNQALRKNVSDAEVELSCTLTEIRL 271

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
           +LK+V+ LK G ++P      +     A+G  ++    G    +  +++ +R+   +  
Sbjct: 272 SLKEVLALKSGDILPIELP--STVTALADGVPVFRVRYGIHNSSRALKVVERLLSPESF 328


>gi|329849711|ref|ZP_08264557.1| flagellar motor switch protein FliM [Asticcacaulis biprosthecum
           C19]
 gi|328841622|gb|EGF91192.1| flagellar motor switch protein FliM [Asticcacaulis biprosthecum
           C19]
          Length = 388

 Score =  171 bits (433), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 42/281 (14%), Positives = 102/281 (36%), Gaps = 6/281 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + +    +     +V++S  +  S +F   ++S     + +        +   +   
Sbjct: 111 RLVRLMTTSLRNFTSDNVEVSLDNISSIRFGDYLNSIPLPAILAVFRAEELDNYGLLTVD 170

Query: 101 NNLVITLLENLLGASHETIP-QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           +NL+ ++++ LLG    T   ++  R  +T+E+ L +R +  +     Q        + N
Sbjct: 171 SNLIYSIVDVLLGGRRGTAALRIEGRPYTTIERVLVQRMVEVVLNDARQAFEPLTAVNFN 230

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK 219
           L+                      + + + +E+      L++P  T L+     L  Q  
Sbjct: 231 LDRLETNPRFAAIARPA--NAAILVKLRIDMEDRGGRIELLLPYAT-LEPIRKMLLLQFM 287

Query: 220 SENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            E    D       A + +   + +   ++ ++  L  V+ LK+G+ I    +  +   L
Sbjct: 288 GEKFGRDNIWESHLATELWTTQMEVRAVLDEQQVPLSRVLNLKVGETIVLNAQADSPVQL 347

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLHKR 318
                 + +  +GR G +  +R+   +    K     + K+
Sbjct: 348 RCGQIPLTTGRMGRKGHSIAVRVDTPLALSTKRRLTQMKKK 388


>gi|300696948|ref|YP_003747609.1| flagellar motor switching and energizing component [Ralstonia
           solanacearum CFBP2957]
 gi|299073672|emb|CBJ53192.1| flagellar motor switching and energizing component [Ralstonia
           solanacearum CFBP2957]
          Length = 335

 Score =  170 bits (432), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 36/254 (14%), Positives = 87/254 (34%), Gaps = 7/254 (2%)

Query: 54  MDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLG 113
           +  + +IS    +  K+S  I +       +   +             NL+  ++++L G
Sbjct: 73  LRRNAEISVGPVKVQKYSEFIRNLVVPAAINLVHVKPLRGTALFVFDPNLIFIVVDHLFG 132

Query: 114 ASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNT 173
                  ++  R  + VE+++ +R +A +     +                         
Sbjct: 133 GDGRFHMRVEGRDFTQVEQRIIQRMLALMFEHYGKAWQPIYPIEFEPLRMEMHTEFA--N 190

Query: 174 NRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSE--NQSEDLIDPF 231
               NE V +   +M + +      + +P  T+++     L+S  + E     +  +   
Sbjct: 191 VATPNEVVVSTRFSMELGSNGGDVHVCMPY-TMIEPIRDLLTSAIQGEALEVDKRWVRLL 249

Query: 232 ARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGR 291
           +++     V +   +      + D++ +K+G VIP             +G  +  C  G 
Sbjct: 250 SQQVQTAEVEVVAHLANANVHVSDILNMKVGDVIPLEL--DDFVTARVDGVPVMECAYGT 307

Query: 292 VGKNYTIRITDRIN 305
               Y +R+   +N
Sbjct: 308 FNGQYALRVNRMLN 321


>gi|170742328|ref|YP_001770983.1| flagellar motor switch protein FliM [Methylobacterium sp. 4-46]
 gi|168196602|gb|ACA18549.1| flagellar motor switch protein FliM [Methylobacterium sp. 4-46]
          Length = 403

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 42/276 (15%), Positives = 99/276 (35%), Gaps = 4/276 (1%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + L    +     +V+++  +  S +F   +++     +        W ++  +   
Sbjct: 120 RMIRLLSTSLRNFFQDNVEVTLDNITSVRFGDYLNAIPLPTLLGVFKADLWENSGLVTVD 179

Query: 101 NNLVITLLENLLGA-SHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           +NL    L+ LLG     T  +L  R  +++E  L +R +  I   L             
Sbjct: 180 SNLAYATLDLLLGGKRGTTTIRLDGRPFTSIEMSLVRRMLEIILGDLEASFQPLSPVRFQ 239

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISL-SSQN 218
           ++     +       R +N     I++ + +E       ++ P  T+     + L S   
Sbjct: 240 IDRLES-NPRFATITRPAN-AAILIDLKLDMEGRGGLLQILFPYATIEPIRDLLLQSFMG 297

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           +   +        A + +Q  V ++  ++     LK V+ L++G  I F  +      L 
Sbjct: 298 EKLGRDHVWEGHLATEIWQAEVEVEAVLHQMTLPLKRVLALEVGDTILFDAKPTDLITLR 357

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
                +    +GR+  +  +++T  +   + +   F
Sbjct: 358 CGDWALSQGRIGRLEDSIAVQVTRPLRRARTTFAAF 393


>gi|77165630|ref|YP_344155.1| flagellar motor switch protein FliM [Nitrosococcus oceani ATCC
           19707]
 gi|254434449|ref|ZP_05047957.1| flagellar motor switch protein FliM [Nitrosococcus oceani AFC27]
 gi|76883944|gb|ABA58625.1| Flagellar motor switch protein FliM [Nitrosococcus oceani ATCC
           19707]
 gi|207090782|gb|EDZ68053.1| flagellar motor switch protein FliM [Nitrosococcus oceani AFC27]
          Length = 336

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 48/305 (15%), Positives = 102/305 (33%), Gaps = 22/305 (7%)

Query: 23  GKLGDKKTIE--------KISSSL-------GYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
             LGD+KTI         +I+ +           + +         +    +++    Q 
Sbjct: 29  RVLGDEKTIRPYDFSSEDRIARAYVPLLEMINERFARQFRLSLFNLLRRATEVTVGGVQV 88

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSL 127
            KFS  +H+       +   +              LV  L+E   G S +   +L NR  
Sbjct: 89  LKFSEYLHTLFMPTSLNLVQIDPLRGTGLFVFDPKLVFMLVEQYFGGSGQFYNRLENREF 148

Query: 128 STVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMN 187
           +  E  + +  + +  A L Q        +           L    +  S+E V     +
Sbjct: 149 TPTEVHIIQLVLERTFADLKQAWEPVLAVNFEYLQTELNPRLATIAS--SSEMVVVSTFH 206

Query: 188 MTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSED--LIDPFARKTYQLNVNIDTR 245
           +  E     F + +P  TLL+     L++  K +    D        +      V +   
Sbjct: 207 VEFEGGGGEFHIALPY-TLLEPVRELLATGKKDDFAQADGGWNQALRKNVSDAEVELSCT 265

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           +   + +L +++ LK G ++P      +     A+G  ++    G    +  +++ +R+ 
Sbjct: 266 LTEIQLSLGEILALKSGDILPIELP--STVTALADGIPVFRVRYGIHHGSRALKVVERLL 323

Query: 306 FDQKS 310
             +  
Sbjct: 324 SPESF 328


>gi|300693352|ref|YP_003749325.1| flagellar motor switching and energizing component [Ralstonia
           solanacearum PSI07]
 gi|299075389|emb|CBJ34684.1| flagellar motor switching and energizing component [Ralstonia
           solanacearum PSI07]
          Length = 335

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 35/254 (13%), Positives = 87/254 (34%), Gaps = 7/254 (2%)

Query: 54  MDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLG 113
           +  + +IS    +  K+S  I +       +   +             NL+  ++++L G
Sbjct: 73  LRRNAEISVGPVKVQKYSEFIRNLVVPAAINLVHVKPLRGTALFVFDPNLIFIVVDHLFG 132

Query: 114 ASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNT 173
                  ++  R  + VE+++ +R +  +     +                         
Sbjct: 133 GDGRFHMRVEGRDFTQVEQRIIQRMLQLMFDHYGKAWQPIYPIEFEALRMEMHTEFA--N 190

Query: 174 NRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSE--NQSEDLIDPF 231
               NE V + + +M + +      + +P  T+++     L+S  + E     +  +   
Sbjct: 191 VATPNEVVVSTSFSMELGSNGGDVHVCMPY-TMIEPIRDLLTSAIQGEALEVDKRWVRLL 249

Query: 232 ARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGR 291
           +++     V +   +      + D++ +K+G VIP             +G  +  C  G 
Sbjct: 250 SQQVQTAEVELVAHLANANVQVSDILNMKVGDVIPLEL--DDSVTAKVDGVPVMECAYGT 307

Query: 292 VGKNYTIRITDRIN 305
               Y +R+   +N
Sbjct: 308 FNGQYALRVNRMLN 321


>gi|325981184|ref|YP_004293586.1| flagellar motor switch protein FliM [Nitrosomonas sp. AL212]
 gi|325530703|gb|ADZ25424.1| flagellar motor switch protein FliM [Nitrosomonas sp. AL212]
          Length = 325

 Score =  170 bits (430), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 36/271 (13%), Positives = 93/271 (34%), Gaps = 7/271 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       M   VDI+    +  KFS  + +       +   +           
Sbjct: 58  ERFARLLRIGLFNFMRRTVDIAVGPVKVIKFSEFVRNLVVPTNLNMVHMKPLRGTALFVF 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              L+  +++NL G       ++  R  +  E+++ +R +  +     +   +       
Sbjct: 118 DPELIFLIVDNLFGGDGRYHTRVEGRDFTQTEQRIIQRLLGVVFDEYEKSWKSVYPIQFE 177

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK 219
                             NE V  +  ++ + N      + IP   +++    +L S  +
Sbjct: 178 YVRSEMNPQFATI--ATPNEVVVCVTFDIDMGNKGGGLHVCIPYS-MVEPIRDTLYSALQ 234

Query: 220 SE--NQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            +     +  I   +++     V +   +   K T + +++++ G +IP    +     +
Sbjct: 235 GDHLEVDKRWIKLLSQQVQGAEVELVANLGGAKVTFEQILSMQSGDIIPLEIPKSISVCV 294

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
             +G  +  C  G +  +Y +R+   I+  +
Sbjct: 295 --DGVPVMDCRYGTMNGHYALRVNSMISRSE 323


>gi|17548599|ref|NP_521939.1| flagellar motor switch protein FliM [Ralstonia solanacearum
           GMI1000]
 gi|17430847|emb|CAD17529.1| probable flagellar motor switch protein flim [Ralstonia
           solanacearum GMI1000]
          Length = 335

 Score =  169 bits (428), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 34/254 (13%), Positives = 86/254 (33%), Gaps = 7/254 (2%)

Query: 54  MDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLG 113
           +  + +IS    +  K+S  I +       +   +             NL+  ++++L G
Sbjct: 73  LRRNAEISVGPVKVQKYSEFIRNLVVPAAINLVHVKPLRGTALFVFDPNLIFIVVDHLFG 132

Query: 114 ASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNT 173
                  ++  R  + VE+++ +R +  +     +                         
Sbjct: 133 GDGRFHMRVEGRDFTQVEQRIIQRMLQLMFEHYGKAWQPIYPIEFEPLRMEMHTEFA--N 190

Query: 174 NRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSE--NQSEDLIDPF 231
               NE V +   +M + +      + +P  T+++     L+S  + E     +  +   
Sbjct: 191 VATPNEVVVSTRFSMELGSNGGDVHVCMPY-TMIEPIRDLLTSAIQGEALEVDKRWVRLL 249

Query: 232 ARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGR 291
           +++     V +   +      + D++ +K+G V+P             +G  +  C  G 
Sbjct: 250 SQQVQTAEVEVVAHLANANVHVSDILNMKVGDVVPIEL--DDSVTARVDGVPVMECAYGT 307

Query: 292 VGKNYTIRITDRIN 305
               Y +R+   +N
Sbjct: 308 FNGQYALRVNRMLN 321


>gi|257095345|ref|YP_003168986.1| flagellar motor switch protein FliM [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257047869|gb|ACV37057.1| flagellar motor switch protein FliM [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 334

 Score =  169 bits (428), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 39/272 (14%), Positives = 96/272 (35%), Gaps = 7/272 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++L       M    +IS  S +  K+S    +       +  +            
Sbjct: 59  ERFARYLRIGLFNYMHRSTEISVGSIRVQKYSEFTRNLVVPTNLNLINAKPLRGTALFVF 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
             +LV  +++N+ G       ++  R  +  E+++ K  +  +    ++      + +  
Sbjct: 119 DPSLVFLVVDNMFGGDGRFHTRVEGRDFTATEQRIIKGLLGVVFTEYSRSWKPVYDLTFE 178

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK 219
                +++    N     +E V     ++      +   +  P   +++     L S  +
Sbjct: 179 YVR-SEMNSQFANI-ATPSEIVVATTFSIEFGGSTADLHICFPYS-MIEPIRDLLFSTMQ 235

Query: 220 SENQSEDLID--PFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
           S+  S D        ++     V I  R+     +L+ ++ +K+G ++P    EK   I 
Sbjct: 236 SDQLSTDRRWVIMLRKQLTNAEVEITARLATATVSLRQILEMKVGDIVPIDIPEK--VIA 293

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
             +   +  C  G+ G  Y I+I   +  + +
Sbjct: 294 QVDDVPLMECRYGQQGGQYAIKIDHFMTIENQ 325


>gi|91776323|ref|YP_546079.1| flagellar motor switch protein FliM [Methylobacillus flagellatus
           KT]
 gi|91710310|gb|ABE50238.1| flagellar motor switch protein FliM [Methylobacillus flagellatus
           KT]
          Length = 335

 Score =  169 bits (428), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 38/270 (14%), Positives = 97/270 (35%), Gaps = 7/270 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       +    ++S    +  K+S  I +       +   +        +  
Sbjct: 58  ERFARLLRIGLFNFLRRTTEVSVGPVKISKYSEFIRNLVVPTNLNLVQMKPLRGTALMVF 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  +++NL G       ++  R  +  E+++ +R +A +     +      +    
Sbjct: 118 DPTLVFLIVDNLFGGDGRFHTRVEGRDFTQTEQRIIQRVLAIVFETYAKSWEPVYKLEFE 177

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS--Q 217
                +++    N     NE V +   N+ + + +       P   +++     L+S  Q
Sbjct: 178 YIR-SEMNTQFANI-ATPNEVVVSTTFNIELGSASGEIHFCFPYS-MIEPIRDLLTSPLQ 234

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            ++    +  +    ++     V +   +   + TL D++ +K+G VIP    E+  A +
Sbjct: 235 GEALGVDKRWVRLMTQQIQSAEVMLIADLAKAEMTLGDILNMKVGDVIPLSISEEIEAKV 294

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFD 307
             +   +  C+ G     Y +R+   +  +
Sbjct: 295 --DNVPVMQCKYGVFNGQYALRVEKLLRSN 322


>gi|83747640|ref|ZP_00944676.1| FliM [Ralstonia solanacearum UW551]
 gi|207739721|ref|YP_002258114.1| flagellar motor switch protein flim [Ralstonia solanacearum
           IPO1609]
 gi|9438185|gb|AAF87587.1|AF283286_1 flagellar motor switch [Ralstonia solanacearum]
 gi|83725692|gb|EAP72834.1| FliM [Ralstonia solanacearum UW551]
 gi|206593103|emb|CAQ60009.1| flagellar motor switch protein flim [Ralstonia solanacearum
           IPO1609]
          Length = 335

 Score =  169 bits (427), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 35/254 (13%), Positives = 87/254 (34%), Gaps = 7/254 (2%)

Query: 54  MDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLG 113
           +  + +IS    +  K+S  I +       +   +             NL+  ++++L G
Sbjct: 73  LRRNAEISVGPVKVQKYSEFIRNLVVPAAINLVHVKPLRGTALFVFDPNLIFIVVDHLFG 132

Query: 114 ASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNT 173
                  ++  R  + VE+++ +R +A +     +                         
Sbjct: 133 GDGRFHMRVEGRDFTQVEQRIIQRMLALMFEHYGKAWQPIYPIEFEPLRMEMHTEFA--N 190

Query: 174 NRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSE--NQSEDLIDPF 231
               NE V +   +M + +      + +P  T+++     L+S  + E     +  +   
Sbjct: 191 VATPNEVVVSTRFSMELGSNGGDVHVCMPY-TMIEPIRDLLTSAIQGEALEVDKRWVRLL 249

Query: 232 ARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGR 291
           +++     V +   +      + D++ +K+G V+P             +G  +  C  G 
Sbjct: 250 SQQVQTAEVEVVAHLANANVHVSDILNMKVGDVVPLEL--DDFVTARVDGVPVMECAYGT 307

Query: 292 VGKNYTIRITDRIN 305
               Y +R+   +N
Sbjct: 308 FNGQYALRVNRMLN 321


>gi|288942630|ref|YP_003444870.1| flagellar motor switch protein FliM [Allochromatium vinosum DSM
           180]
 gi|288898002|gb|ADC63838.1| flagellar motor switch protein FliM [Allochromatium vinosum DSM
           180]
          Length = 325

 Score =  169 bits (427), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 37/270 (13%), Positives = 91/270 (33%), Gaps = 9/270 (3%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++L       +    +IS    +  KFS  +HS       +   +           
Sbjct: 62  ERFARYLRVHLFNLLRRSSEISVIGARVTKFSEYLHSLYVPTSLNLVRVYPLHGTALFVF 121

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  + +E ++ K  +    + + +           
Sbjct: 122 DPKLVFGLVDNFFGGDGRYYSRIEGRDFTPMEMRVIKNLLDASFSDMQKAWEPVMHLDF- 180

Query: 160 LEDFYDIDYLKKNTN-RLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQN 218
             +F + +   +  N     E V   + ++ +E    +  +  P   +++     L +  
Sbjct: 181 --EFINAEVNPQFANIVSPTEIVVINDFHIELEGGGGNMHVTFPYS-MIEPIREVLDTGL 237

Query: 219 KSE--NQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAI 276
           +S+     +        +     V I + +     T++ ++ +K G +IP    E    +
Sbjct: 238 QSDRSGVDQRWQRALEEEIPLAKVEISSVLTEVTLTVEQLLEVKPGDIIPVDLPE--TIV 295

Query: 277 LSANGKEIYSCELGRVGKNYTIRITDRINF 306
           L+     ++  + G       I+I + I  
Sbjct: 296 LNVEDIPLFRGKFGVSNGINAIKIMEHIKH 325


>gi|186477685|ref|YP_001859155.1| flagellar motor switch protein FliM [Burkholderia phymatum STM815]
 gi|184194144|gb|ACC72109.1| flagellar motor switch protein FliM [Burkholderia phymatum STM815]
          Length = 332

 Score =  168 bits (426), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 37/272 (13%), Positives = 89/272 (32%), Gaps = 7/272 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
            + + L       M    +IS    +  K+S    +       +   +            
Sbjct: 60  RFARLLRVGIFNFMRRTAEISVGPVKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFD 119

Query: 101 NNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNL 160
            NLV  +++NL G       ++  R  +  E+++  + +  +         + +  S   
Sbjct: 120 PNLVFFVVDNLFGGDGRFHTRVEGREFTQTEQRIIHKLLNLVFEHYTAAWKSVRPLSFEY 179

Query: 161 EDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS--QN 218
                            NE V     ++       +  + +P   +++     LSS  Q 
Sbjct: 180 TRSEMHTQFANV--ATPNEIVIVTQFSIEFGPTGGTLHICMPYS-MIEPIRDVLSSPIQG 236

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           ++       +   +++     V +   +     T ++++ +K G V+P    E   A + 
Sbjct: 237 EALEVDRRWVRVLSQQVQAAEVELTADLAQIPVTFQEILNMKAGDVLPINIPEHITAKV- 295

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
            +G  +  C  G     Y +R+   I+  ++ 
Sbjct: 296 -DGVPVMECGYGIFNGQYALRVQKMISAAEQM 326


>gi|299068765|emb|CBJ40005.1| flagellar motor switching and energizing component [Ralstonia
           solanacearum CMR15]
          Length = 335

 Score =  168 bits (426), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 34/254 (13%), Positives = 86/254 (33%), Gaps = 7/254 (2%)

Query: 54  MDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLG 113
           +  + +IS    +  K+S  I +       +   +             NL+  ++++L G
Sbjct: 73  LRRNAEISVGPVKVQKYSEFIRNLVVPAAINLVHVKPLRGTALFVFDPNLIFIVVDHLFG 132

Query: 114 ASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNT 173
                  ++  R  + VE+++ +R +  +     +                         
Sbjct: 133 GDGRFHMRVEGRDFTQVEQRIIQRMLQLMFEHYGKAWQPIYPIEFEPLRMEMHTEFA--N 190

Query: 174 NRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSE--NQSEDLIDPF 231
               NE V +   +M + +      + +P  T+++     L+S  + E     +  +   
Sbjct: 191 VATPNEVVVSTRFSMELGSNGGDVHVCMPY-TMIEPIRDLLTSAIQGEALEVDKRWVRLL 249

Query: 232 ARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGR 291
           +++     V +   +      + D++ +K+G V+P             +G  +  C  G 
Sbjct: 250 SQQVQTAEVEVVAHLANANVHVSDILNMKVGDVVPIEL--DDAVTARVDGVPVMECAYGT 307

Query: 292 VGKNYTIRITDRIN 305
               Y +R+   +N
Sbjct: 308 FNGQYALRVNRMLN 321


>gi|261855321|ref|YP_003262604.1| flagellar motor switch protein FliM [Halothiobacillus neapolitanus
           c2]
 gi|261835790|gb|ACX95557.1| flagellar motor switch protein FliM [Halothiobacillus neapolitanus
           c2]
          Length = 347

 Score =  167 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 42/274 (15%), Positives = 100/274 (36%), Gaps = 8/274 (2%)

Query: 38  LGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFI 97
           L   + +         +   VDIS    +  K+S   H+       +   +         
Sbjct: 58  LNERFARNFRIRLVSMLRRTVDISIEGVRMMKYSEYSHALYVPTSLTLVHVRPLKGTGLF 117

Query: 98  GCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESS 157
              + LV  L++N  G       ++  R  +  E ++  R + Q    + +  +     +
Sbjct: 118 MMESQLVFKLVDNFFGGFG-MHAKIEGRDFTPTELRVITRVLEQAIDEVQRSWTPVYPVN 176

Query: 158 PNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQ 217
                 ++++    N      E V   +  + +E     F +++P   +++     L   
Sbjct: 177 IQTVS-HEMNPQLANI-VSGTEVVVVNSFRIEVEGGGGKFDIVLPYS-MIEPIRDLLDGG 233

Query: 218 NKSEN--QSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCA 275
            + +     E       R+  + ++ +  ++   + +L D+  +++G V+PF   E    
Sbjct: 234 MQGDRLEVDERWTQALKRELGRADIELVAQLGEMRMSLADIAHMEVGDVLPFEMPE--QV 291

Query: 276 ILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
           +L+A G  +Y  +LG    N ++RI   +    +
Sbjct: 292 VLTAQGLPLYQGKLGVHRGNKSVRIQSPVKERLE 325


>gi|325109075|ref|YP_004270143.1| flagellar motor switch protein FliM [Planctomyces brasiliensis DSM
           5305]
 gi|324969343|gb|ADY60121.1| flagellar motor switch protein FliM [Planctomyces brasiliensis DSM
           5305]
          Length = 368

 Score =  167 bits (424), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 43/294 (14%), Positives = 102/294 (34%), Gaps = 11/294 (3%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            +  + +       +   L  + +      +++   S     +   + S +    F+   
Sbjct: 58  MRAFQALHEGFSREFGASLSGMLRSI----IEVKLISVDQLTYGEFVFSLENPTCFNLLF 113

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
               + +  +  + +++  +++ LLG    +     +R L+ +E +L  R        L 
Sbjct: 114 SDKLNGHLILDLNPSIIYPIVDRLLGGGKSSTQSYPSRPLTEIELRLVSRITKSAITALE 173

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
                  E    +        L +      NE +  I+  +++  +     L IP  T +
Sbjct: 174 NSWINISELQLRVTQIESNPQLVQIV--PPNEVIVLISFEISMGEMRGIMNLCIPFNT-I 230

Query: 208 KTTLISLSSQNKSENQSEDLIDPFARKTYQ----LNVNIDTRINLKKTTLKDVVTLKIGQ 263
           +     LSS   S    + +      +         VN+   +     T  +++ L +G 
Sbjct: 231 EPLTGKLSSDTWSAYTKQQISPQQKAQLEVGIGAAKVNLVAALAETHLTASELMNLDVGD 290

Query: 264 VIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLHK 317
           VI      K    +   GK  +S ++G++  +  I+I D++   +  +   L K
Sbjct: 291 VILTERDVKKGLTIFVEGKPTFSADVGQIKGHKAIQIRDKLPKTRDIVDQHLQK 344


>gi|73539704|ref|YP_300071.1| flagellar motor switch protein FliM [Ralstonia eutropha JMP134]
 gi|72123041|gb|AAZ65227.1| Flagellar motor switch protein FliM [Ralstonia eutropha JMP134]
          Length = 337

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 38/269 (14%), Positives = 84/269 (31%), Gaps = 4/269 (1%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       +    DI+  S +  KF     +       +   +           
Sbjct: 63  ERFARSLRTALFNFIRRGADITVGSVRIEKFGDFARNLPMPTNLNLVHMKPLRGTALFVY 122

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
             NLV  +++NL G       ++  R  +  E+++ +R +            T       
Sbjct: 123 DPNLVFLVVDNLFGGDGRFHTRVEGRDFTQTEQRIIQRMLEMTLTSYGNAWRTVYPIETE 182

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK 219
                             NE V T   ++ +  V     + +P   +     + ++    
Sbjct: 183 YVRSEMHTKFANVATV--NEAVITTAFHIELGAVGGQLHVCLPYAMIEPLKDLLMNPLQD 240

Query: 220 SENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSA 279
            +   +  +   + +    +V +       ++T+ +V+ L+ G V+P    E        
Sbjct: 241 EKEVDKSWLAKLSTQLRAADVEVVAEFTHVQSTVAEVLALRAGDVLPIELPEH--VFGKV 298

Query: 280 NGKEIYSCELGRVGKNYTIRITDRINFDQ 308
           NG  +  C  G +   Y +R+   IN   
Sbjct: 299 NGVPVMQCGFGTINGQYALRVERMINHQD 327


>gi|188592199|ref|YP_001796797.1| flim: flagellar motor switching and energizing component
           [Cupriavidus taiwanensis LMG 19424]
 gi|170938573|emb|CAP63560.1| FliM: flagellar motor switching and energizing component
           [Cupriavidus taiwanensis LMG 19424]
          Length = 339

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 39/269 (14%), Positives = 84/269 (31%), Gaps = 4/269 (1%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       +    DIS  S +  KF     +       +   L           
Sbjct: 62  ERFARSLRTALFNFIRRGADISVGSVRIEKFGDFARNLPMPTNLNLVHLKPLRGTALFVY 121

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
             NLV  +++NL G       ++  R  +  E+++ +R +            T       
Sbjct: 122 DPNLVFLVVDNLFGGDGRFHTRVEGRDFTQTEQRIIQRMLELTLTSYGNAWRTVHPIETE 181

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK 219
                             NE V T   ++ +  V     + +P   +     + ++    
Sbjct: 182 YIRSEMHPKFANV--ATHNEAVVTTAFHIELGAVGGQLHVCLPYAMIEPLKDLLMNPLQD 239

Query: 220 SENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSA 279
            +   +  +   + +     V +       ++T+ +V+ ++ G V+P    EK       
Sbjct: 240 EKEVDKGWVTQLSTQLRAAEVELVAEFAHLQSTVAEVLAMRAGDVLPIELPEK--VFGKV 297

Query: 280 NGKEIYSCELGRVGKNYTIRITDRINFDQ 308
           +G  +  C  G +   Y +R+   IN   
Sbjct: 298 DGVPVMQCGFGTMNGQYALRVERMINHQD 326


>gi|302878292|ref|YP_003846856.1| flagellar motor switch protein FliM [Gallionella capsiferriformans
           ES-2]
 gi|302581081|gb|ADL55092.1| flagellar motor switch protein FliM [Gallionella capsiferriformans
           ES-2]
          Length = 329

 Score =  167 bits (422), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 41/271 (15%), Positives = 95/271 (35%), Gaps = 7/271 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + +         +    +IS    +  KF   + +       +         N     
Sbjct: 59  ERFARLFRIGLFNFIRRTPEISVGPVRVLKFGEFVRNLAVPTNLNIIQPKPLRGNGLFIF 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
             NLV  +++N+ G       ++  R  +  E+++ ++ +A +     +   T       
Sbjct: 119 DPNLVFLVVDNMFGGDGRFHTRVEGREFTQTEQRIIQKMLAVVFETYAKAWETVYPLEFE 178

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK 219
                +++    N     NE V     ++ +     +F + +P  T L+     L +  +
Sbjct: 179 FVR-SEMNPQFANI-ATPNEVVIVTTFDIELGGNGGAFHICMPYST-LEPVKDLLFNNIQ 235

Query: 220 SE--NQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            E     +  +   +R+     + +   +     TL+ V+ +++G VIP    E   A  
Sbjct: 236 GEHLAVDKRWLQLLSRQVQCAEIELAATLGQANITLERVLKMRVGDVIPLNVDENITA-- 293

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
           S +G  I  C+ G     Y ++I   +  ++
Sbjct: 294 SIDGVPIMECKYGVFNNQYALKIVKMLTTNE 324


>gi|329901244|ref|ZP_08272769.1| Flagellar motor switch protein FliM [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327549176|gb|EGF33768.1| Flagellar motor switch protein FliM [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 333

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 40/269 (14%), Positives = 92/269 (34%), Gaps = 5/269 (1%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       +    ++S    +  K+S  I +       +   +        +  
Sbjct: 58  ERFARLLRIGLFNFLRRSAEVSIGPVRVSKYSEFIRNLVVPTNLNLVHMKPLRGTVLMVF 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
             NLV  +++NL G       ++  R  +  E+++ +R +A +     +           
Sbjct: 118 DPNLVFLIVDNLFGGDGRFHTRVEGRDFTQTEQRIIQRILAIVFENYAKSWEPVYPVEFE 177

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QN 218
                +++    N     NE V      + +  V+      IP  T+     I  SS Q 
Sbjct: 178 YIR-SEMNTQFANI-ATPNEVVICTTFTIELGPVSGEMHFCIPYSTIEPIRDILTSSLQG 235

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           ++    +  I    ++     V I     + ++    ++ +K+G +IP    +   A + 
Sbjct: 236 ETLEVDKRWIRLMTQQIQTAEVEIIADFGVARSNFGAILNMKVGDIIPLAVPDVVLAKV- 294

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFD 307
            +G  +  C  G+    Y +R+   +   
Sbjct: 295 -DGVPVMECTYGKFNGQYALRVEKLLAQS 322


>gi|53723902|ref|YP_104282.1| flagellar motor switch protein FliM [Burkholderia mallei ATCC
           23344]
 gi|67641904|ref|ZP_00440669.1| flagellar motor switch protein FliM [Burkholderia mallei GB8 horse
           4]
 gi|121600665|ref|YP_994775.1| flagellar motor switch protein FliM [Burkholderia mallei SAVP1]
 gi|124385588|ref|YP_001027842.1| flagellar motor switch protein FliM [Burkholderia mallei NCTC
           10229]
 gi|126451066|ref|YP_001082210.1| flagellar motor switch protein FliM [Burkholderia mallei NCTC
           10247]
 gi|167000456|ref|ZP_02266270.1| flagellar motor switch protein FliM [Burkholderia mallei PRL-20]
 gi|254174753|ref|ZP_04881414.1| flagellar motor switch protein FliM [Burkholderia mallei ATCC
           10399]
 gi|254201359|ref|ZP_04907723.1| flagellar motor switch protein FliM [Burkholderia mallei FMH]
 gi|254206701|ref|ZP_04913052.1| flagellar motor switch protein FliM [Burkholderia mallei JHU]
 gi|254357364|ref|ZP_04973638.1| flagellar motor switch protein FliM [Burkholderia mallei
           2002721280]
 gi|52427325|gb|AAU47918.1| flagellar motor switch protein FliM [Burkholderia mallei ATCC
           23344]
 gi|121229475|gb|ABM51993.1| flagellar motor switch protein FliM [Burkholderia mallei SAVP1]
 gi|124293608|gb|ABN02877.1| flagellar motor switch protein FliM [Burkholderia mallei NCTC
           10229]
 gi|126243936|gb|ABO07029.1| flagellar motor switch protein FliM [Burkholderia mallei NCTC
           10247]
 gi|147747253|gb|EDK54329.1| flagellar motor switch protein FliM [Burkholderia mallei FMH]
 gi|147752243|gb|EDK59309.1| flagellar motor switch protein FliM [Burkholderia mallei JHU]
 gi|148026428|gb|EDK84513.1| flagellar motor switch protein FliM [Burkholderia mallei
           2002721280]
 gi|160695798|gb|EDP85768.1| flagellar motor switch protein FliM [Burkholderia mallei ATCC
           10399]
 gi|238522917|gb|EEP86359.1| flagellar motor switch protein FliM [Burkholderia mallei GB8 horse
           4]
 gi|243063644|gb|EES45830.1| flagellar motor switch protein FliM [Burkholderia mallei PRL-20]
          Length = 332

 Score =  166 bits (421), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 36/272 (13%), Positives = 87/272 (31%), Gaps = 7/272 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
            + + L       M    +IS +  +  K+S    +       +   +            
Sbjct: 60  RFARLLRIGIFNFMRRTAEISVSQVKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFD 119

Query: 101 NNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNL 160
            NLV  +++NL G       ++  R  +  E+++  + +  +         + +      
Sbjct: 120 PNLVFFVVDNLFGGDGRFHTRVEGRDFTATEQRIIGKLLNLVFEHYASAWKSVRPLQFEF 179

Query: 161 EDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS--QN 218
                            NE V     ++       +  + +P   +++     LSS  Q 
Sbjct: 180 VRSEMHTQFA--NVATPNEIVIATQFSIEFGPTGGTLHICMPYS-MIEPIRDVLSSPIQG 236

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           ++       +   +++     V +   +    TT + ++ L+ G V+P    +   A + 
Sbjct: 237 EALEVDRRWVRVLSQQVQSAEVELVADLAEVPTTFEKILNLRTGDVLPLDITDSITAKV- 295

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
            +G  +  C  G     Y +R+   I+     
Sbjct: 296 -DGVPVMECGYGIFNGQYALRVQRMISASDTM 326


>gi|94314217|ref|YP_587426.1| flagellar motor switch protein FliM [Cupriavidus metallidurans
           CH34]
 gi|93358069|gb|ABF12157.1| flagellar motor switch protein FliM [Cupriavidus metallidurans
           CH34]
          Length = 336

 Score =  166 bits (420), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 36/269 (13%), Positives = 88/269 (32%), Gaps = 4/269 (1%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       +    DIS  + +  K+   + +       +   +           
Sbjct: 62  ERFARALRTALFNFIRRGADISVGTVRIEKYGDFVRNLPVPTNLNLVHMKPLRGTALFVY 121

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
             NLV  +++NL G       ++  R  +  E+++ +R +    +   Q   T      +
Sbjct: 122 DPNLVFLVVDNLFGGDGRFHTRVEGRDFTQTEQRIIRRMLDLTLSSYGQAWRTVHPIEFD 181

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK 219
                             N+ V T   ++ +  V     + IP   +     + ++    
Sbjct: 182 YVRSEMHTKFANVAG--PNDAVVTTAFHIELGAVGGQLHICIPFSMIEPLRDLLMNPLQD 239

Query: 220 SENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSA 279
                +  +   + +     V +       ++T+ +V+ ++ G V+P    E     +  
Sbjct: 240 EVEVDKRWLGQLSNQLRAAEVELVAEFTHLRSTVAEVLAMREGDVLPIELPEHIFGKV-- 297

Query: 280 NGKEIYSCELGRVGKNYTIRITDRINFDQ 308
           NG  +  C  G +   Y +R+   +N+  
Sbjct: 298 NGVPVMQCGFGTMNGQYALRVERMLNYQD 326


>gi|167834865|ref|ZP_02461748.1| flagellar motor switch protein FliM [Burkholderia thailandensis
           MSMB43]
          Length = 332

 Score =  166 bits (420), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 37/272 (13%), Positives = 88/272 (32%), Gaps = 7/272 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
            + + L       M    +IS +  +  K+S    +       +   +            
Sbjct: 60  RFARLLRIGIFNFMRRTAEISVSQVKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFD 119

Query: 101 NNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNL 160
            NLV  +++NL G       ++  R  +  E+++  + +  +         + +  +   
Sbjct: 120 PNLVFFVVDNLFGGDGRFHTRVEGRDFTATEQRIIGKLLNLVFEHYASAWKSVRPLAFEF 179

Query: 161 EDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS--QN 218
                            NE V     ++       +  + +P   +++     LSS  Q 
Sbjct: 180 VRSEMHTQFA--NVATPNEIVIVTQFSIEFGPTGGTLHICMPYS-MIEPIRDVLSSPIQG 236

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           ++       +   +++     V +   +    TT + ++ L+ G V+P    E   A + 
Sbjct: 237 EALEVDRRWVRVLSQQVQSAEVELVADLAEVPTTFEKILNLRAGDVLPLDIAESISAKV- 295

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
            +G  +  C  G     Y +R+   I+     
Sbjct: 296 -DGVPVMECGYGIFNGQYALRVQKMISASDTM 326


>gi|163744328|ref|ZP_02151688.1| flagellar motor switch protein [Oceanibulbus indolifex HEL-45]
 gi|161381146|gb|EDQ05555.1| flagellar motor switch protein [Oceanibulbus indolifex HEL-45]
          Length = 315

 Score =  166 bits (420), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 49/268 (18%), Positives = 94/268 (35%), Gaps = 7/268 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
            L    +P   K    +  +I  TS +   +   + S +   + + A+   W S      
Sbjct: 36  RLLLALVPD-LKSYCTIAPEIELTSLEYMPYEDAMESIQSPSLIAIANAEGWGSQIACVV 94

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
             +L+ ++LE +LG    T  +   R L+ +E+KL +R        L QC+        +
Sbjct: 95  EPDLLFSVLEIMLGGRRATTQEWKPRGLTAIEQKLGRRLAELSLKGLAQCLQDVSPVQFD 154

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
           ++        +             + M+M  E+ +    L++P  TL  +   L      
Sbjct: 155 IQSLES--NPRSVMLAAPRTATVLVRMHMQFEDRSGHMALVLPYGTLDEVSAQLAQPFLG 212

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            +S   S    D    +     V I   +      L +V+  K GQVI       T  + 
Sbjct: 213 GRSPTDSNARKD-MNNQISSTTVTITGVLQEVTIPLHEVLEWKTGQVIDLGMTVDTPVVG 271

Query: 278 SANGKEIYSCELGR-VGKNYTIRITDRI 304
             N + ++    G+       +R+   +
Sbjct: 272 MVNAQPMFQAAFGQRSNGALALRVIQSL 299


>gi|163856451|ref|YP_001630749.1| flagellar motor switch protein FliM [Bordetella petrii DSM 12804]
 gi|163260179|emb|CAP42481.1| flagellar motor switch protein FliM [Bordetella petrii]
          Length = 335

 Score =  165 bits (419), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 36/273 (13%), Positives = 92/273 (33%), Gaps = 6/273 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L  +    M  + DI+  S +  K++    +       +   +           
Sbjct: 60  ERFARQLRHLLLNFMRRNADITVGSIKILKYADFERNLPVPSNLNMIQMKPLRGTALFTY 119

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
             +LV  ++++L G       ++  R  +T E+++ +R +        +           
Sbjct: 120 DPSLVFLVIDSLFGGDGRYHTRVEGRDFTTTEQRIIRRLLNLTLESYGKSWEAVYPIEFE 179

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTT--LISLSSQ 217
                        T   +NE V   + ++          + +P   +      L     +
Sbjct: 180 YVRSEMHTKFASITG--NNEVVVVSSFHIEFGATGGDLNICLPYSMIEPVRDLLTRPLQE 237

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
              E   +      +R+    +V++        +++++++ LK+G V+P    E    I 
Sbjct: 238 TTLEEVDQRWTHQLSRQVRSADVDLTAEFASIPSSIRELLRLKVGDVLPIEVPE--TVIA 295

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
           + NG  +  C  G     Y +R+ +   ++  +
Sbjct: 296 NVNGVPLMECSYGVFNGQYALRVQNLFTYESDT 328


>gi|121602879|ref|YP_989408.1| flagellar motor switch protein FliM [Bartonella bacilliformis
           KC583]
 gi|120615056|gb|ABM45657.1| flagellar motor switch protein FliM [Bartonella bacilliformis
           KC583]
          Length = 323

 Score =  165 bits (419), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 49/265 (18%), Positives = 106/265 (40%), Gaps = 5/265 (1%)

Query: 54  MDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLG 113
             L+  I   S  + K   I  +   + +    S   W ++      + LV  + E   G
Sbjct: 61  TPLEFTIDVVSLDTLKIDKITQTIGTDTLLIDFSSDRWGNDVIFVLDSVLVELITETFFG 120

Query: 114 ASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNT 173
           A+   I     R  S  E  +++     ++  ++    T  +S                T
Sbjct: 121 ATEPKIINRNGRPFSPTECSISEHFGKLLANAMDSVFGTGDKSLLIFTQTRKAQEFNTET 180

Query: 174 NRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSED--LIDPF 231
              S  F  +  +++      +   +++P+    +    +++   ++  +  D       
Sbjct: 181 FHQSQMF--SCTLSIKCGEAEAHLNILMPRSCH-RPIHEAITRALRAPEKRMDPLWTKRL 237

Query: 232 ARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGR 291
            ++  Q +V I+  +     TL +++ LK+GQV+P          L +  K +Y C LG+
Sbjct: 238 RKEVSQAHVQIEAFMQQGSMTLNELLNLKVGQVLPLPINAVKQVKLRSGDKSLYKCSLGK 297

Query: 292 VGKNYTIRITDRINFDQKSLKNFLH 316
           +GKN++IR+TD I+ +++ +   +H
Sbjct: 298 IGKNFSIRVTDPIDEEKEMINELVH 322


>gi|53717666|ref|YP_106652.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           K96243]
 gi|76811753|ref|YP_331656.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           1710b]
 gi|126441392|ref|YP_001057084.1| flagellar motor switch protein FliM [Burkholderia pseudomallei 668]
 gi|126453439|ref|YP_001064314.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           1106a]
 gi|134281495|ref|ZP_01768203.1| flagellar motor switch protein FliM [Burkholderia pseudomallei 305]
 gi|167717395|ref|ZP_02400631.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           DM98]
 gi|167736438|ref|ZP_02409212.1| flagellar motor switch protein FliM [Burkholderia pseudomallei 14]
 gi|167813512|ref|ZP_02445192.1| flagellar motor switch protein FliM [Burkholderia pseudomallei 91]
 gi|167822054|ref|ZP_02453525.1| flagellar motor switch protein FliM [Burkholderia pseudomallei 9]
 gi|167843667|ref|ZP_02469175.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           B7210]
 gi|167892138|ref|ZP_02479540.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           7894]
 gi|167900650|ref|ZP_02487855.1| flagellar motor switch protein FliM [Burkholderia pseudomallei NCTC
           13177]
 gi|167908870|ref|ZP_02495961.1| flagellar motor switch protein FliM [Burkholderia pseudomallei 112]
 gi|167916909|ref|ZP_02504000.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           BCC215]
 gi|217424100|ref|ZP_03455600.1| flagellar motor switch protein FliM [Burkholderia pseudomallei 576]
 gi|226193119|ref|ZP_03788729.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           Pakistan 9]
 gi|237814422|ref|YP_002898873.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           MSHR346]
 gi|242315986|ref|ZP_04815002.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           1106b]
 gi|254184092|ref|ZP_04890683.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           1655]
 gi|254186558|ref|ZP_04893075.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254194648|ref|ZP_04901079.1| flagellar motor switch protein FliM [Burkholderia pseudomallei S13]
 gi|254258129|ref|ZP_04949183.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           1710a]
 gi|254298640|ref|ZP_04966091.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           406e]
 gi|52208080|emb|CAH34010.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           K96243]
 gi|76581206|gb|ABA50681.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           1710b]
 gi|126220885|gb|ABN84391.1| flagellar motor switch protein FliM [Burkholderia pseudomallei 668]
 gi|126227081|gb|ABN90621.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           1106a]
 gi|134247162|gb|EBA47248.1| flagellar motor switch protein FliM [Burkholderia pseudomallei 305]
 gi|157808681|gb|EDO85851.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           406e]
 gi|157934243|gb|EDO89913.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           Pasteur 52237]
 gi|169651398|gb|EDS84091.1| flagellar motor switch protein FliM [Burkholderia pseudomallei S13]
 gi|184214624|gb|EDU11667.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           1655]
 gi|217393163|gb|EEC33185.1| flagellar motor switch protein FliM [Burkholderia pseudomallei 576]
 gi|225934719|gb|EEH30696.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           Pakistan 9]
 gi|237504112|gb|ACQ96430.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           MSHR346]
 gi|242139225|gb|EES25627.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           1106b]
 gi|254216818|gb|EET06202.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           1710a]
          Length = 332

 Score =  165 bits (419), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 36/272 (13%), Positives = 87/272 (31%), Gaps = 7/272 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
            + + L       M    +IS +  +  K+S    +       +   +            
Sbjct: 60  RFARLLRIGIFNFMRRTAEISVSQVKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFD 119

Query: 101 NNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNL 160
            NLV  +++NL G       ++  R  +  E+++  + +  +         + +      
Sbjct: 120 PNLVFFVVDNLFGGDGRFHTRVEGRDFTATEQRIIGKLLNLVFEHYASAWKSVRPLQFEF 179

Query: 161 EDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS--QN 218
                            NE V     ++       +  + +P   +++     LSS  Q 
Sbjct: 180 VRSEMHTQFA--NVATPNEIVIVTQFSIEFGPTGGTLHICMPYS-MIEPIRDVLSSPIQG 236

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           ++       +   +++     V +   +    TT + ++ L+ G V+P    +   A + 
Sbjct: 237 EALEVDRRWVRVLSQQVQSAEVELVADLAEVPTTFEKILNLRTGDVLPLDITDSITAKV- 295

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
            +G  +  C  G     Y +R+   I+     
Sbjct: 296 -DGVPVMECGYGIFNGQYALRVQRMISASDTM 326


>gi|302343739|ref|YP_003808268.1| flagellar motor switch protein FliM [Desulfarculus baarsii DSM
           2075]
 gi|301640352|gb|ADK85674.1| flagellar motor switch protein FliM [Desulfarculus baarsii DSM
           2075]
          Length = 328

 Score =  165 bits (418), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 36/272 (13%), Positives = 89/272 (32%), Gaps = 5/272 (1%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
            + +         +   VD++ TS    KF   + S           +     +      
Sbjct: 60  RFARLFRTTLSSALRKIVDMTTTSVDMVKFGEFMRSLPVPTSLHIFKMDPLRGHAIFVLE 119

Query: 101 NNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNL 160
           + LV  L+E   G +     ++  R  + +E++L ++ +      +        E +   
Sbjct: 120 SKLVFNLVETFFGGAGGGNVKIEGRDFTAIEQQLTRKVVMLALKDMESAWKPVHEVTMVY 179

Query: 161 EDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKS 220
                             + V  +   + +E+ A +  + IP  T ++     L +  +S
Sbjct: 180 SRTEINPQFASIV--PPTDVVIVVKFELEMEHTAGTVTVCIPYST-IEPIRTKLYAGFQS 236

Query: 221 E--NQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           +      + +  F ++  +  V     +   + T  D++ LK+G V+          +  
Sbjct: 237 DQLEVDHEWMRRFRKQLREAEVEFTVELGRTELTSGDLLQLKVGDVLQLDSDINGHLVAM 296

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
             G   +    G++  N   R+    ++  + 
Sbjct: 297 VEGVPKFLGRPGQMRGNKAFRVEGFKDYGAEI 328


>gi|330902572|gb|EGH33587.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           japonica str. M301072PT]
          Length = 244

 Score =  165 bits (418), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 36/245 (14%), Positives = 84/245 (34%), Gaps = 18/245 (7%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++        +    D++    Q  KF   +HS       + A +           
Sbjct: 9   ERFARYTRISMFNLLRRSADVAVGGVQVMKFGEYVHSLYVPTSLNLAKIKPLRGTALFIL 68

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  L++N  G       ++  R  +  E ++ +  + Q    L +      E    
Sbjct: 69  DAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLDQAFVDLKEAWQAIMEV--- 124

Query: 160 LEDFYDIDYLKKNTNRL------SNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                + +Y+    N         +E V     ++ ++       + +P   +++     
Sbjct: 125 -----NFEYINSEVNPAMANIVGPSEAVVISTFHIELDGGGGDLHVTMPYS-MIEPIREM 178

Query: 214 LSSQNKS--ENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S  ++Q E  ++        +NV + T I  ++  L+D++ ++ G VIP    +
Sbjct: 179 LDAGFQSDLDDQDERWVNALKEDVLDVNVPLTTTIAQRQLPLRDILHMRPGDVIPVELSD 238

Query: 272 KTCAI 276
                
Sbjct: 239 SLVMR 243


>gi|114332022|ref|YP_748244.1| flagellar motor switch protein FliM [Nitrosomonas eutropha C91]
 gi|114309036|gb|ABI60279.1| flagellar motor switch protein FliM [Nitrosomonas eutropha C91]
          Length = 330

 Score =  165 bits (418), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 45/292 (15%), Positives = 94/292 (32%), Gaps = 13/292 (4%)

Query: 12  PLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFS 71
           P       R+         I          +   L       +   VDIS  S ++ K+S
Sbjct: 41  PYDMATQERIVRGRMPALEIINA------RFANSLQIGLYNFLRRGVDISAGSIKTIKYS 94

Query: 72  HIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVE 131
               S       +  S+        I    NL+  +++N+ G       ++  R  +  E
Sbjct: 95  EFTRSLVVPANINMVSMKPLRGTALITIDPNLIFLIVDNMFGGDGRFHTRVEGREFTLTE 154

Query: 132 KKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIE 191
           + + +R +  +     +   +            +++    N    ++  V   +  + + 
Sbjct: 155 QGIIRRLLDVLFENYEKAWKSVYPVRFEYIR-AEMNPQFANIATPTD-VVVASSFELNLG 212

Query: 192 NVASSFVLIIPQETLLKTTLISL--SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLK 249
                F +  P  T+L+     L  S Q        + I    R+     + I   +   
Sbjct: 213 GNRGEFYICTPY-TMLEPIRDLLNNSMQEDHAEVDNNWIKSLTRQVQGAEIEIIANLGHT 271

Query: 250 KTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
           + TL  ++ ++ G VI          +  ANG  I  C  G +  +Y +++ 
Sbjct: 272 RVTLHQILNMQEGDVIALDIP--DTVVAMANGVPIMDCHYGILNDHYALKVK 321


>gi|237653569|ref|YP_002889883.1| flagellar motor switch protein FliM [Thauera sp. MZ1T]
 gi|237624816|gb|ACR01506.1| flagellar motor switch protein FliM [Thauera sp. MZ1T]
          Length = 336

 Score =  165 bits (418), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 38/272 (13%), Positives = 99/272 (36%), Gaps = 7/272 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++L       M  + ++S    +  K++  + +       +  +         +  
Sbjct: 59  ERFARYLRIGLFNYMHRNAEVSAGPIKVQKYAEFVRNLVVPTNLNLITAKPLRGTGLVVF 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
             NLV  +++N+ G       ++  R  +  E+++ +  +  + A   +  +      P 
Sbjct: 119 DPNLVFLVVDNMFGGDGRFHTRVEGRDFTPTEQRIIRGMLDVVFAEYVRAWAPVFNLQPE 178

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK 219
                +++    N     +E V + ++++      +   +  P   +L+     L S  +
Sbjct: 179 FIR-SEMNSQFANI-ATPSEVVVSTSLSVEFGGSQAEMHICFPYS-MLEPIRDLLYSSMQ 235

Query: 220 SE--NQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
           S+        I    R+     V +       + +L+D+V +++G VIP   +    A +
Sbjct: 236 SDHLTSDRRWIKLLTRQLQTAEVELACSFGTARVSLRDIVDMRVGDVIPLAVQPVLQAEV 295

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
             +G  ++ C  G     Y +R+   I  +  
Sbjct: 296 --DGVPVFECRQGTRNGRYALRVERFITAEDN 325


>gi|254251031|ref|ZP_04944349.1| Flagellar motor switch protein [Burkholderia dolosa AUO158]
 gi|124893640|gb|EAY67520.1| Flagellar motor switch protein [Burkholderia dolosa AUO158]
          Length = 332

 Score =  165 bits (417), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 35/272 (12%), Positives = 86/272 (31%), Gaps = 7/272 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
            + + L       M    +IS +  +  K+S    +       +   +            
Sbjct: 60  RFARLLRIGIFNFMRRTAEISVSQVKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFD 119

Query: 101 NNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNL 160
            NLV  +++NL G       ++  R  +  E+++  + +  +         + +      
Sbjct: 120 PNLVFFVVDNLFGGDGRFHTRVEGRDFTATEQRIIGKLLNLVFEHYTVAWKSVRPLQFEF 179

Query: 161 EDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS--QN 218
                            NE V     ++       +  + +P   +++     LSS  Q 
Sbjct: 180 VRSEMHTQFA--NVATPNEIVIVTQFSIEFGPTGGTLHICMPYS-MIEPIRDVLSSPIQG 236

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           ++       +   +++     V +   +     T + ++ L+ G V+P    +   A + 
Sbjct: 237 EALEVDRRWVRVLSQQVQAAEVELTADLAEIPVTFEKILNLRAGDVLPLEIPDTITAKV- 295

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
            +G  +  C  G     Y +R+   I+     
Sbjct: 296 -DGVPVMECGYGIFNGQYALRVQKMISAGDTM 326


>gi|116694517|ref|YP_728728.1| flagellar motor switch protein [Ralstonia eutropha H16]
 gi|113529016|emb|CAJ95363.1| flagellar motor switch protein [Ralstonia eutropha H16]
          Length = 339

 Score =  165 bits (417), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 38/269 (14%), Positives = 85/269 (31%), Gaps = 4/269 (1%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       +    DI+  S +  KF     +       +   L           
Sbjct: 62  ERFARSMRTALFNFIRRGADITVGSIRIEKFGDFARNLPMPTNLNLVHLKPLRGTALFVY 121

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
             NLV  +++NL G       ++  R  +  E+++ +R +    A       T       
Sbjct: 122 DPNLVFLVVDNLFGGDGRFHTRVEGRDFTQTEQRIIQRMLELTLASYGNAWRTVHPIETE 181

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK 219
                             NE V T   ++ +  V     + +P   +     + ++    
Sbjct: 182 YIRSEMHPKFANV--ATHNEAVVTTAFHIELGAVGGQLHVCLPYAMIEPLKDLLMNPLQD 239

Query: 220 SENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSA 279
            +   +  +   + +     V +       ++T+ +V+ ++ G V+P    EK       
Sbjct: 240 EKEVDKGWVTQLSTQLRAAEVELVAEFAHLQSTVAEVLAMRAGDVLPIELPEK--VFGKV 297

Query: 280 NGKEIYSCELGRVGKNYTIRITDRINFDQ 308
           +G  +  C  G +   Y +R+   IN   
Sbjct: 298 DGVPVMQCGFGTMNGQYALRVERMINHQD 326


>gi|206603652|gb|EDZ40132.1| Flagellar motor switch protein FliM) [Leptospirillum sp. Group II
           '5-way CG']
          Length = 338

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 42/276 (15%), Positives = 90/276 (32%), Gaps = 17/276 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + +F        +   V+ S    +  KF   +         +   L S   N  +  
Sbjct: 60  ERFARFFQVTLSATLRKTVEFSPQGIEMVKFGDFVKKIPMPSNINILRLESLRRNILLII 119

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              +V  L++++ G S     ++  R  S +E ++++  +        +  +        
Sbjct: 120 DARMVYLLVDHMFGGSGRGHVKIEGRDFSPIEARISRNVMDLAIGDFEKAWAPV------ 173

Query: 160 LEDFYDIDYLKKNTNRL------SNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                 I Y++   N          E V T+   + I+    +  + IP  T ++     
Sbjct: 174 --HPMPITYIRSEINPQFAAIVAPTEMVVTMAYRLEIDGQGRTIYICIPYST-IEPIKEK 230

Query: 214 LSSQNKSE--NQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+        I+    +  +  + I+  I   + TL+D++  K G V       
Sbjct: 231 LYTGFQSDQYEVDSRWINRLQERVEEAPLEIEAFIGEARFTLRDILGWKTGDVFSLDRYV 290

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
                +   G   +    G    +  IRI  R+   
Sbjct: 291 SEPVEVRVEGIVRFLARPGIFRHHRAIRIERRVPPP 326


>gi|42766718|gb|AAS45442.1| putative flagellar biosynthesis protein [Burkholderia pseudomallei]
          Length = 332

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 37/272 (13%), Positives = 88/272 (32%), Gaps = 7/272 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
            + + L       M    +IS +  +  K+S    +       +   + S          
Sbjct: 60  RFARLLRIGIFNFMRRTAEISVSQVKVQKYSEFTRNLPIPTNLNLVHVKSLRGTSLFVFD 119

Query: 101 NNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNL 160
            NLV  +++NL G       ++  R  +  E+++  + +  +         + +      
Sbjct: 120 PNLVFFVVDNLFGGDGRFHTRVEGRDFTATEQRIIGKLLNLVFEHYASAWKSVRPLQFEF 179

Query: 161 EDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS--QN 218
                            NE V     ++       +  + +P   +++     LSS  Q 
Sbjct: 180 VRSEMHTQFA--NVATPNEIVIVTQFSIEFGPTGGTLHICMPYS-MIEPIRDVLSSPIQG 236

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           ++       +   +++     V +   +    TT + ++ L+ G V+P    +   A + 
Sbjct: 237 EALEVDRRWVRVLSQQVQSAEVELVADLAEVPTTFEKILNLRTGDVLPLDITDSITAKV- 295

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
            +G  +  C  G     Y +R+   I+     
Sbjct: 296 -DGVPVMECGYGIFNGQYALRVQRMISASDTM 326


>gi|300311368|ref|YP_003775460.1| flagellar motor switch protein FliM [Herbaspirillum seropedicae
           SmR1]
 gi|300074153|gb|ADJ63552.1| flagellar motor switch FliM protein [Herbaspirillum seropedicae
           SmR1]
          Length = 334

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 40/288 (13%), Positives = 94/288 (32%), Gaps = 11/288 (3%)

Query: 19  ARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFK 78
            R+    G   T+E I+     L++  L            +IS    +  K+S  I +  
Sbjct: 44  ERIVR--GRMPTLEIINERFARLFRIGLFNFIH----RTAEISVGPVKVSKYSEFIRNLV 97

Query: 79  ENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRT 138
                +   +  +     +      V  L++N+ G       ++  R  +  E+++  R 
Sbjct: 98  VPTNLNLVHIKPFRGIGLVVFDPQFVFMLVDNMFGGDGRFHTRIEGREFTPTEQRIIMRV 157

Query: 139 IAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFV 198
           +        +                +++    N     NE V +    + +  V+    
Sbjct: 158 LEITFETYAKSWEPIYPIEFEFIR-SEMNTQFANI-ATPNEVVVSTTFTVELGPVSGEIH 215

Query: 199 LIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVV 257
           +  P   +      ++ S Q ++    +  I    ++     V +       +    D++
Sbjct: 216 ICTPYSMIEPVRDRLTSSMQGEALEVDKRWIRLMKQQIQTAEVELIVNFGTARVNFTDLL 275

Query: 258 TLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
            +++G VIP      T      +G  +  C  G+    Y +R+   ++
Sbjct: 276 HMQVGDVIPLQT--NTTVEAQVDGVPVMECSYGQSNGQYALRVEKLLS 321


>gi|187478203|ref|YP_786227.1| flagellar motor switch protein [Bordetella avium 197N]
 gi|115422789|emb|CAJ49317.1| flagellar motor switch protein [Bordetella avium 197N]
          Length = 334

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 35/271 (12%), Positives = 91/271 (33%), Gaps = 6/271 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +  +    M    DI+  S +  K++    +       +   +           
Sbjct: 60  ERFARNMRHVLLNFMRRSADITVGSIKIIKYADFERNLPVPSNLNMIQMKPLRGTALFTY 119

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
             +LV  ++++L G       ++  R  +T E+++ +R +        +          +
Sbjct: 120 DPSLVFLVIDSLFGGDGRYHTRVEGRDFTTTEQRIIRRLLNLTLESYGKSWDPVYPIEFD 179

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTT--LISLSSQ 217
                        T   +NE V   + ++          + +P   +      L      
Sbjct: 180 YVRSEMHTKFASITG--NNEVVVVSSFHIEFGATGGDLNICLPYSMIEPVRDLLTRPLQD 237

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
           +  E   +      +R+    ++++        ++++ ++ LK+G V+P    E   A +
Sbjct: 238 SALEEVDQRWSQQLSRQVRSADIDLVAEFARIPSSIRGLMNLKVGDVLPVDVPESITAHV 297

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
             +G  +  C  G     Y +R+ + +N D 
Sbjct: 298 --DGVPLMECSYGVFNGKYALRVQNMLNQDD 326


>gi|172059107|ref|YP_001806759.1| flagellar motor switch protein FliM [Burkholderia ambifaria MC40-6]
 gi|171991624|gb|ACB62543.1| flagellar motor switch protein FliM [Burkholderia ambifaria MC40-6]
          Length = 332

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 35/272 (12%), Positives = 87/272 (31%), Gaps = 7/272 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
            + + L       M    +IS +  +  K+S    +       +   +            
Sbjct: 60  RFARLLRIGIFNFMRRTAEISVSQVKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFD 119

Query: 101 NNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNL 160
            NLV  +++NL G       ++  R  +  E+++  + +  +         + +      
Sbjct: 120 PNLVFFVVDNLFGGDGRFHTRVEGRDFTATEQRIIGKLLNLVFEHYATAWKSVRPLQFEF 179

Query: 161 EDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS--QN 218
                            NE V     ++       +  + +P   +++     LSS  Q 
Sbjct: 180 VRSEMHTQFANV--ATPNEIVIVTQFSIEFGPTGGTLHICMPYS-MIEPIRDVLSSPIQG 236

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           ++       +   +++     V +   +    +T + ++ L+ G V+P    +   A + 
Sbjct: 237 EALEVDRRWVRVLSQQVQSAEVELSANLAEIPSTFEKILNLRAGDVLPLEIEDTITAKV- 295

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
            +G  +  C  G     Y +R+   I+     
Sbjct: 296 -DGVPVMECGYGIFNGQYALRVQKMISASDTM 326


>gi|115350088|ref|YP_771927.1| flagellar motor switch protein FliM [Burkholderia ambifaria AMMD]
 gi|115280076|gb|ABI85593.1| flagellar motor switch protein FliM [Burkholderia ambifaria AMMD]
          Length = 332

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 35/272 (12%), Positives = 87/272 (31%), Gaps = 7/272 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
            + + L       M    +IS +  +  K+S    +       +   +            
Sbjct: 60  RFARLLRIGIFNFMRRTAEISVSQVKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFD 119

Query: 101 NNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNL 160
            NLV  +++NL G       ++  R  +  E+++  + +  +         + +      
Sbjct: 120 PNLVFFVVDNLFGGDGRFHTRVEGRDFTATEQRIIGKLLNLVFEHYATAWKSVRPLQFEF 179

Query: 161 EDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS--QN 218
                            NE V     ++       +  + +P   +++     LSS  Q 
Sbjct: 180 VRSEMHTQFANV--ATPNEIVIVTQFSIEFGPTGGTLHICMPYS-MIEPIRDVLSSPIQG 236

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           ++       +   +++     V +   +    +T + ++ L+ G V+P    +   A + 
Sbjct: 237 EALEVDRRWVRVLSQQVQSAEVELSANLAEIPSTFEKILNLRAGDVLPLEIEDTITAKV- 295

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
            +G  +  C  G     Y +R+   I+     
Sbjct: 296 -DGVPVMECGYGIFNGQYALRVQKMISASDTM 326


>gi|161523223|ref|YP_001578235.1| flagellar motor switch protein FliM [Burkholderia multivorans ATCC
           17616]
 gi|189348920|ref|YP_001944548.1| flagellar motor switch protein FliM [Burkholderia multivorans ATCC
           17616]
 gi|221201776|ref|ZP_03574813.1| flagellar motor switch protein FliM [Burkholderia multivorans
           CGD2M]
 gi|221207719|ref|ZP_03580727.1| flagellar motor switch protein FliM [Burkholderia multivorans CGD2]
 gi|221214537|ref|ZP_03587507.1| flagellar motor switch protein FliM [Burkholderia multivorans CGD1]
 gi|160340652|gb|ABX13738.1| flagellar motor switch protein FliM [Burkholderia multivorans ATCC
           17616]
 gi|189332942|dbj|BAG42012.1| flagellar motor switch protein [Burkholderia multivorans ATCC
           17616]
 gi|221165427|gb|EED97903.1| flagellar motor switch protein FliM [Burkholderia multivorans CGD1]
 gi|221172565|gb|EEE05004.1| flagellar motor switch protein FliM [Burkholderia multivorans CGD2]
 gi|221178196|gb|EEE10606.1| flagellar motor switch protein FliM [Burkholderia multivorans
           CGD2M]
          Length = 332

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 36/272 (13%), Positives = 87/272 (31%), Gaps = 7/272 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
            + + L       M    +IS +  +  K+S    +       +   +            
Sbjct: 60  RFARLLRIGIFNFMRRTAEISVSQVKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFD 119

Query: 101 NNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNL 160
            NLV  +++NL G       ++  R  +  E+++  + +  +         + +      
Sbjct: 120 PNLVFFVVDNLFGGDGRFHTRVEGRDFTATEQRIIGKLLNLVFEHYTVAWKSVRPLQFEF 179

Query: 161 EDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS--QN 218
                            NE V     ++       +  + +P   +++     LSS  Q 
Sbjct: 180 VRSEMHTQFA--NVATPNEIVIVTQFSIEFGPTGGTLHICMPYS-MIEPIRDVLSSPIQG 236

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           ++       +   +++     V +   +    TT + ++ L+ G V+P    +   A + 
Sbjct: 237 EALEVDRRWVRVLSQQVQAAEVELTADLAEIPTTFEKILNLRAGDVLPLDIADTITAKV- 295

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
            +G  +  C  G     Y +R+   I+     
Sbjct: 296 -DGVPVMECGYGIFNGQYALRVQKMISASDTM 326


>gi|83720285|ref|YP_440587.1| flagellar motor switch protein FliM [Burkholderia thailandensis
           E264]
 gi|167579274|ref|ZP_02372148.1| flagellar motor switch protein FliM [Burkholderia thailandensis
           TXDOH]
 gi|167617380|ref|ZP_02386011.1| flagellar motor switch protein FliM [Burkholderia thailandensis
           Bt4]
 gi|83654110|gb|ABC38173.1| flagellar motor switch protein FliM [Burkholderia thailandensis
           E264]
          Length = 332

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 36/272 (13%), Positives = 87/272 (31%), Gaps = 7/272 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
            + + L       M    +IS +  +  K+S    +       +   +            
Sbjct: 60  RFARLLRIGIFNFMRRTAEISVSQVKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFD 119

Query: 101 NNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNL 160
            NLV  +++NL G       ++  R  +  E+++  + +  +         + +      
Sbjct: 120 PNLVFFVVDNLFGGDGRFHTRVEGRDFTATEQRIIGKLLNLVFEHYAVAWKSVRPLQFEF 179

Query: 161 EDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS--QN 218
                            NE V     ++       +  + +P   +++     LSS  Q 
Sbjct: 180 VRSEMHTQFA--NVATPNEIVIVTQFSIEFGPTGGTLHICMPYS-MIEPIRDVLSSPIQG 236

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           ++       +   +++     V +   +    TT + ++ L+ G V+P    +   A + 
Sbjct: 237 EALEVDRRWVRVLSQQVQSAEVELVADLAEVPTTFEKILNLRAGDVLPLDIADSITAKV- 295

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
            +G  +  C  G     Y +R+   I+     
Sbjct: 296 -DGVPVMECGYGIFNGQYALRVQKMISASDTM 326


>gi|124516745|gb|EAY58253.1| Flagellar motor switch protein FliM [Leptospirillum rubarum]
          Length = 338

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 42/276 (15%), Positives = 90/276 (32%), Gaps = 17/276 (6%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + +F        +   V+ S    +  KF   +         +   L S   N  +  
Sbjct: 60  ERFARFFQVTLSATLRKTVEFSPQGIEMVKFGDFVKKIPMPSNINILRLESLRRNILLII 119

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              +V  L++++ G S     ++  R  S +E ++++  +        +  +        
Sbjct: 120 DARMVYLLVDHMFGGSGRGHVKIEGRDFSPIEARISRNVMDLAIGDFEKAWAPV------ 173

Query: 160 LEDFYDIDYLKKNTNRL------SNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
                 I Y++   N          E V T+   + I+    +  + IP  T ++     
Sbjct: 174 --HPMPITYIRSEINPQFAAIVAPTEMVVTMAYRLEIDGQGRTIYICIPYST-IEPIKEK 230

Query: 214 LSSQNKSE--NQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L +  +S+        I+    +  +  + I+  I   + TL+D++  K G V       
Sbjct: 231 LYTGFQSDQYEVDSRWINRLQERVEEAPLEIEAFIGETRFTLRDILGWKTGDVFSLDRYV 290

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
                +   G   +    G    +  IRI  R+   
Sbjct: 291 SEPVEVRVEGIVRFLARPGIFRHHRAIRIERRVPPP 326


>gi|238025700|ref|YP_002909931.1| flagellar motor switch protein FliM [Burkholderia glumae BGR1]
 gi|237874894|gb|ACR27227.1| Flagellar motor switch protein FliM [Burkholderia glumae BGR1]
          Length = 332

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 37/272 (13%), Positives = 88/272 (32%), Gaps = 7/272 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
            + + L       M    +IS +  +  K+S    +       +   +            
Sbjct: 60  RFARLLRVGIFNFMRRTAEISVSQVKVQKYSEFTRNLPIPTNLNLVHIKPLRGTSLFVFD 119

Query: 101 NNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNL 160
            NLV  +++NL G       ++  R  +  E ++  R +  +    +    + +      
Sbjct: 120 PNLVFFVVDNLFGGDGRFHTRVEGRDFTQTEMRIISRLLHLVFEHYSVAWKSVRPLQFEH 179

Query: 161 EDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS--QN 218
                            NE V     ++       +  + +P   +++     LSS  Q 
Sbjct: 180 VRSEMHTQFA--NVATPNEIVIVTQFSIEFGPTGGTLHICMPYS-MIEPIRDVLSSPIQG 236

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           ++       +   +++     V +   +    +T + ++ L++G V+P    E   A + 
Sbjct: 237 EALEVDRRWVRVLSQQVQSAEVELTANLTEMPSTFEKILNLRVGDVLPIDVEESIIAKV- 295

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
            +G  +  C  G     Y +R+   I+     
Sbjct: 296 -DGVPVMECGYGIFNGQYALRVNRMISASDTM 326


>gi|170698080|ref|ZP_02889161.1| flagellar motor switch protein FliM [Burkholderia ambifaria
           IOP40-10]
 gi|170137041|gb|EDT05288.1| flagellar motor switch protein FliM [Burkholderia ambifaria
           IOP40-10]
          Length = 332

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 35/272 (12%), Positives = 87/272 (31%), Gaps = 7/272 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
            + + L       M    +IS +  +  K+S    +       +   +            
Sbjct: 60  RFARLLRIGIFNFMRRTAEISVSQVKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFD 119

Query: 101 NNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNL 160
            NLV  +++NL G       ++  R  +  E+++  + +  +         + +      
Sbjct: 120 PNLVFFVVDNLFGGDGRFHTRVEGRDFTATEQRIIGKLLNLVFEHYATAWKSVRPLQFEF 179

Query: 161 EDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS--QN 218
                            NE V     ++       +  + +P   +++     LSS  Q 
Sbjct: 180 VRSEMHTQFANV--ATPNEIVIVTQFSIEFGPTGGTLHICMPYS-MVEPIRDVLSSPIQG 236

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           ++       +   +++     V +   +    +T + ++ L+ G V+P    +   A + 
Sbjct: 237 EALEVDRRWVRVLSQQVQSAEVELSANLAEIPSTFEKILNLRAGDVLPLEIEDTITAKV- 295

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
            +G  +  C  G     Y +R+   I+     
Sbjct: 296 -DGVPVMECGYGIFNGQYALRVQKMISASDTM 326


>gi|171316890|ref|ZP_02906099.1| flagellar motor switch protein FliM [Burkholderia ambifaria MEX-5]
 gi|171097971|gb|EDT42789.1| flagellar motor switch protein FliM [Burkholderia ambifaria MEX-5]
          Length = 332

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 35/272 (12%), Positives = 87/272 (31%), Gaps = 7/272 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
            + + L       M    +IS +  +  K+S    +       +   +            
Sbjct: 60  RFARLLRIGIFNFMRRTAEISVSQVKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFD 119

Query: 101 NNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNL 160
            NLV  +++NL G       ++  R  +  E+++  + +  +         + +      
Sbjct: 120 PNLVFFVVDNLFGGDGRFHTRVEGRDFTATEQRIIGKLLNLVFEHYATAWKSVRPLQFEF 179

Query: 161 EDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS--QN 218
                            NE V     ++       +  + +P   +++     LSS  Q 
Sbjct: 180 VRSEMHTQFANV--ATPNEIVIVTQFSIEFGPTGGTLHICMPYS-MVEPIRDVLSSPIQG 236

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           ++       +   +++     V +   +    +T + ++ L+ G V+P    +   A + 
Sbjct: 237 EALEVDRRWVRVLSQQVQSAEVELSANLAEIPSTFEKILNLRAGDVLPLEIEDTITAKV- 295

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
            +G  +  C  G     Y +R+   I+     
Sbjct: 296 -DGVPVMECGYGIFNGQYALRVQKMISASDTM 326


>gi|332531130|ref|ZP_08407044.1| flagellar motor switch protein FliM [Hylemonella gracilis ATCC
           19624]
 gi|332039415|gb|EGI75827.1| flagellar motor switch protein FliM [Hylemonella gracilis ATCC
           19624]
          Length = 331

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 47/272 (17%), Positives = 102/272 (37%), Gaps = 5/272 (1%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       +    +IS    Q  ++S  +        F+  ++     N  I C
Sbjct: 59  ERFARNLRISLFNFIRRSPEISVGPVQVQRYSAFLRELAVPTSFNIMAVRPLRGNGMIVC 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
             +L+  +++ L G   +   ++  R  S  E+++  R +  IS    +           
Sbjct: 119 EPSLIFGVIDTLYGGIGKFQSRIEGRDFSATEQRIINRLVDVISDEYKKAWRGIYPLELE 178

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QN 218
            +   ++     N     +E V + +  + I  ++ +    IP  TL     +  SS Q 
Sbjct: 179 YQR-SEMQPQFANI-ATPSEIVVSSSFQLEIGEMSGTIHFCIPYATLEPIRDVLYSSTQG 236

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
            S       ++   R+    +V +   +    TT+++++ +K+G  I    + +  A +S
Sbjct: 237 DSMEVDRRWVNVLTREIQAADVTLVAELARANTTVEELLAMKVGDFIELERQPRIEATIS 296

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
             G  ++ C+ G     Y IRI   +  +  S
Sbjct: 297 --GVPVFECQYGTHNAKYAIRIERSLRGNDTS 326


>gi|30248480|ref|NP_840550.1| flagellar motor switch protein FliM [Nitrosomonas europaea ATCC
           19718]
 gi|30138366|emb|CAD84375.1| Flagellar motor switch protein FliM [Nitrosomonas europaea ATCC
           19718]
          Length = 330

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 43/263 (16%), Positives = 90/263 (34%), Gaps = 7/263 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
            +   L       +   VDIS  S ++ K+S    S       +  S+            
Sbjct: 64  RFANSLQIGLYNFLRRGVDISAGSIKTIKYSEFTRSLVVPANINLVSMKPLRGTALFTID 123

Query: 101 NNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNL 160
            NL+  +++N+ G       ++  R  +  E+ + +R +  +     +   +        
Sbjct: 124 PNLIFLIVDNMFGGDGRFHTRVEGREFTLTEQGIIRRLLDVLFEHYEKAWQSVYPVKFEY 183

Query: 161 EDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISL--SSQN 218
               +++    N    ++  V      + +      F   IP  T+L+     L  S Q 
Sbjct: 184 IR-AEMNPQFANIVTPTD-IVVASAFELNLGGNRGEFYTCIPY-TMLEPIRDLLNNSMQE 240

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
                 ++ I    R+     + I   +   + TL  ++ ++ G VI     +   AI  
Sbjct: 241 DRAEVDKNWIKSLTRQVQGAEIEIIANLGQTQVTLHQILNMQEGDVIALDIPDTVVAI-- 298

Query: 279 ANGKEIYSCELGRVGKNYTIRIT 301
           AN   I  C  G +  +Y +++ 
Sbjct: 299 ANNVPIMDCHYGILNGHYALKVK 321


>gi|167585018|ref|ZP_02377406.1| flagellar motor switch protein FliM [Burkholderia ubonensis Bu]
          Length = 332

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 33/271 (12%), Positives = 84/271 (30%), Gaps = 5/271 (1%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
            + + L       M    +IS +  +  K+S    +       +   +            
Sbjct: 60  RFARLLRIGIFNFMRRTAEISVSQVKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFD 119

Query: 101 NNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNL 160
            NLV  +++NL G       ++  R  +  E+++  + +  +         + +      
Sbjct: 120 PNLVFFVVDNLFGGDGRFHTRVEGRDFTATEQRIIGKMLNLVFEHYTTAWKSVRPLQFEY 179

Query: 161 EDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNK 219
                            NE V     ++       +  + +P   +     +  S  Q +
Sbjct: 180 VRSEMHTQFANV--ATPNEIVIVTQFSIEFGPTGGTLHICMPYSMVEPIRDVLASPIQGE 237

Query: 220 SENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSA 279
           +       +   +++     V +   +     T + ++ L+ G V+P    +   A +  
Sbjct: 238 ALEVDRRWVRVLSQQVQTAEVEVTANLAEIPVTFEQILNLRAGDVLPLAIEDTITAKV-- 295

Query: 280 NGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
           +G  +  C  G     Y +R+   I+ +   
Sbjct: 296 DGVPVMECGYGIFNGQYALRVQKMISANDTM 326


>gi|330814983|ref|YP_004358688.1| Flagellar motor switch protein FliM [Burkholderia gladioli BSR3]
 gi|327367376|gb|AEA58732.1| Flagellar motor switch protein FliM [Burkholderia gladioli BSR3]
          Length = 332

 Score =  163 bits (412), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 35/272 (12%), Positives = 84/272 (30%), Gaps = 7/272 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
            + + L       M    +IS +  +  K+S    +       +   +            
Sbjct: 60  RFARLLRVGIFNFMRRTAEISVSQVKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFD 119

Query: 101 NNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNL 160
            NLV  +++NL G       ++  R  +  E ++  + +  +         + +      
Sbjct: 120 PNLVFFVVDNLFGGDGRFHTRVEGRDFTQTEMRIISKLLHMVFEHYTVAWKSVRPLQFEH 179

Query: 161 EDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS--QN 218
                            NE V     ++       +  + +P   +++     LSS  Q 
Sbjct: 180 VRSEMHTQFA--NVATPNEIVIVTQFSIEFGPTGGTLHICMPYS-MIEPIRDVLSSPIQG 236

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           ++       +   +++     V +   +    TT + ++ L++G V+P            
Sbjct: 237 EALEVDRRWVRVLSQQVQAAEVELTADLAEVPTTFERILNLRVGDVLPLDIG--DAVTAK 294

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
            +G  +  C  G     Y +R+   I     +
Sbjct: 295 VDGVPVMECGYGIFNGQYALRVNRMIGASDTT 326


>gi|107021592|ref|YP_619919.1| flagellar motor switch protein FliM [Burkholderia cenocepacia AU
           1054]
 gi|116688064|ref|YP_833687.1| flagellar motor switch protein FliM [Burkholderia cenocepacia
           HI2424]
 gi|170731414|ref|YP_001763361.1| flagellar motor switch protein FliM [Burkholderia cenocepacia
           MC0-3]
 gi|206561843|ref|YP_002232608.1| flagellar motor switch protein FliM [Burkholderia cenocepacia
           J2315]
 gi|254246641|ref|ZP_04939962.1| Flagellar motor switch protein [Burkholderia cenocepacia PC184]
 gi|105891781|gb|ABF74946.1| flagellar motor switch protein FliM [Burkholderia cenocepacia AU
           1054]
 gi|116646153|gb|ABK06794.1| flagellar motor switch protein FliM [Burkholderia cenocepacia
           HI2424]
 gi|124871417|gb|EAY63133.1| Flagellar motor switch protein [Burkholderia cenocepacia PC184]
 gi|169814656|gb|ACA89239.1| flagellar motor switch protein FliM [Burkholderia cenocepacia
           MC0-3]
 gi|198037885|emb|CAR53829.1| flagellar motor switch protein FliM [Burkholderia cenocepacia
           J2315]
          Length = 332

 Score =  163 bits (412), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 35/272 (12%), Positives = 86/272 (31%), Gaps = 7/272 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
            + + L       M    +IS +  +  K+S    +       +   +            
Sbjct: 60  RFARLLRIGIFNFMRRTAEISVSQVKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFD 119

Query: 101 NNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNL 160
            NLV  +++NL G       ++  R  +  E+++  + +  +         + +      
Sbjct: 120 PNLVFFVVDNLFGGDGRFHTRVEGRDFTATEQRIIGKLLNLVFEHYTTAWKSVRPLQFEF 179

Query: 161 EDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS--QN 218
                            NE V     ++       +  + +P   +++     LSS  Q 
Sbjct: 180 VRSEMHTQFANV--ATPNEIVIVTQFSIEFGPTGGTLHICMPYS-MIEPIRDVLSSPIQG 236

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           ++       +   +++     V +   +    +T + ++ L+ G V+P    +   A + 
Sbjct: 237 EALEVDRRWVRVLSQQVQAAEVELTANLAEISSTFEKILNLRAGDVLPLEIEDTITAKV- 295

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
            +G  +  C  G     Y +R+   I      
Sbjct: 296 -DGVPVMECGYGIFNGQYALRVQKMIGASDSM 326


>gi|239817144|ref|YP_002946054.1| flagellar motor switch protein FliM [Variovorax paradoxus S110]
 gi|239803721|gb|ACS20788.1| flagellar motor switch protein FliM [Variovorax paradoxus S110]
          Length = 333

 Score =  163 bits (412), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 36/269 (13%), Positives = 81/269 (30%), Gaps = 4/269 (1%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       M    DIS       ++   +         +   +           
Sbjct: 61  ERFARHLRSSLLNFMRRSPDISVGPVHIQQYGEFVRHLPVPANINMLHMKPLRGTALFVF 120

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  +++NL G+      ++  R  +  E+++ KR +                 S +
Sbjct: 121 DPKLVFLVVDNLFGSDGRYHVRVEGRDFTRTEQRIIKRLLNLTLQCYADAWQPVFPLSFD 180

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK 219
                    L        NE V    + +    V     + IP   +     +  +    
Sbjct: 181 YVRAEMHGKLANIV--APNEVVINTTLQIEFGPVGGFLHVCIPYSMIEPIRDLLSNPVQD 238

Query: 220 SENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSA 279
                +  +   +++    +V +        +T+ +V+ L++G V+P      T      
Sbjct: 239 EIEVDKRWVRQMSQQMQSADVELSAEFITLPSTIGEVLKLQVGDVLPIELP--TSITARV 296

Query: 280 NGKEIYSCELGRVGKNYTIRITDRINFDQ 308
           +G  +  C  G   + Y +R+   I+   
Sbjct: 297 DGIPVMECGYGVSNERYALRVLQMISHQD 325


>gi|33592495|ref|NP_880139.1| flagellar motor switch protein FliM [Bordetella pertussis Tohama I]
 gi|33601558|ref|NP_889118.1| flagellar motor switch protein FliM [Bordetella bronchiseptica
           RB50]
 gi|33572141|emb|CAE41684.1| flagellar motor switch protein FliM [Bordetella pertussis Tohama I]
 gi|33575994|emb|CAE33074.1| flagellar motor switch protein FliM [Bordetella bronchiseptica
           RB50]
 gi|332381913|gb|AEE66760.1| flagellar motor switch protein FliM [Bordetella pertussis CS]
          Length = 336

 Score =  163 bits (412), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 34/272 (12%), Positives = 86/272 (31%), Gaps = 6/272 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +  +    M  + DI+  + +  K++    +       +   +           
Sbjct: 60  ERFARHMRNVLLNFMRRNADITVGAIKILKYADFERNLPVPSNLNMIQMKPLRGTALFTY 119

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
             NLV  ++++L G       ++  R  +T E+++ +R +        +           
Sbjct: 120 DPNLVFLVIDSLFGGDGRYHTRVEGRDFTTTEQRIIRRLLNLTLESYGKSWDPVYPIEFE 179

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTT--LISLSSQ 217
                        T   +NE V     ++          + +P   +      L      
Sbjct: 180 YVRSEMHTKFASITG--NNEVVVVSPFHIEFGATGGDLNICLPYSMIEPVRDLLTRPLQD 237

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
              E   +       R+    ++++        +++ +++ +K G V+P    E      
Sbjct: 238 TALEEVDQRWAQQLQRQVRSADIDLVAEFGHIPSSIGELMRMKTGDVLPIAVPE--TVTA 295

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
             +G  +  C  G     Y +R+ + IN+D  
Sbjct: 296 HVDGVPLMECGYGVFNGRYALRVQNLINYDDT 327


>gi|295678044|ref|YP_003606568.1| flagellar motor switch protein FliM [Burkholderia sp. CCGE1002]
 gi|295437887|gb|ADG17057.1| flagellar motor switch protein FliM [Burkholderia sp. CCGE1002]
          Length = 332

 Score =  163 bits (412), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 35/272 (12%), Positives = 86/272 (31%), Gaps = 7/272 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
            + + L       M    +IS    +  K+S    +       +   +            
Sbjct: 60  RFARLLRVGIFNFMRRSAEISVGPVKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFD 119

Query: 101 NNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNL 160
            NLV  +++NL G       ++  R  +  E+++  + +            + +      
Sbjct: 120 PNLVFFVVDNLFGGDGRFHTRVEGRDFTQTEQRIITKLLNLTFEHYTASWKSVRPLQFEY 179

Query: 161 EDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS--QN 218
                            NE V     ++   +   +  + +P   +++     LSS  Q 
Sbjct: 180 VRSEMHTQFANV--ATPNEIVIVTQFSIEFGSTGGTLHICMPYS-MIEPIRDVLSSPIQG 236

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           ++ +     +   +++     V +   +     T + ++ ++ G V+P    E   A + 
Sbjct: 237 EAMDVDRRWVRVLSQQVQAAEVQLTADLAQVPVTFEQILNMRKGDVLPINIPEHITAKV- 295

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
            +G  +  C  G     Y +R+   I+     
Sbjct: 296 -DGVPVMECGYGIFNGQYALRVQKMISAADTM 326


>gi|134294173|ref|YP_001117908.1| flagellar motor switch protein FliM [Burkholderia vietnamiensis G4]
 gi|134137330|gb|ABO53073.1| flagellar motor switch protein FliM [Burkholderia vietnamiensis G4]
          Length = 332

 Score =  163 bits (412), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 34/272 (12%), Positives = 83/272 (30%), Gaps = 7/272 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
            + + L       M    +IS +  +  K+S    +       +   +            
Sbjct: 60  RFARLLRIGIFNFMRRTAEISVSQVKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFD 119

Query: 101 NNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNL 160
            NLV  +++NL G       ++  R  +  E+++  + +  +         + +      
Sbjct: 120 PNLVFFVVDNLFGGDGRFHTRVEGRDFTATEQRIIGKLLNLVFEHYTTAWKSVRPLQFEF 179

Query: 161 EDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS--QN 218
                            NE V     ++       +  + +P   +++     LSS  Q 
Sbjct: 180 VRSEMHTQFANV--ATPNEIVIVTQFSIEFGPTGGTLHICMPYS-MVEPIRDVLSSPIQG 236

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           ++       +   +++     V +   +     T + ++ L+ G V+P            
Sbjct: 237 EALEVDRRWVRVLSQQVQSAEVELTADLAEIPATFEKILNLRAGDVLPLEI--DDTITAK 294

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
            +G  +  C  G     Y +R+   I+     
Sbjct: 295 VDGVPVMECGYGIFNGQYALRVQKMISAGDTM 326


>gi|119899013|ref|YP_934226.1| flagellar motor switch protein FliM [Azoarcus sp. BH72]
 gi|119671426|emb|CAL95339.1| flagellar motor switch protein FliM [Azoarcus sp. BH72]
          Length = 336

 Score =  163 bits (412), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 37/272 (13%), Positives = 97/272 (35%), Gaps = 7/272 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + ++L       M  + ++S    +  K++  + +       +            +  
Sbjct: 59  ERFARYLRIGLFNYMHRNAEVSVGPIKVQKYAEFVRNLVVPTNLNLVLGKPLRGTGLVVF 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
             NLV  +++N+ G       ++  R  +  E+++ +  +  +     +  +        
Sbjct: 119 DPNLVFLVVDNMFGGDGRFHTRVEGRDFTPTEQRIIQGMLNVVFTEYAKAWAPV--FKLE 176

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK 219
           LE        +       +E V + + ++ +    +   +  P   +++     L S  +
Sbjct: 177 LEYVRSEMNSQFANIATPSEIVVSTSFSLELGGAQAEMHICFPYS-MVEPIRDLLYSTMQ 235

Query: 220 SE--NQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
           S+   Q    I   +R+     V +   +   + TL+D+V +++G VIP    E   A +
Sbjct: 236 SDHLTQDRRWITLLSRQLQTAEVELTCNLGTARVTLRDIVNMRVGDVIPLQVSELLQATV 295

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
             +G  +  C  G     +  ++   +  D+ 
Sbjct: 296 --DGVPVLECRYGTQNGQFAFKVDRFLGPDET 325


>gi|167560937|ref|ZP_02353853.1| flagellar motor switch protein FliM [Burkholderia oklahomensis
           EO147]
 gi|167568197|ref|ZP_02361071.1| flagellar motor switch protein FliM [Burkholderia oklahomensis
           C6786]
          Length = 332

 Score =  162 bits (411), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 36/272 (13%), Positives = 88/272 (32%), Gaps = 7/272 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
            + + L       M    +IS +  +  K+S    +       +   +            
Sbjct: 60  RFARLLRIGIFNFMRRTAEISVSQVKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFD 119

Query: 101 NNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNL 160
            NLV  +++NL G       ++  R  +  E+++  + +  +    +    + +      
Sbjct: 120 PNLVFFVVDNLFGGDGRFHTRVEGRDFTATEQRIIGKLLNLVFEHYSVAWKSVRPLQFEF 179

Query: 161 EDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS--QN 218
                            NE V     ++       +  + +P   +++     LSS  Q 
Sbjct: 180 VRSEMHTQFA--NVATPNEIVIVTQFSIEFGPTGGTLHICMPYS-MIEPIRDVLSSPIQG 236

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           ++       +   +++     V +   +    TT + ++ L+ G V+P    E   A + 
Sbjct: 237 EALEVDRRWVRVLSQQVQSAEVELVADLAEIPTTFEKILNLRAGDVLPLDIAETLTAKV- 295

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
            +G  +  C  G     Y +R+   ++     
Sbjct: 296 -DGVPVMECGYGIFNGQYALRVQKMVSASDTM 326


>gi|297538201|ref|YP_003673970.1| flagellar motor switch protein FliM [Methylotenera sp. 301]
 gi|297257548|gb|ADI29393.1| flagellar motor switch protein FliM [Methylotenera sp. 301]
          Length = 334

 Score =  162 bits (411), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 37/270 (13%), Positives = 93/270 (34%), Gaps = 7/270 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       +   V++S    +  K+S  + +       +   +        +  
Sbjct: 58  ERFARLVRIELFNFLRRTVEVSVGPVRITKYSDFVRNLVVPTNLNLIQMKPLRGTALMVF 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  +++N+ G       ++  R  +  E+++ +R +  +    ++           
Sbjct: 118 DPTLVFLVVDNMFGGDGRFHTRVEGRDFTQTEQRIIQRILNIVFETYSKSWEPVYPVQFE 177

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK 219
                +++    N     NE V  +  N+ +   +       P   +L+     LSS  +
Sbjct: 178 YMR-SEMNTQFANI-ATPNEVVIAVTFNVELGPASGEIHFCFPYS-MLEPLRDMLSSPLQ 234

Query: 220 SE--NQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            E     +  +    ++     V I   +      + DV+ +K+G V+P    E   A +
Sbjct: 235 GEVLGTDKRWVKLMTQQVQAAEVEIVADLAKTNMMIGDVLNMKVGDVVPLNIEESIEAQV 294

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFD 307
             +G  +  C+ G     Y +R+   +  +
Sbjct: 295 --DGVPVMLCKYGMFNGQYALRVEKLLRSN 322


>gi|124265765|ref|YP_001019769.1| flagellar motor switch protein [Methylibium petroleiphilum PM1]
 gi|124258540|gb|ABM93534.1| flagellar motor switch protein [Methylibium petroleiphilum PM1]
          Length = 333

 Score =  162 bits (411), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 38/247 (15%), Positives = 85/247 (34%), Gaps = 5/247 (2%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           +++  + +  K+S  +        F+  ++     +  I C   LV  +++ L G + + 
Sbjct: 78  EVAVGTIKVQKYSAFLREIVVPTNFNIMAVRPLRGSGLIVCDPTLVFAVIDALFGGAGKF 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSN 178
             ++  R  S  E ++  R +  ISA   +  +         +                +
Sbjct: 138 HTRIEGRDFSPTELRVISRLVEVISAEYKKAWAGVYPVELEYQRSEMQPQFATI--AAPS 195

Query: 179 EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQ 237
           E V T +  + I + + +    IP  TL        S+ Q  +       +    ++   
Sbjct: 196 EIVVTTSFTVEIGDTSGTIHFCIPYATLEPIRDTLYSTVQGDANEPDRRWVKLLTQQIQA 255

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             V++   +     T++ ++ LK G  I              +G  ++ C  G     Y 
Sbjct: 256 AEVDLVAELAQAPATVEQLLALKPGDFIELDL--DQVVHAKVDGVPVFDCHYGTSNGKYA 313

Query: 298 IRITDRI 304
           I+I   +
Sbjct: 314 IKIDQLL 320


>gi|296135698|ref|YP_003642940.1| flagellar motor switch protein FliM [Thiomonas intermedia K12]
 gi|294339869|emb|CAZ88232.1| Flagellar motor switch [Thiomonas sp. 3As]
 gi|295795820|gb|ADG30610.1| flagellar motor switch protein FliM [Thiomonas intermedia K12]
          Length = 336

 Score =  162 bits (410), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 43/298 (14%), Positives = 104/298 (34%), Gaps = 13/298 (4%)

Query: 12  PLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFS 71
           P       R+    G   T+E I+     L++  L    +       +IS +S +  K++
Sbjct: 37  PYDLASQDRIVR--GRMPTLEVINERFARLWRVSLFNFLRRAS----EISVSSVKLTKYN 90

Query: 72  HIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVE 131
             I         +   +              L+ ++++N  G       ++  R  + +E
Sbjct: 91  EFIRGLVVPSNLNLVQMKPLRGTALFIFDPRLIFSVIDNFFGGDGRFHARIEGRDFTPLE 150

Query: 132 KKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIE 191
           +++ KR +  +        +      P L         +        E V     ++ IE
Sbjct: 151 QRIIKRMLDMVFKEYKTAWAPVLPLEPELTRSEV--NPQFVNIATPTEVVIVSTFDVEIE 208

Query: 192 NVASSFVLIIPQETLLKTTLISLSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLK 249
               S  + IP   +++     L++   ++    D   +     +  +  V +   +  +
Sbjct: 209 GGGGSLHVCIPYS-MVEPIRDQLTTGMTTDRSEVDHRWVKALQTEMREAEVEMRVELLQR 267

Query: 250 KTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
           +  +++++ L++G V+P    E    I   +G  +   E GR      ++I  ++  +
Sbjct: 268 QILVRELLNLRVGDVLPVDMPE--TVIARVDGIPVLLGEYGRHEDKMALKIRQQLFPE 323


>gi|330940699|gb|EGH43710.1| flagellar motor switch protein FliM [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 222

 Score =  162 bits (410), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 36/234 (15%), Positives = 85/234 (36%), Gaps = 20/234 (8%)

Query: 82  VFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQ 141
             + A +              LV  L++N  G       ++  R  +  E ++ +  + Q
Sbjct: 1   SLNLAKIKPLRGTALFILDAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLDQ 59

Query: 142 ISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRL------SNEFVTTINMNMTIENVAS 195
               L +      E         + +Y+    N         +E V     ++ ++    
Sbjct: 60  AFVDLKEAWQAIMEV--------NFEYINSEVNPAMANIVGPSEAVVISTFHIELDGGGG 111

Query: 196 SFVLIIPQETLLKTTLISLSSQNKS--ENQSEDLIDPFARKTYQLNVNIDTRINLKKTTL 253
              + +P   +++     L +  +S  ++Q E  ++        +NV + T I  ++  L
Sbjct: 112 DLHVTMPYS-MIEPIREMLDAGFQSDLDDQDERWVNALKEDVLDVNVPLTTTIAQRQLPL 170

Query: 254 KDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
           +D++ ++ G VIP    +    ++ ANG   +  +LG       +++ + I   
Sbjct: 171 RDILHMRPGDVIPVELSDS--LVMRANGVPSFKVKLGSHKGKMALQVIEPIARR 222


>gi|255021379|ref|ZP_05293427.1| Flagellar motor switch protein FliM [Acidithiobacillus caldus ATCC
           51756]
 gi|254969242|gb|EET26756.1| Flagellar motor switch protein FliM [Acidithiobacillus caldus ATCC
           51756]
          Length = 337

 Score =  162 bits (410), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 39/293 (13%), Positives = 105/293 (35%), Gaps = 11/293 (3%)

Query: 24  KLGDKKTIEKISSSLGYLYKKFLPKIFKEKM----DLDVDISYTSCQSGKFSHIIHSFKE 79
            L ++  I +       +  + L ++++  +        +IS    +  K+S  I S   
Sbjct: 40  DLANQDRIVRGRMPTLEVVNERLARLWRVSLFNFLRRSAEISVGPVRLVKYSEFIRSLMV 99

Query: 80  NFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTI 139
               +   +     +        L+  +++N  G       ++  R  + +E+++ KR +
Sbjct: 100 PSNINIVQVKPLRGSALFVFDARLIFAVVDNYFGGDGRFHARIEGREFTPLEQRIIKRLL 159

Query: 140 AQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVL 199
             +        S   +  P L         +  +     E V     N+ +E+   SF +
Sbjct: 160 DLVFKDFKSAWSPVIDLQPELSRSEV--NPQFVSIATPTEVVIVSTFNIELESGTGSFQI 217

Query: 200 IIPQETLLKTTLISLSSQNKSENQ--SEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVV 257
            +P   +++     L++   ++     +  +     +  +  + +         +++ ++
Sbjct: 218 CLPYG-MVEPVRDQLTAGTTADRSEIDKRWVQSLHDELREATLELRVEFARLPISVRQLL 276

Query: 258 TLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
            L++G VIP    E    +   +G  ++    G  G  Y I+  + +  + +S
Sbjct: 277 ALRVGDVIPLERPE--TLVARVDGIPVFRGPYGVHGGKYAIQFHEALPPETES 327


>gi|293607830|ref|ZP_06690150.1| flagellar motor switch protein FliM [Achromobacter piechaudii ATCC
           43553]
 gi|292813773|gb|EFF72934.1| flagellar motor switch protein FliM [Achromobacter piechaudii ATCC
           43553]
          Length = 335

 Score =  162 bits (410), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 36/273 (13%), Positives = 91/273 (33%), Gaps = 6/273 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +  +    M    DI+  S +  K++    +       +   +           
Sbjct: 60  ERFARHMRNVLLNFMRRSADITVGSIKIQKYADFERNLPVPSNLNMIQMKPLRGTALFTY 119

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
             NLV  ++++L G       ++  R  +T E+++ +R +        +           
Sbjct: 120 DPNLVFLVIDSLFGGDGRYHTRVEGRDFTTTEQRIIRRLLNLTLESYGKSWDPVYPIEFE 179

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTT--LISLSSQ 217
                        T   +NE V   + ++          + +P   +      L     +
Sbjct: 180 YVRSEMHTKFASITG--NNEVVVVTSFHIEFGATGGDLNICLPYSMIEPVRDLLTRPLQE 237

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
              E   +      +R+    ++++        +++++++ LK+G V+P    E    I 
Sbjct: 238 TTLEEVDQRWSQQLSRQVRSADIDVVAEFARIPSSIRELMHLKVGDVLPVDVPE--TIIA 295

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
           + +G  +  C  G     Y +R+ +   +D  S
Sbjct: 296 NVDGVPLMECGYGVFNGQYALRVQNMFTYDTDS 328


>gi|332524239|ref|ZP_08400465.1| flagellar motor switch protein FliM [Rubrivivax benzoatilyticus
           JA2]
 gi|332107574|gb|EGJ08798.1| flagellar motor switch protein FliM [Rubrivivax benzoatilyticus
           JA2]
          Length = 334

 Score =  162 bits (409), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 41/251 (16%), Positives = 88/251 (35%), Gaps = 5/251 (1%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S    +  KFS  +        F+  S+     +  I C  N+V  +++ L G + + 
Sbjct: 78  EVSIGGIKVQKFSAFLREIVVPTNFNLVSVKPLRGSGLIVCDPNVVFAVIDALFGGAGKF 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSN 178
             ++  R  S  E ++  R +  I A   +            +   ++     N     +
Sbjct: 138 HTRIEGRDFSPTELRVILRLVECIIAEYKKAWHGIYPLELEYQR-SEMQPQFANI-ATPS 195

Query: 179 EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQ 237
           E V +    + I + + +    IP  TL     +  S+ Q  S       ++    +   
Sbjct: 196 EIVVSTAFTLEIGDTSGAVHFCIPYSTLEPIRDVLYSTIQGDSAEPDRRWVNLLKHQIQA 255

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             V++   +     T++ +++ K G  I         A +  +G  ++ C  G     Y 
Sbjct: 256 AEVDLVAELGHAPATVEQLLSFKPGDFIELDLDPMIQAKV--DGVPVFDCHYGTTNGRYA 313

Query: 298 IRITDRINFDQ 308
           I+I   +    
Sbjct: 314 IKIDRLLTSSN 324


>gi|254292908|ref|YP_003058931.1| flagellar motor switch protein FliM [Hirschia baltica ATCC 49814]
 gi|254041439|gb|ACT58234.1| flagellar motor switch protein FliM [Hirschia baltica ATCC 49814]
          Length = 376

 Score =  162 bits (409), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 42/267 (15%), Positives = 101/267 (37%), Gaps = 6/267 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
              + L    +     +V++S  S  S +F   ++S     + S        +   +   
Sbjct: 100 RLVRLLTTSLRNFTSDNVEVSLDSIASMRFGDYLNSIPLPAILSVFRARQLDNYGLVTVD 159

Query: 101 NNLVITLLENLLGASHETIP-QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           +NL+ ++++ LLG    T   ++  R  +T+E+ L  R +  I A   +  +   E   +
Sbjct: 160 SNLIYSIVDVLLGGRRGTAAMRVEGRPYTTIERMLVTRLVEVILADAKKAFNPLTEVDFD 219

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
           L+               +      + + + +E+      L++P  TL  ++  L+     
Sbjct: 220 LDRIETNPRFAAIAQPANAA--ILVRLRVDMEDRGGRCELMLPYATLEPIRKMLLQNFMG 277

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            K  N         A + +    N+   ++  +  L  +++L++G  +     + +   L
Sbjct: 278 EKFGN-DNIWEGHLATEIWTAPTNVRVVMDEFEQPLGRMMSLEVGDTLLMTAGQNSKVSL 336

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRI 304
                 +   ++GR+GK   +R+   +
Sbjct: 337 RCGDIYLTEGQIGRIGKKVAVRVDAPL 363


>gi|187925747|ref|YP_001897389.1| flagellar motor switch protein FliM [Burkholderia phytofirmans
           PsJN]
 gi|187716941|gb|ACD18165.1| flagellar motor switch protein FliM [Burkholderia phytofirmans
           PsJN]
          Length = 332

 Score =  162 bits (409), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 35/272 (12%), Positives = 86/272 (31%), Gaps = 7/272 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
            + + L       M    +IS    +  K+S    +       +   +            
Sbjct: 60  RFARLLRVGIFNFMRRSAEISVGPVKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFD 119

Query: 101 NNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNL 160
            NLV  +++NL G       ++  R  +  E+++  + +  +         + +      
Sbjct: 120 PNLVFFVVDNLFGGDGRFHTRVEGRDFTQTEQRIINKLLNLVFDNYTASWKSVRPLQFEY 179

Query: 161 EDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS--QN 218
                            NE V     ++       +  + +P   +++     LSS  Q 
Sbjct: 180 VRSEMHTQFANV--ATPNEIVIVTQFSIEFGTTGGTLHICMPYS-MIEPIRDILSSPIQG 236

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           ++       +   +++     V +   +     T + ++ ++ G V+P    E   A + 
Sbjct: 237 EALEVDRRWVRVLSQQVQAAEVELTADLAQVPVTFEQILNMRKGDVLPINIPEHITAKV- 295

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
            +G  +  C  G     Y +R+   I+  +  
Sbjct: 296 -DGVPVMECGYGIFNGQYALRVQKMISAAETM 326


>gi|253996306|ref|YP_003048370.1| flagellar motor switch protein FliM [Methylotenera mobilis JLW8]
 gi|253982985|gb|ACT47843.1| flagellar motor switch protein FliM [Methylotenera mobilis JLW8]
          Length = 334

 Score =  162 bits (409), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 35/270 (12%), Positives = 90/270 (33%), Gaps = 7/270 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +       +   V++S    +  K+S  I +       +   +        +  
Sbjct: 58  ERFARLVRIELFNFLRRTVEVSVGPVRITKYSDFIRNLVVPTNLNLVQMKPLRGTALMVF 117

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  +++N+ G       ++  R  +  E+++ +R +A +     +           
Sbjct: 118 DPTLVFLVVDNMFGGDGRFHTRVEGRDFTQTEQRIIQRILAIVFETYAKSWEPVYPIEFE 177

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK 219
                +++    N     NE V     N+ +   +      +P   +++     L+S  +
Sbjct: 178 YLR-SEMNTQFANI-ATPNEVVVVTTFNVELGPASGEIHFCMPYS-MVEPIRDLLTSPLQ 234

Query: 220 SE--NQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            E     +  +    ++     + I   +   +  L  V+ +K+G VIP           
Sbjct: 235 GEVLGADKRWVKLMTQQVQAAEIEIVADLATTEMHLGKVLNMKVGDVIPISM--DDAIEA 292

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFD 307
             +G  +  C+ G     Y +R+   +  +
Sbjct: 293 KVDGVPVMLCKYGLFNGQYALRVEKLLRSN 322


>gi|311105953|ref|YP_003978806.1| flagellar motor switch protein FliM [Achromobacter xylosoxidans A8]
 gi|310760642|gb|ADP16091.1| flagellar motor switch protein FliM [Achromobacter xylosoxidans A8]
          Length = 335

 Score =  162 bits (409), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 36/273 (13%), Positives = 91/273 (33%), Gaps = 6/273 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +  +    M    DI+  S +  K++    +       +   +           
Sbjct: 60  ERFARQMRHVLLNFMRRSADITVGSIKIQKYADFERNLPVPSNLNMIQMKPLRGTALFTY 119

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
             NLV  ++++L G       ++  R  +T E+++ +R +        +           
Sbjct: 120 DPNLVFLVIDSLFGGDGRYHTRVEGRDFTTTEQRIIRRLLNLTLESYGKSWDPVYPIEFE 179

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTT--LISLSSQ 217
                        T   +NE V   + ++          + +P   +      L     +
Sbjct: 180 YVRSEMHTKFASITG--NNEVVVVTSFHIEFGATGGDLNICLPYSMIEPVRDLLTRPLQE 237

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
              E   +      +R+    ++++        +++++++ LK+G V+P    E    + 
Sbjct: 238 TTLEEVDQRWAQQLSRQVRSADIDVVAEFARIPSSIRELMRLKVGDVLPVTVPE--TIVA 295

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
           S +G  +  C  G     Y +R+ +    D +S
Sbjct: 296 SVDGVPLMECGYGVFNGQYALRVQNMFTHDTES 328


>gi|308273526|emb|CBX30128.1| hypothetical protein N47_D29370 [uncultured Desulfobacterium sp.]
          Length = 322

 Score =  162 bits (409), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 41/267 (15%), Positives = 96/267 (35%), Gaps = 5/267 (1%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             +  FL +     + L  D+S     S KF     S       +   +        +  
Sbjct: 59  ERFINFLNESLPGTIGLSTDVSVDEIDSIKFGDFCRSLPVPTSLNIFKMEPLKGFALLVF 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV   ++ + G    +  +L  R  + +E+K+  R +  +   L +  +  ++    
Sbjct: 119 EGWLVFAFVDAMFGGKGVSHVKLEGRGFTAIEQKIVSRIVDIVLVDLQKAWAEIKDLKMV 178

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK 219
                ++D       + ++  + T    + I N      + +P + +++     L    +
Sbjct: 179 YTR-SEMDPQFAGIAKPTDMIIAT-KFALNIGNFTGGMTICLPYD-VIEPIGEKLKENYR 235

Query: 220 SENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
           SE    D        +K  +L++N+   +   K T ++ + +K+  V+    +     ++
Sbjct: 236 SEKFEADPVWKQHIKKKIQELDINLKCTLGRIKITGREFLEMKVDDVLLTGQKVDDPIVV 295

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRI 304
           S      +   +G +     IRI D+I
Sbjct: 296 SVGDLNKFKGHVGSMNNKKAIRIADKI 322


>gi|91785619|ref|YP_560825.1| flagellar motor switch protein FliM [Burkholderia xenovorans LB400]
 gi|296157439|ref|ZP_06840274.1| flagellar motor switch protein FliM [Burkholderia sp. Ch1-1]
 gi|91689573|gb|ABE32773.1| Flagellar motor switch protein FliM [Burkholderia xenovorans LB400]
 gi|295892211|gb|EFG71994.1| flagellar motor switch protein FliM [Burkholderia sp. Ch1-1]
          Length = 332

 Score =  161 bits (408), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 35/272 (12%), Positives = 85/272 (31%), Gaps = 7/272 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
            + + L       M    +IS    +  K+S    +       +   +            
Sbjct: 60  RFARLLRVGIFNFMRRSAEISVGPVKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFD 119

Query: 101 NNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNL 160
            NLV  +++NL G       ++  R  +  E+++  + +  +         + +      
Sbjct: 120 PNLVFFVVDNLFGGDGRFHTRVEGRDFTQTEQRIINKLLNLVFDNYTASWKSVRPLQFEY 179

Query: 161 EDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS--QN 218
                            NE V     ++       +  + +P   +++     LSS  Q 
Sbjct: 180 VRSEMHTQFANV--ATPNEIVIVTQFSIEFGTTGGTLHICMPYS-MIEPIRDILSSPIQG 236

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           ++       +   +++     V +   +     T + ++ ++ G V+P    E   A + 
Sbjct: 237 EALEVDRRWVRVLSQQVQAAEVELTADLAKVPVTFEQILNMRKGDVLPINIPEHITAKV- 295

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
            +G  +  C  G     Y +R+   I+     
Sbjct: 296 -DGVPVMECGYGIFNGQYALRVQKMISAADTM 326


>gi|317406219|gb|EFV86466.1| flagellar motor switch protein [Achromobacter xylosoxidans C54]
          Length = 335

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 41/315 (13%), Positives = 105/315 (33%), Gaps = 10/315 (3%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSL---GYLYKKFLPKIFKEKMDLD 57
           + G+S  K  S   P   AR        + + +   +L      + + +  +    M   
Sbjct: 19  VTGESDSKKESAG-PNDGARAYDLSSPDRVVRRRMQTLELINERFARQMRSVLLNFMRRS 77

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
            DI+  S +  K++    +       +   +             NLV  ++++L G    
Sbjct: 78  ADITVGSIKIQKYADFERNLPVPSNLNMVQMKPLRGTALFTYDPNLVFLVIDSLFGGDGR 137

Query: 118 TIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLS 177
              ++  R  +T E+++ +R +        +          +             T   +
Sbjct: 138 YHTRVEGRDFTTTEQRIIRRLLNLTLESYGKSWDPVYPIEFDYVRSEMHTKFASITG--N 195

Query: 178 NEFVTTINMNMTIENVASSFVLIIPQETLLKTT--LISLSSQNKSENQSEDLIDPFARKT 235
           NE V   + ++          + +P   +      L     +   E   +      +R+ 
Sbjct: 196 NEVVVVTSFHIEFGATGGDLNICLPYSMIEPVRDLLTRPLQETTLEEVDQRWSQQLSRQV 255

Query: 236 YQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKN 295
              ++++        +++++++ +K+G ++P    +    I   +G  +  C  G     
Sbjct: 256 RSADIDVVAEFARIPSSIRELMRMKVGDILPVDVPQ--TVIAHVDGVPLMECGYGVFNGQ 313

Query: 296 YTIRITDRINFDQKS 310
           Y +R+ +    D +S
Sbjct: 314 YALRVQNMFTHDTES 328


>gi|307731349|ref|YP_003908573.1| flagellar motor switch protein FliM [Burkholderia sp. CCGE1003]
 gi|307585884|gb|ADN59282.1| flagellar motor switch protein FliM [Burkholderia sp. CCGE1003]
          Length = 332

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 35/272 (12%), Positives = 86/272 (31%), Gaps = 7/272 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
            + + L       M    +IS    +  K+S    +       +   +            
Sbjct: 60  RFARLLRVGIFNFMRRSAEISVGPVKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFD 119

Query: 101 NNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNL 160
            NLV  +++NL G       ++  R  +  E+++  + +  +         + +      
Sbjct: 120 PNLVFFVVDNLFGGDGRFHTRVEGREFTQTEQRIISKLLNLVFEHYAASWKSVRPLQFEY 179

Query: 161 EDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS--QN 218
                            NE V     ++       +  + +P   +++     LSS  Q 
Sbjct: 180 MRSEMHTQFA--NVATPNEIVIVTQFSIEFGTTGGTLHICMPYS-MIEPIRDILSSPIQG 236

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           ++       +   +++     V +   +     T + ++ ++ G V+P    E+  A + 
Sbjct: 237 EALEVDRRWVRVLSQQVQSAEVELTADLAQVPITFEQILNMRKGDVLPINIPEQITAKV- 295

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
            +G  +  C  G     Y +R+   I+     
Sbjct: 296 -DGVPVMECGYGIFNGQYALRVQRMISAADTM 326


>gi|170694407|ref|ZP_02885561.1| flagellar motor switch protein FliM [Burkholderia graminis C4D1M]
 gi|170140830|gb|EDT09004.1| flagellar motor switch protein FliM [Burkholderia graminis C4D1M]
          Length = 332

 Score =  161 bits (407), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 35/272 (12%), Positives = 84/272 (30%), Gaps = 7/272 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
            + + L       M    +IS    +  K+S    +       +   +            
Sbjct: 60  RFARLLRVGIFNFMRRSAEISVGPVKVQKYSEFTRNLPIPTNLNLVHIKPLRGTSLFVFD 119

Query: 101 NNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNL 160
            NLV  +++NL G       ++  R  +  E+++  + +            + +      
Sbjct: 120 PNLVFFVVDNLFGGDGRFHTRVEGRDFTQTEQRIIMKLLNLTFEHYAASWKSVRPLQFEY 179

Query: 161 EDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS--QN 218
                            NE V     ++       +  + +P   +++     LSS  Q 
Sbjct: 180 MRSEMHTQFANV--ATPNEIVIVTQFSIEFGTTGGTLHICMPYS-MIEPIRDILSSPIQG 236

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           ++       +   +++     V +   +     T + ++ ++ G V+P    E   A + 
Sbjct: 237 EALEVDRRWVRVLSQQVQAAEVELTADLAQVPITFEQILNMRKGDVLPINIPEHITAKV- 295

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
            +G  +  C  G     Y +R+   I+     
Sbjct: 296 -DGVPVMECGYGIFNGQYALRVQKMISAADTM 326


>gi|241763648|ref|ZP_04761698.1| flagellar motor switch protein FliM [Acidovorax delafieldii 2AN]
 gi|241367123|gb|EER61489.1| flagellar motor switch protein FliM [Acidovorax delafieldii 2AN]
          Length = 334

 Score =  160 bits (406), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 43/245 (17%), Positives = 90/245 (36%), Gaps = 5/245 (2%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           +IS  +    ++S  +        F+  ++     +  I C  +LV  +++ L G   + 
Sbjct: 78  EISVGTVSVQRYSAFLRELAVPTNFNIVAIRPLRGSGLIVCEPSLVFGIIDTLYGGVGKF 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSN 178
             ++  R  S  E+++  R +  I A   +            +   ++     N     +
Sbjct: 138 QTRIEGRDFSPTEQRVINRLVDVICAEYKKAWHGIYPLELEYQR-SEMQPQFANI-ATPS 195

Query: 179 EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQ 237
           E V +    + I +++ +  + +P  TL     +  SS Q  S       +    R+   
Sbjct: 196 EIVVSTAFQLEIGDLSGAIHICMPYATLEPIRDVLYSSTQGDSIEVDRRWVRVLTREIQA 255

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             V +   +     T++ ++ +K G  I      +  A  S  G  I+ C+ G     Y 
Sbjct: 256 AEVTLVAELAQADATVEQLLAMKPGDFIELDREPRIRA--SIGGVPIFECQYGTHNSKYA 313

Query: 298 IRITD 302
           IRI +
Sbjct: 314 IRIEE 318


>gi|300680950|sp|P0CG26|FLIM_CAUCR RecName: Full=Flagellar motor switch protein FliM
 gi|144253|gb|AAA62449.1| FliM [Caulobacter crescentus CB15]
          Length = 373

 Score =  160 bits (406), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 43/323 (13%), Positives = 114/323 (35%), Gaps = 20/323 (6%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLP--------------KIFKEKM 54
           N   +  +L   L+G   D +T  +   +   +  + LP                 +   
Sbjct: 53  NQDEIDSLLGFDLSGDGSDDRTGIRAIINSALVSYERLPMLEIVFDRLVRLMTTSLRNFT 112

Query: 55  DLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGA 114
             +V++S  +  S +F   ++S     + +        +   +   +NL+ ++++ LLG 
Sbjct: 113 SDNVEVSLDNISSIRFGDYLNSIPLPGILAVFRAEELDNYGLLTVDSNLIYSIVDVLLGG 172

Query: 115 SHETIP-QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNT 173
              T   ++  R  +T+E+ L +R I  +   L          S +L+            
Sbjct: 173 RRGTAAMRIEGRPYTTIERVLVQRMIDVVLHDLKSAFEPLHPVSFSLDRLET--NPPFAA 230

Query: 174 NRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLIDPF 231
                     + + + +E+      L++P  TL  ++  L+      K   +        
Sbjct: 231 IARPANAAILVKLRIDMEDRGGRIELLLPYATLEPIRKMLLQQFMGEKFG-RDNIWEGHL 289

Query: 232 ARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGR 291
           A + +   + +   ++ ++  L  V+ +++G  +      +     +     +    +GR
Sbjct: 290 ATELWTTQMEVRAVLDEQQVPLSRVLNMQVGDTLMLNATSRQPGGAARRRIPLTRGRMGR 349

Query: 292 VGKNYTIRITDRINFDQKSLKNF 314
              +  +R    ++  +K+++  
Sbjct: 350 RNHSIAVRAEAPVDRRKKAVQKL 372


>gi|171057710|ref|YP_001790059.1| flagellar motor switch protein FliM [Leptothrix cholodnii SP-6]
 gi|170775155|gb|ACB33294.1| flagellar motor switch protein FliM [Leptothrix cholodnii SP-6]
          Length = 334

 Score =  160 bits (406), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 39/247 (15%), Positives = 85/247 (34%), Gaps = 5/247 (2%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S    +  K+S  +        F+  S+     +  I C   LV ++++ L G S + 
Sbjct: 78  EVSVGGIKVQKYSAFLRETVVPTNFNIVSVRPLRGSGMIVCDPTLVFSVIDALFGGSGKF 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSN 178
             ++  R  S  E+++  R +  I+    +            +   ++     N      
Sbjct: 138 HTRIEGRDFSPTEQRVISRIVEVIATEYKKAWQGIYPLELEYQR-SEMQPQFANI-AAPG 195

Query: 179 EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQ 237
           E V T +  + I +   +    IP  TL     +  SS Q  S       +     +   
Sbjct: 196 EIVVTTSFTLEIGDATGTIHFCIPYATLEPIRDVLYSSTQGDSAEPDRRWVKLMTHQIQA 255

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             V +   +     T++ ++ LK G  I     +     +  +G  +   + G     Y 
Sbjct: 256 AQVQLVAELAHAPATVEQLLALKAGDFIELDLIKSIEVKV--DGVPVMEAQYGTSNGKYA 313

Query: 298 IRITDRI 304
           +++   +
Sbjct: 314 LKVDRML 320


>gi|326319064|ref|YP_004236736.1| flagellar motor switch protein FliM [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|323375900|gb|ADX48169.1| flagellar motor switch protein FliM [Acidovorax avenae subsp.
           avenae ATCC 19860]
          Length = 334

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 43/251 (17%), Positives = 91/251 (36%), Gaps = 5/251 (1%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           +IS  +    ++S  +        F+  ++     +  I C  +LV  +++ L G   + 
Sbjct: 78  EISVGTVSVQRYSAFLRELAVPTNFNIVAIRPLRGSGLIVCEPSLVFGIIDTLYGGVGKF 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSN 178
             ++  R  S  E+++  R +  I A   +            +   ++     N     +
Sbjct: 138 QTRIEGRDFSPTEQRVINRLVDVICAEYKKAWHGIYPLELEYQR-SEMQPQFANI-ATPS 195

Query: 179 EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQ 237
           E V +    + I +++ +  + +P  TL     +  SS Q  S       +    R+   
Sbjct: 196 EIVVSTAFQLEIGDLSGAIHICMPYATLEPIRDVLYSSTQGDSIEVDRRWVRVLTREIQA 255

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             V +   +     T++ ++ +K G  I      +  A  S  G  I+ C+ G     Y 
Sbjct: 256 AEVTLVAELARADATVEQLLAMKPGDFIELDREPRIQA--SIGGVPIFECQYGTHNSKYA 313

Query: 298 IRITDRINFDQ 308
           IRI + +    
Sbjct: 314 IRIEECLRNPD 324


>gi|120613024|ref|YP_972702.1| flagellar motor switch protein FliM [Acidovorax citrulli AAC00-1]
 gi|120591488|gb|ABM34928.1| flagellar motor switch protein FliM [Acidovorax citrulli AAC00-1]
          Length = 334

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 43/251 (17%), Positives = 91/251 (36%), Gaps = 5/251 (1%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           +IS  +    ++S  +        F+  ++     +  I C  +LV  +++ L G   + 
Sbjct: 78  EISVGTVSVQRYSAFLRELAVPTNFNIVAIRPLRGSGLIVCEPSLVFGIIDTLYGGVGKF 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSN 178
             ++  R  S  E+++  R +  I A   +            +   ++     N     +
Sbjct: 138 QTRIEGRDFSPTEQRVINRLVDVICAEYKKAWHGIYPLELEYQR-SEMQPQFANI-ATPS 195

Query: 179 EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQ 237
           E V +    + I +++ +  + +P  TL     +  SS Q  S       +    R+   
Sbjct: 196 EIVVSTAFQLEIGDLSGAIHICMPYATLEPIRDVLYSSTQGDSIEVDRRWVRVLTREIQA 255

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             V +   +     T++ ++ +K G  I      +  A  S  G  I+ C+ G     Y 
Sbjct: 256 AEVTLVAELARADATVEQLLAMKPGDFIELDREPRIQA--SIGGVPIFECQYGTHNSKYA 313

Query: 298 IRITDRINFDQ 308
           IRI + +    
Sbjct: 314 IRIEECLRNPD 324


>gi|209522293|ref|ZP_03270920.1| flagellar motor switch protein FliM [Burkholderia sp. H160]
 gi|209497269|gb|EDZ97497.1| flagellar motor switch protein FliM [Burkholderia sp. H160]
          Length = 332

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 35/272 (12%), Positives = 87/272 (31%), Gaps = 7/272 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
            + + L       M    +IS    +  K+S    +       +   +            
Sbjct: 60  RFARLLRVGIFNFMRRSAEISVGPVKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFD 119

Query: 101 NNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNL 160
            NLV  +++NL G       ++  R  +  E+++  + +            + +      
Sbjct: 120 PNLVFFVVDNLFGGDGRFHTRVEGRDFTQTEQRIIMKLLNLTFEHYTASWKSVRPLQFEY 179

Query: 161 EDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS--QN 218
                            NE V     ++   +   +  + +P   +++     LSS  Q 
Sbjct: 180 VRSEMHTQFANV--ATPNEIVIVTQFSIEFGSTGGTLHICMPYS-MIEPIRDILSSPIQG 236

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           ++ +     +   +++     V +   +     T + ++ ++ G V+P    E+  A + 
Sbjct: 237 EAMDVDRRWVRVLSQQVQAAEVQLTADLAQVPVTFEQILNMRKGDVLPINIPERITAKV- 295

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
            +G  +  C  G     Y +R+   I+     
Sbjct: 296 -DGVPVMECGYGIFNGQYALRVQKMISAADTM 326


>gi|78064701|ref|YP_367470.1| flagellar motor switch protein FliM [Burkholderia sp. 383]
 gi|77965446|gb|ABB06826.1| Flagellar motor switch protein FliM [Burkholderia sp. 383]
          Length = 332

 Score =  160 bits (404), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 34/272 (12%), Positives = 86/272 (31%), Gaps = 7/272 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
            + + L       M    +IS +  +  K+S    +       +   +            
Sbjct: 60  RFARLLRIGIFNFMRRTAEISVSQVKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFD 119

Query: 101 NNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNL 160
            NLV  +++NL G       ++  R  +  E+++  + +  +         + +      
Sbjct: 120 PNLVFFVVDNLFGGDGRFHTRVEGRDFTATEQRIIGKLLNLVFEHYTTAWKSVRPLQFEF 179

Query: 161 EDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS--QN 218
                            NE V     ++       +  + +P   +++     LSS  Q 
Sbjct: 180 VRSEMHTQFANV--ATPNEIVIVTQFSIEFGPTGGTLHICMPYS-MIEPIRDVLSSPIQG 236

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           ++       +   +++     V +   +    +  + ++ L+ G V+P    +   A + 
Sbjct: 237 EALEVDRRWVRVLSQQVQAAEVELTANLAEISSNFEKILNLRAGDVLPLEIEDTITAKV- 295

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
            +G  +  C  G     Y +R+   I+     
Sbjct: 296 -DGVPVMECGYGIFNGQYALRVQKMISAGDSM 326


>gi|160896094|ref|YP_001561676.1| flagellar motor switch protein FliM [Delftia acidovorans SPH-1]
 gi|160361678|gb|ABX33291.1| flagellar motor switch protein FliM [Delftia acidovorans SPH-1]
          Length = 334

 Score =  159 bits (403), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 38/245 (15%), Positives = 87/245 (35%), Gaps = 5/245 (2%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S  +    ++S  +        F+  ++     +  + C  +LV  +++ L G +   
Sbjct: 78  EVSVGTVSVQRYSAFLRELVVPTNFNIVAIRPLRGSGLVVCDPSLVFGVIDTLYGGTGRL 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSN 178
             ++  R  S  E+++  R +  I     +            +   ++     N     +
Sbjct: 138 QTRIEGRDFSHTEQRVINRLVNVICEEYKKAWHGIYPLELGYQR-SEMQPQFANI-ATPS 195

Query: 179 EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQ 237
           E V +    + I +++ S  + +P  TL     +  SS Q  S       +    R+   
Sbjct: 196 EIVVSTAFQLEIGDISGSIHICMPYATLEPIRDVLYSSTQGDSIEVDRRWVKVLKREIQA 255

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             V +   +     T++ ++ ++ G  I            S  G  I+ C+ G     Y 
Sbjct: 256 AEVTLVAELARADATVEQLLAMRPGDFIELDREP--LIRASIGGVPIFECQYGTHNDKYA 313

Query: 298 IRITD 302
           IR+ +
Sbjct: 314 IRVEN 318


>gi|319409195|emb|CBI82839.1| Flagellar motor switch protein FliM [Bartonella schoenbuchensis R1]
          Length = 335

 Score =  159 bits (403), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 47/265 (17%), Positives = 105/265 (39%), Gaps = 5/265 (1%)

Query: 54  MDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLG 113
             L+      S  + K   II +   + +    S S W  +        LV  + E   G
Sbjct: 73  TSLEFSTDVQSLDTLKSDKIIQTIGTDTLLIYFSSSLWGDDVIFVLDATLVDLITEAFFG 132

Query: 114 ASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNT 173
           A+   +     R  S  E K+++     ++  ++    T   S    +           T
Sbjct: 133 AAEPKLINRNGRPFSPTEYKISEYFGKLLANTMDGIFGTGDGSLLLFKQILKAQEFNAET 192

Query: 174 NRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSED--LIDPF 231
              S  F  +  + +    + ++  +++P+    +    +++   ++  +  D       
Sbjct: 193 FHQSQMF--SCTLGVKCNEIETNVNILMPRSCH-RPIQEAVTRALRAPAKHTDPLWAKRL 249

Query: 232 ARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGR 291
            ++  + +V+I+  I     TL ++  L++GQV+           L +  K +Y C LG+
Sbjct: 250 KQEVSRAHVSIEAFIQQGSMTLDELSKLQVGQVLSLPANAVKQIKLRSGKKSLYKCSLGK 309

Query: 292 VGKNYTIRITDRINFDQKSLKNFLH 316
           +G N++IR+TD I+ +++ +   +H
Sbjct: 310 MGTNFSIRVTDPIDEEKEMIDELVH 334


>gi|251789181|ref|YP_003003902.1| flagellar motor switch protein FliM [Dickeya zeae Ech1591]
 gi|247537802|gb|ACT06423.1| flagellar motor switch protein FliM [Dickeya zeae Ech1591]
          Length = 338

 Score =  159 bits (403), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 41/276 (14%), Positives = 94/276 (34%), Gaps = 6/276 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + +         +    DI+  + +   +     +       +   L           
Sbjct: 61  ERFARQFRMGLFNLLRRSPDITVGAIKIQPYHEFARNLPVPTNLNLIHLKPLRGTALFVF 120

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           S +LV   ++NL G       ++  R  +  E+++ +R +       +   +   +    
Sbjct: 121 SPSLVFIAVDNLFGGDGRFPTKVEGREFTHTEQRVVRRMLKLALDAYSDAWNAIYKLDVE 180

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK 219
                ++     N     N+ V T   ++ I  +   F + IP   +++     L++   
Sbjct: 181 YVR-SEMQVKFTNITTSPNDIVVTTPFHLEIGTLTGEFSICIPFS-MIEPLRELLANPPL 238

Query: 220 SENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
             +Q ED    +  A++     + +          L  V+ LK G ++P    E    + 
Sbjct: 239 ENSQQEDQHWRETLAKQVQHSELELVANFVDIPVRLSKVLKLKPGDILPIDKPE--RLVA 296

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKN 313
             +G  + +C+ G +   Y +R+   IN    SL +
Sbjct: 297 HVDGVPVLTCQYGTLDGQYALRVEHLINPILNSLND 332


>gi|323527699|ref|YP_004229852.1| flagellar motor switch protein FliM [Burkholderia sp. CCGE1001]
 gi|323384701|gb|ADX56792.1| flagellar motor switch protein FliM [Burkholderia sp. CCGE1001]
          Length = 332

 Score =  159 bits (402), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 35/272 (12%), Positives = 85/272 (31%), Gaps = 7/272 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
            + + L       M    +IS    +  K+S    +       +   +            
Sbjct: 60  RFARLLRVGIFNFMRRSAEISVGPVKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFD 119

Query: 101 NNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNL 160
            NLV  +++NL G       ++  R  +  E+++  + +            + +      
Sbjct: 120 PNLVFFVVDNLFGGDGRFHTRVEGRDFTQTEQRIIMKLLNLTFEHYAASWKSVRPLQFEY 179

Query: 161 EDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS--QN 218
                            NE V     ++       +  + +P   +++     LSS  Q 
Sbjct: 180 MRSEMHTQFANV--ATPNEIVIVTQFSIEFGTTGGTLHICMPYS-MIEPIRDILSSPIQG 236

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           ++       +   +++     V +   +     T + ++ ++ G V+P    E+  A + 
Sbjct: 237 EALEVDRRWVRVLSQQVQAAEVELTADLAQVPITFEQILNMRKGDVLPINIPEQITAKV- 295

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
            +G  +  C  G     Y +R+   I+     
Sbjct: 296 -DGVPVMECGYGIFNGQYALRVQKMISAADTM 326


>gi|330899437|gb|EGH30856.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           japonica str. M301072PT]
          Length = 216

 Score =  159 bits (402), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 35/228 (15%), Positives = 83/228 (36%), Gaps = 20/228 (8%)

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +              LV  L++N  G       ++  R  +  E ++ +  + Q    L 
Sbjct: 1   IKPLRGTALFILDAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLDQAFVDLK 59

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRL------SNEFVTTINMNMTIENVASSFVLII 201
           +      E         + +Y+    N         +E V     ++ ++       + +
Sbjct: 60  EAWQAIMEV--------NFEYINSEVNPAMANIVGPSEAVVISTFHIELDGGGGDLHVTM 111

Query: 202 PQETLLKTTLISLSSQNKS--ENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTL 259
           P   +++     L +  +S  ++Q E  ++        +NV + T I  ++  L+D++ +
Sbjct: 112 PYS-MIEPIREMLDAGFQSDLDDQDERWVNALKEDVLDVNVPLTTTIAQRQLPLRDILHM 170

Query: 260 KIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
           + G VIP    +    ++ ANG   +  +LG       +++ + I   
Sbjct: 171 RPGDVIPVELSDS--LVMRANGVPSFKVKLGSHKGKMALQVIEPIARR 216


>gi|58039165|ref|YP_191129.1| flagellar motor switch protein FliM [Gluconobacter oxydans 621H]
 gi|58001579|gb|AAW60473.1| Flagellar motor switch protein FliM [Gluconobacter oxydans 621H]
          Length = 343

 Score =  159 bits (401), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 46/277 (16%), Positives = 102/277 (36%), Gaps = 12/277 (4%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
            + + L    +     +V+ S     S +F   + +     +F+      W +   +  S
Sbjct: 61  RFTRILTTSLRNFTSDNVEASMDRLGSQRFGDYLENVPGQAMFAVFKAEEWDNYGVVVLS 120

Query: 101 NNLVITLLENLLGA--SHETIPQLY-----NRSLSTVEKKLAKRTIAQISAVLNQCISTT 153
           ++L+ ++++ LLG     ++           R  + +E+ L +  +  I   L    S  
Sbjct: 121 SSLIYSIVDALLGGHVRGDSALTAPASRQTGRHHTAIERALIEPMVRIILDDLETSFSPL 180

Query: 154 QESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS 213
              + + E   +++       R  N  V T    + +E       +++P  T L+     
Sbjct: 181 CAVNFHFERL-EMNSRFAMICRAGNG-VVTARFGIDMEGRGGDVDIVLPHAT-LEPVRDI 237

Query: 214 LSSQNKSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHRE 271
           L  Q   E    D    +  AR+ +Q ++ +D  +  +   LKD++ L  G  +    + 
Sbjct: 238 LLQQFMGEKFGHDGIWENHLARELWQTDLTLDAVLEEQTMNLKDIMKLAPGDQLVLRRKP 297

Query: 272 KTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
                L      +++  +GR      ++I D +N   
Sbjct: 298 DASVSLRCGEHVLFTGRVGRKQGQVAVKIEDVLNQKP 334


>gi|332284035|ref|YP_004415946.1| flagellar motor switch protein FliM [Pusillimonas sp. T7-7]
 gi|330427988|gb|AEC19322.1| flagellar motor switch protein FliM [Pusillimonas sp. T7-7]
          Length = 330

 Score =  159 bits (401), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 34/275 (12%), Positives = 91/275 (33%), Gaps = 8/275 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L  +    M  + DI+  S +  K+S    +       +  ++           
Sbjct: 60  ERFARRLRSVLLSFMRRNADITVGSIRIQKYSDFERNLPVPSNLNMVTMKPLRGAALFTF 119

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
             NLV  ++++L G       ++  R  +T E+++ +R +                    
Sbjct: 120 DPNLVFLVIDSLFGGHGRYSTRVEGRDFTTTEQRIIRRLLNLTLESYGGAWEQVYPVQFE 179

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK 219
                        T+   NE V   + N+ +     +  + +P   +++     L+   +
Sbjct: 180 YIRSEMHTKFASITS--GNEIVVVTSFNIELGASGGNLNICLPYS-MIEPVRDLLTRPLQ 236

Query: 220 SENQ---SEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAI 276
             N     +       R+    +V +       ++++ +++ L++  ++P        A 
Sbjct: 237 EANAGAIDQRWTHQLTRQVRSADVELVAEFARIESSIGELMRLEVNDILPLEITPAINAH 296

Query: 277 LSANGKEIYSCELGRVGKNYTIRITDRINFDQKSL 311
           +   G  +  C  G     Y +R+   +   +  +
Sbjct: 297 V--GGVPVMECTYGTFNGRYALRVKKVLASSETDI 329


>gi|307131596|ref|YP_003883612.1| flagellar motor switch protein fliM [Dickeya dadantii 3937]
 gi|306529125|gb|ADM99055.1| Flagellar motor switch protein fliM [Dickeya dadantii 3937]
          Length = 338

 Score =  159 bits (401), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 47/307 (15%), Positives = 107/307 (34%), Gaps = 12/307 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +  P  P    R+  +    + +E I+      ++  L  + +       DI+  + +  
Sbjct: 36  DVKPYDPNTQRRVIRER--LQALEIINERFARQFRMGLFNLLR----RSPDITVGAIKIQ 89

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
            +     +       +   L           S +LV   ++NL G       ++  R  +
Sbjct: 90  PYHEFARNLPVPTNLNLIHLKPLRGTALFVFSPSLVFIAVDNLFGGDGRFPTKVEGREFT 149

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++ +R +       +   +   +         ++     N     N+ V T   ++
Sbjct: 150 HTEQRVVRRMLKLALESYSDAWNAIYKLDVEYVR-SEMQVKFTNITTSPNDIVVTTPFHL 208

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSED--LIDPFARKTYQLNVNIDTRI 246
            I  +   F + IP   +++     L++     +Q ED    +  A++     + +    
Sbjct: 209 EIGTLTGEFSICIPFS-MIEPLRELLANPPLENSQQEDQHWRETLAKQVQHSELELVANF 267

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                 L  V+ LK G ++P    E    +   +G  + +C+ G +   Y +R+   IN 
Sbjct: 268 VDIPVRLSKVLKLKPGDILPIDKPE--RLVAHVDGVPVLTCQYGTLDGQYALRVEHLINP 325

Query: 307 DQKSLKN 313
              SL +
Sbjct: 326 ILNSLND 332


>gi|271500079|ref|YP_003333104.1| flagellar motor switch protein FliM [Dickeya dadantii Ech586]
 gi|270343634|gb|ACZ76399.1| flagellar motor switch protein FliM [Dickeya dadantii Ech586]
          Length = 338

 Score =  158 bits (400), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 47/307 (15%), Positives = 107/307 (34%), Gaps = 12/307 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +  P  P    R+  +    + +E I+      ++  L  + +       DI+  + +  
Sbjct: 36  DVKPYDPNTQRRVIRER--LQALEIINERFARQFRMGLFNLLR----RSPDITVGAIKIQ 89

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
            +     +       +   L           S +LV   ++NL G       ++  R  +
Sbjct: 90  PYHEFARNLPVPTNLNLIHLKPLRGTALFVFSPSLVFIAVDNLFGGDGRFPTKVEGREFT 149

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++ +R +       +   +   +         ++     N     N+ V T   ++
Sbjct: 150 HTEQRVVRRMLKLALESYSDAWNAIYKLDVEYVR-SEMQVKFTNITTSPNDIVVTTPFHL 208

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSED--LIDPFARKTYQLNVNIDTRI 246
            I  +   F + IP   +++     L++     +Q ED    +  A++     + +    
Sbjct: 209 EIGTLTGEFSICIPFS-MIEPLRELLANPPLENSQQEDQHWRETLAKQVQHSELELVANF 267

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                 L  V+ LK G ++P    E    +   +G  + +C+ G +   Y +R+   IN 
Sbjct: 268 VDIPVRLSKVLKLKPGDILPIDKPE--RLVAHVDGVPVLTCQYGTLDGQYALRVEHLINP 325

Query: 307 DQKSLKN 313
              SL +
Sbjct: 326 ILNSLND 332


>gi|110805914|ref|YP_689434.1| flagellar motor switch protein FliM [Shigella flexneri 5 str. 8401]
 gi|110615462|gb|ABF04129.1| flagellar motor switch protein FliM [Shigella flexneri 5 str. 8401]
          Length = 349

 Score =  158 bits (400), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 44/303 (14%), Positives = 93/303 (30%), Gaps = 10/303 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+  +      I      +   + +         +    DI+  +
Sbjct: 45  SGESDIRPYDPNTQRRVVRERLQALEI------INERFARHFRMGLFNLLRRSPDITVGA 98

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G       ++  
Sbjct: 99  IRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEG 158

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +                 ++     N     N+ V   
Sbjct: 159 REFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVR-SEMQVEFTNITTSPNDIVVNT 217

Query: 185 NMNMTIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     L+       S N+ ++  D   R+     + + 
Sbjct: 218 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELV 277

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK G V+P         I   NG  + + + G +   Y +RI   
Sbjct: 278 ANFADISLHLSQILKLKPGDVLPIEKP--DRIIAHVNGVPVLTSQYGTLNGQYALRIEHL 335

Query: 304 INF 306
           IN 
Sbjct: 336 INP 338


>gi|327398387|ref|YP_004339256.1| flagellar motor switch protein FliM [Hippea maritima DSM 10411]
 gi|327181016|gb|AEA33197.1| flagellar motor switch protein FliM [Hippea maritima DSM 10411]
          Length = 327

 Score =  158 bits (399), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 50/280 (17%), Positives = 105/280 (37%), Gaps = 12/280 (4%)

Query: 29  KTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASL 88
           + I+ +       +   L    +      V+I   S     ++  + S   N  F+  SL
Sbjct: 57  RAIKNLHDKFSRNFSSKLSAFLRSI----VEIEVVSVDQMTYAEFVLSLSNNVSFNVVSL 112

Query: 89  SSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQ 148
           S    N       ++   L++ LLG   E+     NR  + +E+ +    + Q    +  
Sbjct: 113 SPLDGNAVFSLEPDIGFALIDRLLGGIGES--SNINRPFTDIEQSILLDVVRQAMEEMRS 170

Query: 149 CISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLK 208
                 + S  +        + +      +E V  +   + +          +P   +L+
Sbjct: 171 SWEPIIDISFEVVGQESSPNVVQIV--APSEIVVLVVFEVKLGETTGIINWCLPV-IVLE 227

Query: 209 TTLISLSSQN---KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVI 265
             L  + + +   +S+  +ED I+  AR   ++ V ++ R+      ++D ++LK G ++
Sbjct: 228 PVLNKIGTHDILARSKKATEDRIEDIARTLKEVLVYLEFRLGTAAMKVEDFLSLKEGDLL 287

Query: 266 PFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
               +      +  NG E Y  +LGR G N  ++I   I 
Sbjct: 288 TLDKKVDDELPVFINGVEKYGVKLGRKGYNKAVKINRIIG 327


>gi|89899368|ref|YP_521839.1| flagellar motor switch protein FliM [Rhodoferax ferrireducens T118]
 gi|89344105|gb|ABD68308.1| flagellar motor switch protein FliM [Rhodoferax ferrireducens T118]
          Length = 329

 Score =  158 bits (399), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 41/270 (15%), Positives = 95/270 (35%), Gaps = 5/270 (1%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       +    +IS       ++S  +        F+  ++     +  I C
Sbjct: 59  ERFARNLRVGLFNFIRRSPEISVGPVTVQRYSAFLRELAVPTNFNIVAIRPLRGSGMIVC 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
             +LV  +++ L G   +   ++  R  S  E+++  R +  I+    +           
Sbjct: 119 EPSLVFGVIDTLYGGIGKFQARIEGRDFSATEQRVINRLVDVITEEYKKAWKGVYPLELE 178

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QN 218
            +   ++     N     +E V + +  + I  +A S    +P  TL     I  SS Q 
Sbjct: 179 YQR-SEMQPQFANI-ATPSEIVISTSFQLEIGEIAGSIHFCMPYATLEPIRDILYSSTQG 236

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
            S    +  ++   ++     + +   +     T++ ++ +K G  I       +   ++
Sbjct: 237 DSIEVDKRWVNVLTQEIQAAEITLVAELARADATVEQLLAMKTGDFIELDRP--SRIEVT 294

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
             G  ++ C+ G     Y IRI   +  + 
Sbjct: 295 VEGVPVFECQYGTHNAKYAIRIDKSLRGND 324


>gi|121596087|ref|YP_987983.1| flagellar motor switch protein FliM [Acidovorax sp. JS42]
 gi|222112243|ref|YP_002554507.1| flagellar motor switch protein flim [Acidovorax ebreus TPSY]
 gi|120608167|gb|ABM43907.1| flagellar motor switch protein FliM [Acidovorax sp. JS42]
 gi|221731687|gb|ACM34507.1| flagellar motor switch protein FliM [Acidovorax ebreus TPSY]
          Length = 334

 Score =  157 bits (398), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 41/245 (16%), Positives = 90/245 (36%), Gaps = 5/245 (2%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           +IS  +    ++S  +        F+  ++     +  + C  +LV  +++ L G   + 
Sbjct: 78  EISVGTVSVQRYSAFLRELVVPTNFNIVAIRPLRGSGLVVCEPSLVFGIIDTLYGGVGKF 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSN 178
             ++  R  S  E+++  R +  I A   +            +   ++     N     +
Sbjct: 138 QTRIEGRDFSATEQRVINRLVDVICAEYKKAWQGIYPLELAYQR-SEMQPQFANI-ATPS 195

Query: 179 EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQ 237
           E V +    + I ++A +  + +P  TL     +  SS Q  +       +    R+   
Sbjct: 196 EIVVSTAFQLEIGDLAGAIHICMPYATLEPIRDVLYSSVQGDAIEVDRRWVRVLTREIQA 255

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             V +   +     T++ ++ +K G  I      +  A  S  G  ++ C+ G     Y 
Sbjct: 256 AEVTLVAELARADATVEQLLAMKPGDFIELEREPRIRA--SIEGVPVFECQYGTHNSKYA 313

Query: 298 IRITD 302
           IRI +
Sbjct: 314 IRIEE 318


>gi|121608105|ref|YP_995912.1| flagellar motor switch protein FliM [Verminephrobacter eiseniae
           EF01-2]
 gi|121552745|gb|ABM56894.1| flagellar motor switch protein FliM [Verminephrobacter eiseniae
           EF01-2]
          Length = 334

 Score =  157 bits (398), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 46/276 (16%), Positives = 96/276 (34%), Gaps = 6/276 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       +    +IS       ++S  +        F+  ++     +  + C
Sbjct: 59  ERFARNLRIGLFNFIRRSPEISVGMVSVQRYSAFLRELVVPTNFNIVAIRPLRGSGLVVC 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
             +LV  +++ L G + +   ++  R  S  E+++  R +  I A   +           
Sbjct: 119 EPSLVFGIIDTLYGGAGKFQTRIEGRDFSPTEQRVINRLVDVICAEYKKAWQGIYPLELE 178

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QN 218
            +   ++     N     +E V +    + I ++  +  + +P  TL     +  SS Q 
Sbjct: 179 YQR-SEMQPQFANI-ATPSEIVVSTAFQLEIGDLPGAIHMCMPYATLEPIRDVLYSSTQG 236

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
            S       +    R+     V +   +     T++ ++ LK G  I    + +  A   
Sbjct: 237 DSIEVDRRWVRVLTREIQAAEVVLVAELARADATVEQLLALKPGDFIELERQPRIRAA-- 294

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRI-NFDQKSLKN 313
             G  I+ C+ G     Y IRI   + N D   L  
Sbjct: 295 IGGVPIFECQYGTHNCRYAIRIEKCLRNADPSWLGE 330


>gi|302389672|ref|YP_003825493.1| flagellar motor switch protein FliM [Thermosediminibacter oceani
           DSM 16646]
 gi|302200300|gb|ADL07870.1| flagellar motor switch protein FliM [Thermosediminibacter oceani
           DSM 16646]
          Length = 331

 Score =  157 bits (397), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 46/274 (16%), Positives = 100/274 (36%), Gaps = 9/274 (3%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L   F  ++   V I+ +S     +S  I S     +              I  
Sbjct: 60  ENFSRQLITFFSTQLRTLVQINASSVDQMPYSEFISSIPNPSIIGIVDFQPLRGAIIIAM 119

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           + ++  ++++ LLG S E   +   R  + +E  +  R  +++  ++ +      E  P 
Sbjct: 120 NVSMAFSIIDRLLGGSGEY--KDKPREPTEIEANILHRVYSKLVKLMQEAWQDILEIHPV 177

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK 219
            +        +       NE V  I +N  I        + IP   +++  +  LS++  
Sbjct: 178 FDKLET--NPQFVQLVSPNEAVALITINTRIGKTDGLINICIPY-IVIEPVMSRLSTKIW 234

Query: 220 SENQSEDLIDPFARKTYQ----LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCA 275
             N  ++  + F +   +    +N  I   I   K T+++ + L +G VI       +  
Sbjct: 235 LSNSKKESPESFIKTITRKLENVNAEIRAEIGKAKITVREFLDLDVGDVIQLDKHINSEV 294

Query: 276 ILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
            +    K  Y   +G+    + +RI   I+   +
Sbjct: 295 DVYVYDKLKYKGIMGKRNGRFAVRINKVISERDE 328


>gi|261821166|ref|YP_003259272.1| flagellar motor switch protein FliM [Pectobacterium wasabiae
           WPP163]
 gi|261605179|gb|ACX87665.1| flagellar motor switch protein FliM [Pectobacterium wasabiae
           WPP163]
          Length = 337

 Score =  157 bits (397), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 48/311 (15%), Positives = 106/311 (34%), Gaps = 12/311 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
               +  P  P    R+  +    + +E I+      ++  L  + +       DI+   
Sbjct: 31  KTDGDVKPYDPNTQRRVIRER--LQALEIINERFARQFRMALFNLLR----RSPDITVGG 84

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L           S +LV   ++NL G       ++  
Sbjct: 85  IKIQPYHEFARNLPVPTNLNLIHLKPLRGTALFVFSPSLVFIAVDNLFGGDGRFPTKVEG 144

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++ KR +        +  +   +         ++     N     N+ V T 
Sbjct: 145 REFTHTEQRVVKRMLRLALEAYGEAWNAIYKLDIEYVR-SEMQVKFTNITTSPNDIVVTT 203

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLS--SQNKSENQSEDLIDPFARKTYQLNVNI 242
             ++ I ++   F + IP   +++     L+      S  + +   D  A++     + +
Sbjct: 204 PFHVEIGSLTGEFNICIPFS-MIEPLRELLANPPLENSRQEDQSWRDTLAKQVQHSELEL 262

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
                     L  ++ L+ G V+P    EK  A +  +G  + + + G +   Y +R+  
Sbjct: 263 VANFVDIPLRLSKILKLQPGDVLPIDKPEKIVAHV--DGVPVLTSQYGTLNGQYALRVEH 320

Query: 303 RINFDQKSLKN 313
            IN    SL N
Sbjct: 321 LINPILNSLDN 331


>gi|221069291|ref|ZP_03545396.1| flagellar motor switch protein FliM [Comamonas testosteroni KF-1]
 gi|220714314|gb|EED69682.1| flagellar motor switch protein FliM [Comamonas testosteroni KF-1]
          Length = 334

 Score =  157 bits (397), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 39/248 (15%), Positives = 88/248 (35%), Gaps = 5/248 (2%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S  +    ++S  +        F+  ++     N  I C  +LV  +++ L G +   
Sbjct: 78  EVSVGTVTVQRYSAFLRELAVPTNFNIMAIRPLRGNGLIVCDPSLVFGVIDTLYGGTGRL 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSN 178
             ++  R  ST E+++  R +  I     +            +   ++     N     +
Sbjct: 138 QTRIEGRDFSTTEQRVINRMVNVICEEYKKAWHGIYPLELAYQR-SEMQPQFANI-ATPS 195

Query: 179 EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQ 237
           E V +    + I +++ S  + +P  TL     +  SS Q  +       +    R+   
Sbjct: 196 EIVVSTAFQLEIGDISGSIHICMPYATLEPIRDVLYSSTQGDAIEVDRRWVKVLTREIQA 255

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             V +   +     T++ ++ ++ G  I            S  G  ++ C+ G     Y 
Sbjct: 256 AEVTLVAELARADATVEQLLAMRPGDFIELDREP--LIRASIGGVPVFECQYGTHNDKYA 313

Query: 298 IRITDRIN 305
           IR+   + 
Sbjct: 314 IRVERSLR 321


>gi|264676601|ref|YP_003276507.1| flagellar motor switch protein FliM [Comamonas testosteroni CNB-2]
 gi|299531254|ref|ZP_07044664.1| flagellar motor switch protein FliM [Comamonas testosteroni S44]
 gi|262207113|gb|ACY31211.1| flagellar motor switch protein FliM [Comamonas testosteroni CNB-2]
 gi|298720661|gb|EFI61608.1| flagellar motor switch protein FliM [Comamonas testosteroni S44]
          Length = 334

 Score =  157 bits (397), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 39/248 (15%), Positives = 88/248 (35%), Gaps = 5/248 (2%)

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S  +    ++S  +        F+  ++     N  I C  +LV  +++ L G +   
Sbjct: 78  EVSVGTVTVQRYSAFLRELAVPTNFNIMAIRPLRGNGLIVCDPSLVFGVIDTLYGGTGRL 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSN 178
             ++  R  ST E+++  R +  I     +            +   ++     N     +
Sbjct: 138 QTRIEGRDFSTTEQRVINRMVNVICEEYKKAWHGIYPLELAYQR-SEMQPQFANI-ATPS 195

Query: 179 EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQ 237
           E V +    + I +++ S  + +P  TL     +  SS Q  +       +    R+   
Sbjct: 196 EIVVSTAFQLEIGDISGSIHICMPYATLEPIRDVLYSSTQGDAIEVDRRWVKVLTREIQA 255

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             V +   +     T++ ++ ++ G  I            S  G  ++ C+ G     Y 
Sbjct: 256 AEVTLVAELARADATVEQLLAMRPGDFIELDREP--LIRASIGGVPVFECQYGTHNDKYA 313

Query: 298 IRITDRIN 305
           IR+   + 
Sbjct: 314 IRVERSLR 321


>gi|46579323|ref|YP_010131.1| flagellar motor switch protein FliM [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120603117|ref|YP_967517.1| flagellar motor switch protein FliM [Desulfovibrio vulgaris DP4]
 gi|46448737|gb|AAS95390.1| flagellar motor switch protein FliM [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120563346|gb|ABM29090.1| flagellar motor switch protein FliM [Desulfovibrio vulgaris DP4]
 gi|311233150|gb|ADP86004.1| flagellar motor switch protein FliM [Desulfovibrio vulgaris RCH1]
          Length = 326

 Score =  157 bits (396), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 41/262 (15%), Positives = 88/262 (33%), Gaps = 6/262 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
            + +         +   V+++  S    KF   + S       +   +     N  I   
Sbjct: 60  RFARLCTNALSNAVRKRVELNPISIDMTKFGDFMRSLPVPTSINIFKMEPLRGNAIIVVD 119

Query: 101 NNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNL 160
           + LV  L+EN  G S  + P++  R  + +E+ +  R I      + +      +    L
Sbjct: 120 SRLVFALVENFFGGSG-SQPKIEGREFTRIEQAIVDRVIHIALDNMEESWRPVHDVHLEL 178

Query: 161 EDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKS 220
                            ++ V  I   + +++   S V+ +P  T ++     L +  ++
Sbjct: 179 VRSEINPQFAAIV--PPSDVVVVITFEVELDSAIGSMVICLPYAT-IEPIRSKLHASFQT 235

Query: 221 ENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           E    D   +     +  +  V +  R    K T   ++ L++G V+           ++
Sbjct: 236 ERLEVDHAWVARLKERLMETPVELKVRFGETKITGNQLLRLQVGDVLLLDTDTDDMLEVT 295

Query: 279 ANGKEIYSCELGRVGKNYTIRI 300
             G   +    G V  N   +I
Sbjct: 296 IAGVTKFWGLGGTVKANKAFQI 317


>gi|256830498|ref|YP_003159226.1| flagellar motor switch protein FliM [Desulfomicrobium baculatum DSM
           4028]
 gi|256579674|gb|ACU90810.1| flagellar motor switch protein FliM [Desulfomicrobium baculatum DSM
           4028]
          Length = 325

 Score =  156 bits (394), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 47/262 (17%), Positives = 94/262 (35%), Gaps = 6/262 (2%)

Query: 41  LYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCS 100
            + +         M   VD++  S    KF   + S       +   +     N  +   
Sbjct: 60  RFSRLCTSALANTMRKRVDVNPISIDMSKFGDFMRSLPVPTSINIFKIDPLRGNALLVVD 119

Query: 101 NNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNL 160
             LV +L+EN  G +  + P++  R  + +E+ +  + +  I A L        E S  L
Sbjct: 120 TRLVFSLVENFFGGAG-SQPKIEGRDFTPIEQSIIVKVVKIILANLEDAWRPVHEVSIEL 178

Query: 161 EDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKS 220
                            ++ V  I+  + +EN   S VL +P  T ++     L +  ++
Sbjct: 179 LRSEINPQFATIV--PPSDVVVVISFEVELENALGSMVLALPYAT-IEPIRSKLYAAFQT 235

Query: 221 ENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           E    D   I  F  +  +  V+++      + T + ++ +K+G ++     E       
Sbjct: 236 ERLEIDHAWISRFRDRLMETPVDMNVTFGTTQITGRQLLDMKVGDILMLDQDEDDMLSGR 295

Query: 279 ANGKEIYSCELGRVGKNYTIRI 300
            +G   +    G V  N   +I
Sbjct: 296 IHGILKFFGLPGFVKGNKAFKI 317


>gi|33596151|ref|NP_883794.1| flagellar motor switch protein FliM [Bordetella parapertussis
           12822]
 gi|33573154|emb|CAE36805.1| flagellar motor switch protein FliM [Bordetella parapertussis]
          Length = 336

 Score =  156 bits (394), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 32/272 (11%), Positives = 84/272 (30%), Gaps = 6/272 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + +  +    M  + DI+  + +  K++    +       +   +           
Sbjct: 60  ERFARHMRNVLLNFMRRNADITVGAIKILKYADFERNLPVPSNLNMIQMKPLRGTALFTY 119

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
             NLV  ++++L G       ++  R  +T E+++ +R +        +           
Sbjct: 120 DPNLVFLVIDSLFGGDGRYHTRVEGRDFTTTEQRIIRRLLNLTLESYGKSWDPVYPIEFE 179

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTT--LISLSSQ 217
                        T   +NE V     ++          + +P   +      L      
Sbjct: 180 YVRSEMHTKFASITG--NNEVVVVSPFHIEFGATGGDLNICLPYSMIEPVRDLLTRPLQD 237

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
              E   +        +    ++++        +++ +++ +K G V+P    E      
Sbjct: 238 TALEEVDQRWAQQLQSQVRSADIDLVAEFGHIPSSIGELMRMKTGDVLPIAVPE--TVTA 295

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
             +G  +     G     Y +R+ + IN+D  
Sbjct: 296 HVDGVPLMEYGYGVFNGRYALRVQNLINYDDT 327


>gi|226944505|ref|YP_002799578.1| flagellar motor switch protein [Azotobacter vinelandii DJ]
 gi|226719432|gb|ACO78603.1| flagellar motor switch protein [Azotobacter vinelandii DJ]
          Length = 350

 Score =  155 bits (393), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 45/313 (14%), Positives = 108/313 (34%), Gaps = 9/313 (2%)

Query: 1   MRGQSIHKNTSPLHPILLARL--TGKLGDKKTIEKISSSL---GYLYKKFLPKIFKEKMD 55
           ++G S  +++SP  P    R+         + I +   +L      + ++        + 
Sbjct: 16  LKGVSGEEDSSPSEPADTQRIRPYNPATQHRVIRERLHALDIINERFARYFRMSLFNLIR 75

Query: 56  LDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGAS 115
              DI+  S +   +S    +       +  ++        +    +LV  +++NL G  
Sbjct: 76  RSADITVDSVRYQSYSDFARNVPVPTNINLLAMKPLRGTALVVFPPSLVFMVVDNLFGGD 135

Query: 116 HETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNR 175
              + +   R  +  E+++ +R +            +      +     ++     N   
Sbjct: 136 GRFLTKSEGREFTHTEQRIIRRLLGLALEAYQSAWKSVYPLEIDYLR-SEMQAKFANITS 194

Query: 176 LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKS-ENQSEDLIDPFARK 234
             NE V     ++ + N+AS F +++P   +     +     N S  ++        A +
Sbjct: 195 SPNEIVINSTFHLEVGNLASDFNIVMPYLMIEPLRSLLNGPLNDSHPDEERQWGKRMASE 254

Query: 235 TYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGK 294
             Q  + +          +  V+ LK+G V+P    E    +   +G  +  CE G    
Sbjct: 255 IKQSQIELIADFAGIDLCIGQVMALKVGDVLPIELPE--TVVARVDGVPVMRCEYGSRNG 312

Query: 295 NYTIRITDRINFD 307
              +++ + I+  
Sbjct: 313 QRALQVKELIDHS 325


>gi|322833203|ref|YP_004213230.1| flagellar motor switch protein FliM [Rahnella sp. Y9602]
 gi|321168404|gb|ADW74103.1| flagellar motor switch protein FliM [Rahnella sp. Y9602]
          Length = 340

 Score =  155 bits (392), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 45/304 (14%), Positives = 97/304 (31%), Gaps = 12/304 (3%)

Query: 12  PLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFS 71
           P  P    R+  +      I      +   + +         +    DI+  + +   + 
Sbjct: 42  PFDPTTQRRVVRERLQALEI------INERFARHFRMGLFNLLRRSPDITVGAIKIQPYH 95

Query: 72  HIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVE 131
               +       +   L           + +LV   ++NL G       ++  R  +  E
Sbjct: 96  DFARNLPVPTNLNLIHLKPLRGTALFVFAPSLVFIAVDNLFGGDGRFPTKVEGREFTHTE 155

Query: 132 KKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIE 191
           +++ KR +           S   + S       ++     N     N+ V T   ++ I 
Sbjct: 156 QRVIKRMLRLALDAYEDAWSGVYKLSVEYVR-AELQIKFTNITSSPNDIVVTTPFHVEIG 214

Query: 192 NVASSFVLIIPQETLLKTTLISLS--SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLK 249
            ++  F + IP   +++     L+      S N+     +    +  Q  + +       
Sbjct: 215 ALSGDFNICIPFS-MIEPLRELLTNPPVENSRNEESQWRENLVHQVQQSELELVANFVEI 273

Query: 250 KTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
              L  ++ LK G V+P         I   +G  + + + G + + Y +R+   IN    
Sbjct: 274 PLRLSQILKLKPGDVLPIEKP--DRLIAHVDGVPVLTSQYGTLNEQYALRVEHLINPILN 331

Query: 310 SLKN 313
           SL  
Sbjct: 332 SLDE 335


>gi|156933435|ref|YP_001437351.1| flagellar motor switch protein FliM [Cronobacter sakazakii ATCC
           BAA-894]
 gi|156531689|gb|ABU76515.1| hypothetical protein ESA_01253 [Cronobacter sakazakii ATCC BAA-894]
          Length = 334

 Score =  155 bits (392), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 42/299 (14%), Positives = 97/299 (32%), Gaps = 10/299 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +  P  P    R+  +    + +E I+      ++  L  + +       DI+  + +  
Sbjct: 33  DIRPYDPNTQRRVVRER--LQALEIINERFARQFRMGLFNLLR----RSPDITVGAIRIQ 86

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
            +     +       +   L           S +LV   ++NL G       ++  R  +
Sbjct: 87  PYHEFARNLPVPTNLNLIHLKPLRGTGLFVFSPSLVFIAVDNLFGGDGRFPTKVEGREFT 146

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++  R +       +                 ++     N     N+ V     ++
Sbjct: 147 HTEQRVINRMLKLALEAYSDAWKAINPLDVEYVR-SEMQVKFTNITTSPNDIVVNTPFHV 205

Query: 189 TIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            I N+   F + +P   +     L+       S  + ++  D   R+     + +     
Sbjct: 206 EIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRQEDQNWRDTLVRQVQHSELELIANFA 265

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                L  ++ LK G V+P    ++    +  +G  + + + G V   Y +R+   IN 
Sbjct: 266 EIPLRLSKILKLKPGDVLPIDKPDRILVHV--DGVPVLTSQYGTVNGQYALRVEHLINP 322


>gi|330826724|ref|YP_004390027.1| flagellar motor switch protein FliM [Alicycliphilus denitrificans
           K601]
 gi|329312096|gb|AEB86511.1| flagellar motor switch protein FliM [Alicycliphilus denitrificans
           K601]
          Length = 334

 Score =  155 bits (391), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 38/264 (14%), Positives = 92/264 (34%), Gaps = 5/264 (1%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + +         +    +IS  +    +++  +        F+  ++     +  I C
Sbjct: 59  ERFARNFRIGLFNMIRRSPEISVGTVGVQRYNAFLRELVVPTNFNIVAIRPLRGSGLIVC 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
             +L+  +++ L G   +   ++  R  S  E ++ +R +  I     +          +
Sbjct: 119 EPSLLFGIIDTLYGGVGKLQTRIEGRDFSATELRVIQRLVNLICEEYKKAWQGIYPLELS 178

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QN 218
            +   ++     N     +E V +    + I +++ +  + +P  TL     +  SS Q 
Sbjct: 179 YQR-SEMQPQFANI-ATPSEIVVSTAFQLEIGDLSGAIHICMPYATLEPIRDVLYSSVQG 236

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
            +       +    R+     V +   +     T++ ++ +K G  I      +  A  S
Sbjct: 237 DAIEVDRRWVKVLTREIQAAEVTLVAELARADATVEQLLAMKPGDFIELDREPRIRA--S 294

Query: 279 ANGKEIYSCELGRVGKNYTIRITD 302
             G  ++ C+ G     Y IRI  
Sbjct: 295 IEGVPVFECQYGTHNAKYAIRIEQ 318


>gi|50120652|ref|YP_049819.1| flagellar motor switch protein FliM [Pectobacterium atrosepticum
           SCRI1043]
 gi|49611178|emb|CAG74624.1| flagellar motor switch protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 337

 Score =  155 bits (391), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 41/276 (14%), Positives = 93/276 (33%), Gaps = 6/276 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + +         +    DI+    +   +     +       +   L           
Sbjct: 60  ERFARQFRMSLFNLLRRSPDITVGGIKIQPYHEFARNLPVPTNLNLIHLKPLRGTALFVF 119

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           S +LV   ++NL G       ++  R  +  E+++ KR +        +  +   +    
Sbjct: 120 SPSLVFIAVDNLFGGDGRFPTKVEGREFTHTEQRVVKRMLRLALEAYGEAWNAIYKLDIE 179

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLS--SQ 217
                ++     N     N+ V T   ++ I ++   F + IP   +++     L+    
Sbjct: 180 YVR-SEMQVKFTNITTSPNDIVVTTPFHVEIGSLTGEFNICIPFS-MIEPLRELLANPPL 237

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
             S  + +   D  A++     + +          L  ++ L+ G V+P    +K  A +
Sbjct: 238 ENSRQEDQSWRDTLAKQVQHSELELVASFVDIPLRLSKILKLQPGDVLPIDKPDKIVAHV 297

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKN 313
             +G  + + + G +   Y +R+   IN    SL N
Sbjct: 298 --DGVPVLTSQYGTLNGQYALRVEHLINPILNSLDN 331


>gi|66768580|ref|YP_243342.1| flagellar motor switch protein FliM [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|66573912|gb|AAY49322.1| flagellar protein [Xanthomonas campestris pv. campestris str. 8004]
          Length = 337

 Score =  155 bits (391), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 41/273 (15%), Positives = 88/273 (32%), Gaps = 25/273 (9%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + +         +    D+S       KF+  +HS       +            I  
Sbjct: 59  ERFARLWRIGLFNLIRRSADLSVRGIDLVKFNEYMHSLYVPTNLNLIRFKPLRGTGLIVF 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV T+++N  G       ++  R  +  E ++ +  + Q  A L +  +   +    
Sbjct: 119 EPTLVFTVVDNFFGGDGRFHTRIEGREFTATEMRVIQLMLKQTFADLKEAWAPVMDV--- 175

Query: 160 LEDFYDIDYLKKNTNR------LSNEFVTTINMNMTIENVASSFVLIIPQE-TLLKTTLI 212
                D +Y+    N          E+V     ++ +E          P    +L     
Sbjct: 176 -----DFEYINSEINPHFANIVTPREYVVVCRFHVELEGGGRR----DPHHPAVLDAGAD 226

Query: 213 SLSSQN--KSENQSED--LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFL 268
             +++   +S+    D         +     V + + +  K+ +L+ +  LKIG ++P  
Sbjct: 227 PRTARRRHQSDRNDRDDSWNVMLREQLDTAEVTLSSVLASKRMSLRQLTGLKIGDILPID 286

Query: 269 HREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
                   L      +++ E G    N  ++IT
Sbjct: 287 LPA--QVPLCVEEIPLFTGEFGVSNGNNAVKIT 317


>gi|26248214|ref|NP_754254.1| flagellar motor switch protein FliM [Escherichia coli CFT073]
 gi|91211163|ref|YP_541149.1| flagellar motor switch protein FliM [Escherichia coli UTI89]
 gi|110642051|ref|YP_669781.1| flagellar motor switch protein FliM [Escherichia coli 536]
 gi|117624085|ref|YP_852998.1| flagellar motor switch protein FliM [Escherichia coli APEC O1]
 gi|237705904|ref|ZP_04536385.1| flagellar motor switch protein FliM [Escherichia sp. 3_2_53FAA]
 gi|331642566|ref|ZP_08343701.1| flagellar motor switch protein FliM [Escherichia coli H736]
 gi|331647539|ref|ZP_08348631.1| flagellar motor switch protein FliM [Escherichia coli M605]
 gi|331653357|ref|ZP_08354362.1| flagellar motor switch protein FliM [Escherichia coli M718]
 gi|331673458|ref|ZP_08374226.1| flagellar motor switch protein FliM [Escherichia coli TA280]
 gi|331677827|ref|ZP_08378502.1| flagellar motor switch protein FliM [Escherichia coli H591]
 gi|332278888|ref|ZP_08391301.1| flagellar motor switch protein FliM [Shigella sp. D9]
 gi|26108618|gb|AAN80821.1|AE016762_74 Flagellar motor switch protein fliM [Escherichia coli CFT073]
 gi|91072737|gb|ABE07618.1| flagellar motor switch protein FliM [Escherichia coli UTI89]
 gi|110343643|gb|ABG69880.1| flagellar motor switch protein FliM [Escherichia coli 536]
 gi|115513209|gb|ABJ01284.1| Flagellar motor switch protein [Escherichia coli APEC O1]
 gi|226900661|gb|EEH86920.1| flagellar motor switch protein FliM [Escherichia sp. 3_2_53FAA]
 gi|331039364|gb|EGI11584.1| flagellar motor switch protein FliM [Escherichia coli H736]
 gi|331043263|gb|EGI15401.1| flagellar motor switch protein FliM [Escherichia coli M605]
 gi|331049455|gb|EGI21527.1| flagellar motor switch protein FliM [Escherichia coli M718]
 gi|331069656|gb|EGI41043.1| flagellar motor switch protein FliM [Escherichia coli TA280]
 gi|331074287|gb|EGI45607.1| flagellar motor switch protein FliM [Escherichia coli H591]
 gi|332101240|gb|EGJ04586.1| flagellar motor switch protein FliM [Shigella sp. D9]
          Length = 349

 Score =  155 bits (391), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 46/314 (14%), Positives = 96/314 (30%), Gaps = 10/314 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+  +      I      +   + +         +    DI+  +
Sbjct: 45  SGESDIRPYDPNTQRRVVRERLQALEI------INERFARHFRMGLFNLLRRSPDITVGA 98

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G       ++  
Sbjct: 99  IRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEG 158

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +                 ++     N     N+ V   
Sbjct: 159 REFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVR-SEMQVKFTNITTSPNDIVVNT 217

Query: 185 NMNMTIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     L+       S N+ ++  D   R+     + + 
Sbjct: 218 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELV 277

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK G V+P         I   +G  + + + G +   Y +RI   
Sbjct: 278 ANFADISLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRIEHL 335

Query: 304 INFDQKSLKNFLHK 317
           IN    SL     K
Sbjct: 336 INPILNSLNEEQPK 349


>gi|237731993|ref|ZP_04562474.1| flagellar motor switch protein fliM [Citrobacter sp. 30_2]
 gi|226907532|gb|EEH93450.1| flagellar motor switch protein fliM [Citrobacter sp. 30_2]
          Length = 349

 Score =  154 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 47/318 (14%), Positives = 103/318 (32%), Gaps = 10/318 (3%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           + G +   +  P  P    R+  +    + +E I+      ++  L  + +       DI
Sbjct: 41  ISGIAKESDIRPYDPNTQRRVVRER--LQALEIINERFARQFRMGLFNLLR----RSPDI 94

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           +  + +   +     +       +   L        +  S +LV   ++NL G       
Sbjct: 95  TVGAIRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPT 154

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++  R  +  E+++  R +       +                 ++     N     N+ 
Sbjct: 155 KVEGREFTHTEQRVINRMLKLALESYSDAWKAINPLEVEYVR-SEMQVKFTNITTSPNDI 213

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLN 239
           V     ++ I N+   F + +P   +     L+       S N+ ++  +   R+     
Sbjct: 214 VVNTPFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRNNLVRQVQHSE 273

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           + +          L  ++ LK G V+P         I   +G  + + + G V   Y +R
Sbjct: 274 LELVANFADIPLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTVNGQYALR 331

Query: 300 ITDRINFDQKSLKNFLHK 317
           +   IN    SL     K
Sbjct: 332 VEHLINPILNSLNEEQPK 349


>gi|319764508|ref|YP_004128445.1| flagellar motor switch protein flim [Alicycliphilus denitrificans
           BC]
 gi|317119069|gb|ADV01558.1| flagellar motor switch protein FliM [Alicycliphilus denitrificans
           BC]
          Length = 334

 Score =  154 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 38/264 (14%), Positives = 92/264 (34%), Gaps = 5/264 (1%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + +         +    +IS  +    +++  +        F+  ++     +  I C
Sbjct: 59  ERFARNFRIGLFNMIRRSPEISVGTVAVQRYNAFLRELVVPTNFNIVAIRPLRGSGLIVC 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
             +L+  +++ L G   +   ++  R  S  E ++ +R +  I     +          +
Sbjct: 119 EPSLLFGIIDTLYGGVGKLQTRIEGRDFSATELRVIQRLVNLICEEYKKAWQGIYPLELS 178

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QN 218
            +   ++     N     +E V +    + I +++ +  + +P  TL     +  SS Q 
Sbjct: 179 YQR-SEMQPQFANI-ATPSEIVVSTAFQLEIGDLSGAIHICMPYATLEPIRDVLYSSVQG 236

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
            +       +    R+     V +   +     T++ ++ +K G  I      +  A  S
Sbjct: 237 DAIEVDRRWVKVLTREIQAAEVTLVAELARADATVEQLLAMKPGDFIELDREPRIRA--S 294

Query: 279 ANGKEIYSCELGRVGKNYTIRITD 302
             G  ++ C+ G     Y IRI  
Sbjct: 295 IEGVPVFECQYGTHNAKYAIRIEQ 318


>gi|253688959|ref|YP_003018149.1| flagellar motor switch protein FliM [Pectobacterium carotovorum
           subsp. carotovorum PC1]
 gi|251755537|gb|ACT13613.1| flagellar motor switch protein FliM [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 337

 Score =  154 bits (389), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 41/276 (14%), Positives = 93/276 (33%), Gaps = 6/276 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + +         +    DI+    +   +     +       +   L           
Sbjct: 60  ERFARQFRMGLFNLLRRSPDITVGGIKIQPYHEFARNLPVPTNLNLIHLKPLRGTALFVF 119

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           S +LV   ++NL G       ++  R  +  E+++ KR +        +  +   +    
Sbjct: 120 SPSLVFIAVDNLFGGDGRFPTKVEGREFTHTEQRVVKRMLRLALEAYGEAWNAIYKLDIE 179

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLS--SQ 217
                ++     N     N+ V T   ++ I ++   F + IP   +++     L+    
Sbjct: 180 YVR-SEMQVKFTNITTSPNDIVVTTPFHVEIGSLTGEFNICIPFS-MIEPLRELLANPPL 237

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
             S  + +   D  A++     + +          L  ++ L+ G V+P    +K  A +
Sbjct: 238 ENSRQEDQSWRDTLAKQVQHSELELVASFVDIPLRLSKILKLQPGDVLPIDKPDKIIAHV 297

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKN 313
             +G  + + + G +   Y +R+   IN    SL N
Sbjct: 298 --DGVPVMTSQYGTLNGQYALRVEHLINPILNSLDN 331


>gi|281601385|gb|ADA74369.1| Flagellar motor switch protein FliM [Shigella flexneri 2002017]
          Length = 349

 Score =  154 bits (389), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 43/303 (14%), Positives = 93/303 (30%), Gaps = 10/303 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+  +      I      +   + +         +    DI+  +
Sbjct: 45  SGESDIRPYDPNTQRRVVRERLQALEI------INERFARHFRMGLFNLLRRSPDITVGA 98

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G       ++  
Sbjct: 99  IRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEG 158

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +                 ++     N     N+ V   
Sbjct: 159 REFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVR-SEMQVEFTNITTSPNDIVVNT 217

Query: 185 NMNMTIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     L+       S N+ ++  D   R+     + + 
Sbjct: 218 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELV 277

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK G V+P         I   +G  + + + G +   Y +RI   
Sbjct: 278 ANFADISLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRIEHL 335

Query: 304 INF 306
           IN 
Sbjct: 336 INP 338


>gi|291613061|ref|YP_003523218.1| flagellar motor switch protein FliM [Sideroxydans lithotrophicus
           ES-1]
 gi|291583173|gb|ADE10831.1| flagellar motor switch protein FliM [Sideroxydans lithotrophicus
           ES-1]
          Length = 333

 Score =  154 bits (389), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 40/292 (13%), Positives = 98/292 (33%), Gaps = 13/292 (4%)

Query: 19  ARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFK 78
            R+    G   T+E I+     L++  L            +IS    +  KFS  I +  
Sbjct: 43  ERIVR--GRMPTMEIINERFARLFRISLYNFIHRSS----EISVGPVRVMKFSEFIRNLP 96

Query: 79  ENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRT 138
                +   +     +       NLV  ++++L G       ++  R  +  E ++ ++ 
Sbjct: 97  VPANLNLVQVKPLRGSALFIFDPNLVFMVVDSLFGGDGRFHTRVEGREFTQTEHRIIQKL 156

Query: 139 IAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFV 198
           +  +     +   T Q+              +       NE V      +    V  S  
Sbjct: 157 LDVVFQTYGKSWETVQKLDFEFIRSEV--NPQFANIATPNEVVVVTTFEVEFTGVGGSIH 214

Query: 199 LIIPQETLLKTTLISLSSQNKSE--NQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDV 256
           + +P   +++     L S  + +     +  +   +R+     V +   +    T ++ V
Sbjct: 215 ICMPYA-MIEPIREMLYSTMQGDHVIADKRWLHMLSRQIQLAEVELTAVLGHATTNVEHV 273

Query: 257 VTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
           + ++ G +IP    +    ++  +   +  C+ G     Y +++   +  + 
Sbjct: 274 LKMRAGDIIPLEVEDTIQVLV--DTVPVMECKYGSSNGQYALKVEKMLATEH 323


>gi|323174676|gb|EFZ60296.1| flagellar motor switch protein FliM [Escherichia coli LT-68]
          Length = 334

 Score =  154 bits (389), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 46/303 (15%), Positives = 99/303 (32%), Gaps = 10/303 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+  +    +T+E I+      ++  L  + +       DI+  +
Sbjct: 30  SGESDIRPYDPNTQRRVVRER--LQTLEIINERFARHFRMGLFNLLR----RSPDITVGA 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G       ++  
Sbjct: 84  IRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +                 ++     N     N+ V   
Sbjct: 144 REFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVR-SEMQVKFTNITTSPNDIVVNT 202

Query: 185 NMNMTIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     L+       S N+ ++  D   R+     + + 
Sbjct: 203 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELV 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK G V+P         I   +G  + + + G +   Y +RI   
Sbjct: 263 ANFADISLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRIEHL 320

Query: 304 INF 306
           IN 
Sbjct: 321 INP 323


>gi|170769401|ref|ZP_02903854.1| flagellar motor switch protein FliM [Escherichia albertii TW07627]
 gi|170121725|gb|EDS90656.1| flagellar motor switch protein FliM [Escherichia albertii TW07627]
          Length = 334

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 46/314 (14%), Positives = 97/314 (30%), Gaps = 10/314 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+  +      I      +   + +         +    DI+  +
Sbjct: 30  STESDIRPYDPNTQQRVVRERLQALEI------INERFARHFRMGLFNLLRRSPDITVGA 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G       ++  
Sbjct: 84  IRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +         +       ++     N     N+ V   
Sbjct: 144 REFTDTEQRVINRMLKLALEGYSDAWKAINPLNVEYVR-SEMQVKFTNITTSPNDIVVNT 202

Query: 185 NMNMTIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     L+    Q  S N+ ++  D   R+     + + 
Sbjct: 203 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPQENSRNEDQNWRDNLVRQVQHSQLELV 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK   V+P         I   +G  + + + G +   Y +RI   
Sbjct: 263 ANFADISLRLSQILKLKPSDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRIEHL 320

Query: 304 INFDQKSLKNFLHK 317
           IN    SL     K
Sbjct: 321 INPILNSLNEEQPK 334


>gi|332095507|gb|EGJ00523.1| flagellar motor switch protein FliM [Shigella dysenteriae 155-74]
          Length = 334

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 47/314 (14%), Positives = 96/314 (30%), Gaps = 10/314 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+  K      I      +   + +         +    DI+  +
Sbjct: 30  SGESDIRPYDPNTQRRVVRKRLQALEI------INERFARHFRMGLFNLLRRSPDITVGA 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G       ++  
Sbjct: 84  IRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +                 ++     N     N+ V   
Sbjct: 144 REFTHTEQRVINRMLKLALEGYSDAWKAINPLDVEYVR-SEMQVKFTNITTSPNDIVVNT 202

Query: 185 NMNMTIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     L+       S N+ ++  D   R+     + + 
Sbjct: 203 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELV 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK G V+P         I   +G  + + + G +   Y +RI   
Sbjct: 263 ANFADISLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRIEHL 320

Query: 304 INFDQKSLKNFLHK 317
           IN    SL     K
Sbjct: 321 INPILNSLNEEQPK 334


>gi|283832660|ref|ZP_06352401.1| flagellar motor switch protein FliM [Citrobacter youngae ATCC
           29220]
 gi|291072334|gb|EFE10443.1| flagellar motor switch protein FliM [Citrobacter youngae ATCC
           29220]
          Length = 334

 Score =  153 bits (387), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 47/318 (14%), Positives = 103/318 (32%), Gaps = 10/318 (3%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           + G +   +  P  P    R+  +    + +E I+      ++  L  + +       DI
Sbjct: 26  ISGIAKESDIRPYDPNTQRRVVRER--LQALEIINERFARQFRMGLFNLLR----RSPDI 79

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           +  + +   +     +       +   L        +  S +LV   ++NL G       
Sbjct: 80  TVGAIRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPT 139

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++  R  +  E+++  R +       +                 ++     N     N+ 
Sbjct: 140 KVEGREFTHTEQRVINRMLKLALESYSDAWKAINPLEVEYVR-SEMQVKFTNITTSPNDI 198

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLN 239
           V     ++ I N+   F + +P   +     L+       S N+ ++  +   R+     
Sbjct: 199 VVNTPFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRNNLVRQVQHSE 258

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           + +          L  ++ LK G V+P         I   +G  + + + G V   Y +R
Sbjct: 259 LELVANFADIPLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTVNGQYALR 316

Query: 300 ITDRINFDQKSLKNFLHK 317
           +   IN    SL     K
Sbjct: 317 VEHLINPILNSLNEEQPK 334


>gi|218549270|ref|YP_002383061.1| flagellar motor switch protein FliM [Escherichia fergusonii ATCC
           35469]
 gi|218356811|emb|CAQ89439.1| flagellar motor switching and energizing component [Escherichia
           fergusonii ATCC 35469]
 gi|324114212|gb|EGC08185.1| flagellar motor switch protein FliM [Escherichia fergusonii B253]
 gi|325497687|gb|EGC95546.1| flagellar motor switch protein FliM [Escherichia fergusonii ECD227]
          Length = 334

 Score =  153 bits (387), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 44/318 (13%), Positives = 96/318 (30%), Gaps = 10/318 (3%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           + G +   +  P  P    R+  +      I      +   + +         +    DI
Sbjct: 26  ISGITNESDIRPYDPNTQRRVVRERLQALEI------INERFARHFRMGLFNLLRRSPDI 79

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           +  + +   +     +       +   L        +  S  LV   ++NL G       
Sbjct: 80  TVGAIRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPALVFIAVDNLFGGDGRFPT 139

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++  R  +  E+++  R +                         ++     N     N+ 
Sbjct: 140 KVEGREFTHTEQRVINRMLKLALEGYRDAWKAINPLEVEYVR-SEMQVKFTNITTSPNDI 198

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLN 239
           V     ++ I N+   F + +P   +     L+       S ++ ++  +   R+     
Sbjct: 199 VVNTPFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRHEDQNWRNNLVRQVQHSQ 258

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           + +          L  ++ LK G V+P         I   +G  + + + G +   Y +R
Sbjct: 259 LELVANFAEISLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALR 316

Query: 300 ITDRINFDQKSLKNFLHK 317
           I   IN    SL     K
Sbjct: 317 IEHLINPILNSLNEEQPK 334


>gi|300994270|ref|ZP_07180822.1| flagellar motor switch protein FliM [Escherichia coli MS 200-1]
 gi|300304935|gb|EFJ59455.1| flagellar motor switch protein FliM [Escherichia coli MS 200-1]
          Length = 334

 Score =  153 bits (387), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 43/303 (14%), Positives = 93/303 (30%), Gaps = 10/303 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+  +      I      +   + +         +    DI+  +
Sbjct: 30  SGESDIRPYDPNTQRRVVRERLQALEI------INERFARHFRMGLFNLLRRSPDITVGA 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G       ++  
Sbjct: 84  IRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +                 ++     N     N+ V   
Sbjct: 144 REFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVR-SEMQVKFTNITTSPNDIVVNT 202

Query: 185 NMNMTIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     L+       S N+ ++  D   R+     + + 
Sbjct: 203 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELV 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK G V+P         I   +G  + + + G +   Y +RI   
Sbjct: 263 ANFADISLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRIEHL 320

Query: 304 INF 306
           IN 
Sbjct: 321 INP 323


>gi|227328351|ref|ZP_03832375.1| flagellar motor switch protein FliM [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 337

 Score =  153 bits (387), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 41/276 (14%), Positives = 94/276 (34%), Gaps = 6/276 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + +         +    DI+  + +   +     +       +   L           
Sbjct: 60  ERFARQFRMGLFNLLRRSPDITVGAIKIQPYHEFARNLPVPTNLNLIHLKPLRGTALFVF 119

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           S +LV   ++NL G       ++  R  +  E+++ KR +        +  +   +    
Sbjct: 120 SPSLVFIAVDNLFGGDGRFPTKVEGREFTHTEQRVVKRMLRLALEAYGEAWNAIYKLDIE 179

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLS--SQ 217
                ++     N     N+ V T   ++ I ++   F + IP   +++     L+    
Sbjct: 180 YVR-SEMQVKFTNITTSPNDIVVTTPFHVEIGSLTGEFNICIPFS-MIEPLRELLANPPL 237

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
             S  + +   D  A++     + +          L  ++ L+ G V+P    +K  A +
Sbjct: 238 ENSRQEDQSWRDTLAKQVQHSELELVASFVDIPLRLSKILKLQPGDVLPIDKPDKIVAHV 297

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKN 313
             +G  + + + G +   Y +R+   IN    SL N
Sbjct: 298 --DGVPVLTSQYGTLNGQYALRVEHLINPILNSLDN 331


>gi|227112534|ref|ZP_03826190.1| flagellar motor switch protein FliM [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 337

 Score =  153 bits (387), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 41/276 (14%), Positives = 94/276 (34%), Gaps = 6/276 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + +         +    DI+  + +   +     +       +   L           
Sbjct: 60  ERFARQFRMGLFNLLRRSPDITVGAIKIQPYHEFARNLPVPTNLNLIHLKPLRGTALFVF 119

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
           S +LV   ++NL G       ++  R  +  E+++ KR +        +  +   +    
Sbjct: 120 SPSLVFIAVDNLFGGDGRFPTKVEGREFTHTEQRVVKRMLRLALEAYGEAWNAIYKLDIE 179

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLS--SQ 217
                ++     N     N+ V T   ++ I ++   F + IP   +++     L+    
Sbjct: 180 YVR-SEMQVKFTNITTSPNDIVVTTPFHVEIGSLTGEFNICIPFS-MIEPLRELLANPPL 237

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
             S  + +   D  A++     + +          L  ++ L+ G V+P    +K  A +
Sbjct: 238 ENSRQEDQSWRDTLAKQVQHSELELVASFVDIPLRLSKILKLQPGDVLPIDKPDKIVAHV 297

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKN 313
             +G  + + + G +   Y +R+   IN    SL N
Sbjct: 298 --DGVPVLTSQYGTLNGQYALRVEHLINPILNSLDN 331


>gi|15831938|ref|NP_310711.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           Sakai]
 gi|82543593|ref|YP_407540.1| flagellar motor switch protein FliM [Shigella boydii Sb227]
 gi|157156914|ref|YP_001463247.1| flagellar motor switch protein FliM [Escherichia coli E24377A]
 gi|157161416|ref|YP_001458734.1| flagellar motor switch protein FliM [Escherichia coli HS]
 gi|168751874|ref|ZP_02776896.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4113]
 gi|168758259|ref|ZP_02783266.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4401]
 gi|168764429|ref|ZP_02789436.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4501]
 gi|168771552|ref|ZP_02796559.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4486]
 gi|168777372|ref|ZP_02802379.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4196]
 gi|168783342|ref|ZP_02808349.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4076]
 gi|168790295|ref|ZP_02815302.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC869]
 gi|168802292|ref|ZP_02827299.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC508]
 gi|170019722|ref|YP_001724676.1| flagellar motor switch protein FliM [Escherichia coli ATCC 8739]
 gi|170684212|ref|YP_001743300.1| flagellar motor switch protein FliM [Escherichia coli SMS-3-5]
 gi|188494069|ref|ZP_03001339.1| flagellar motor switch protein FliM [Escherichia coli 53638]
 gi|191168308|ref|ZP_03030101.1| flagellar motor switch protein FliM [Escherichia coli B7A]
 gi|191173313|ref|ZP_03034843.1| flagellar motor switch protein FliM [Escherichia coli F11]
 gi|193071140|ref|ZP_03052064.1| flagellar motor switch protein FliM [Escherichia coli E110019]
 gi|194429931|ref|ZP_03062441.1| flagellar motor switch protein FliM [Escherichia coli B171]
 gi|194439587|ref|ZP_03071660.1| flagellar motor switch protein FliM [Escherichia coli 101-1]
 gi|195939251|ref|ZP_03084633.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4024]
 gi|208810354|ref|ZP_03252230.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4206]
 gi|208816529|ref|ZP_03257649.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4045]
 gi|208818778|ref|ZP_03259098.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4042]
 gi|209396357|ref|YP_002271061.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4115]
 gi|209919367|ref|YP_002293451.1| flagellar motor switch protein FliM [Escherichia coli SE11]
 gi|215487145|ref|YP_002329576.1| flagellar motor switch protein FliM [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217328609|ref|ZP_03444690.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           TW14588]
 gi|218554525|ref|YP_002387438.1| flagellar motor switch protein FliM [Escherichia coli IAI1]
 gi|218558802|ref|YP_002391715.1| flagellar motor switch protein FliM [Escherichia coli S88]
 gi|218689940|ref|YP_002398152.1| flagellar motor switch protein FliM [Escherichia coli ED1a]
 gi|218695550|ref|YP_002403217.1| flagellar motor switch protein FliM [Escherichia coli 55989]
 gi|218699494|ref|YP_002407123.1| flagellar motor switch protein FliM [Escherichia coli IAI39]
 gi|218705438|ref|YP_002412957.1| flagellar motor switch protein FliM [Escherichia coli UMN026]
 gi|227885626|ref|ZP_04003431.1| flagellar motor switch protein FliM [Escherichia coli 83972]
 gi|254793595|ref|YP_003078432.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           TW14359]
 gi|256017862|ref|ZP_05431727.1| flagellar motor switch protein FliM [Shigella sp. D9]
 gi|256022397|ref|ZP_05436262.1| flagellar motor switch protein FliM [Escherichia sp. 4_1_40B]
 gi|260844344|ref|YP_003222122.1| flagellar motor switching and energizing component FliM
           [Escherichia coli O103:H2 str. 12009]
 gi|260855920|ref|YP_003229811.1| flagellar motor switching and energizing component FliM
           [Escherichia coli O26:H11 str. 11368]
 gi|260868538|ref|YP_003234940.1| flagellar motor switching and energizing component FliM
           [Escherichia coli O111:H- str. 11128]
 gi|261227560|ref|ZP_05941841.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261254616|ref|ZP_05947149.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291283122|ref|YP_003499940.1| Flagellar motor switch protein FliM [Escherichia coli O55:H7 str.
           CB9615]
 gi|293405428|ref|ZP_06649420.1| flagellar motor switch protein fliM [Escherichia coli FVEC1412]
 gi|293410301|ref|ZP_06653877.1| flagellar motor switch protein FliM [Escherichia coli B354]
 gi|293415255|ref|ZP_06657898.1| flagellar motor switch protein FliM [Escherichia coli B185]
 gi|293446325|ref|ZP_06662747.1| flagellar motor switch protein FliM [Escherichia coli B088]
 gi|298381072|ref|ZP_06990671.1| flagellar motor switch protein fliM [Escherichia coli FVEC1302]
 gi|300818635|ref|ZP_07098843.1| flagellar motor switch protein FliM [Escherichia coli MS 107-1]
 gi|300822285|ref|ZP_07102426.1| flagellar motor switch protein FliM [Escherichia coli MS 119-7]
 gi|300899202|ref|ZP_07117478.1| flagellar motor switch protein FliM [Escherichia coli MS 198-1]
 gi|300904835|ref|ZP_07122661.1| flagellar motor switch protein FliM [Escherichia coli MS 84-1]
 gi|300920164|ref|ZP_07136614.1| flagellar motor switch protein FliM [Escherichia coli MS 115-1]
 gi|300923892|ref|ZP_07139907.1| flagellar motor switch protein FliM [Escherichia coli MS 182-1]
 gi|300931158|ref|ZP_07146505.1| flagellar motor switch protein FliM [Escherichia coli MS 187-1]
 gi|300940400|ref|ZP_07154985.1| flagellar motor switch protein FliM [Escherichia coli MS 21-1]
 gi|300951570|ref|ZP_07165403.1| flagellar motor switch protein FliM [Escherichia coli MS 116-1]
 gi|300956539|ref|ZP_07168821.1| flagellar motor switch protein FliM [Escherichia coli MS 175-1]
 gi|301018205|ref|ZP_07182720.1| flagellar motor switch protein FliM [Escherichia coli MS 69-1]
 gi|301305288|ref|ZP_07211385.1| flagellar motor switch protein FliM [Escherichia coli MS 124-1]
 gi|301327732|ref|ZP_07220937.1| flagellar motor switch protein FliM [Escherichia coli MS 78-1]
 gi|301644596|ref|ZP_07244585.1| flagellar motor switch protein FliM [Escherichia coli MS 146-1]
 gi|306814232|ref|ZP_07448398.1| flagellar motor switch protein FliM [Escherichia coli NC101]
 gi|307138612|ref|ZP_07497968.1| flagellar motor switch protein FliM [Escherichia coli H736]
 gi|307312469|ref|ZP_07592103.1| flagellar motor switch protein FliM [Escherichia coli W]
 gi|309795948|ref|ZP_07690361.1| flagellar motor switch protein FliM [Escherichia coli MS 145-7]
 gi|312967142|ref|ZP_07781360.1| flagellar motor switch protein FliM [Escherichia coli 2362-75]
 gi|312973838|ref|ZP_07788010.1| flagellar motor switch protein FliM [Escherichia coli 1827-70]
 gi|331657991|ref|ZP_08358953.1| flagellar motor switch protein FliM [Escherichia coli TA206]
 gi|331663441|ref|ZP_08364351.1| flagellar motor switch protein FliM [Escherichia coli TA143]
 gi|331668636|ref|ZP_08369484.1| flagellar motor switch protein FliM [Escherichia coli TA271]
 gi|331683497|ref|ZP_08384098.1| flagellar motor switch protein FliM [Escherichia coli H299]
 gi|13362152|dbj|BAB36107.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           Sakai]
 gi|81245004|gb|ABB65712.1| FliM [Shigella boydii Sb227]
 gi|157067096|gb|ABV06351.1| flagellar motor switch protein FliM [Escherichia coli HS]
 gi|157078944|gb|ABV18652.1| flagellar motor switch protein FliM [Escherichia coli E24377A]
 gi|169754650|gb|ACA77349.1| flagellar motor switch protein FliM [Escherichia coli ATCC 8739]
 gi|170521930|gb|ACB20108.1| flagellar motor switch protein FliM [Escherichia coli SMS-3-5]
 gi|187767405|gb|EDU31249.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4196]
 gi|188014186|gb|EDU52308.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4113]
 gi|188489268|gb|EDU64371.1| flagellar motor switch protein FliM [Escherichia coli 53638]
 gi|188999277|gb|EDU68263.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4076]
 gi|189354878|gb|EDU73297.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4401]
 gi|189359725|gb|EDU78144.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4486]
 gi|189365559|gb|EDU83975.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4501]
 gi|189370212|gb|EDU88628.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC869]
 gi|189375729|gb|EDU94145.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC508]
 gi|190901680|gb|EDV61436.1| flagellar motor switch protein FliM [Escherichia coli B7A]
 gi|190906430|gb|EDV66039.1| flagellar motor switch protein FliM [Escherichia coli F11]
 gi|192955535|gb|EDV86014.1| flagellar motor switch protein FliM [Escherichia coli E110019]
 gi|194412020|gb|EDX28332.1| flagellar motor switch protein FliM [Escherichia coli B171]
 gi|194421496|gb|EDX37510.1| flagellar motor switch protein FliM [Escherichia coli 101-1]
 gi|208724870|gb|EDZ74577.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4206]
 gi|208730872|gb|EDZ79561.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4045]
 gi|208738901|gb|EDZ86583.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4042]
 gi|209157757|gb|ACI35190.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4115]
 gi|209766818|gb|ACI81721.1| flagellar motor switch protein FliM [Escherichia coli]
 gi|209766820|gb|ACI81722.1| flagellar motor switch protein FliM [Escherichia coli]
 gi|209766822|gb|ACI81723.1| flagellar motor switch protein FliM [Escherichia coli]
 gi|209766824|gb|ACI81724.1| flagellar motor switch protein FliM [Escherichia coli]
 gi|209766826|gb|ACI81725.1| flagellar motor switch protein FliM [Escherichia coli]
 gi|209912626|dbj|BAG77700.1| flagellar motor switch protein FliM [Escherichia coli SE11]
 gi|215265217|emb|CAS09607.1| flagellar motor switching and energizing component [Escherichia
           coli O127:H6 str. E2348/69]
 gi|217317956|gb|EEC26383.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           TW14588]
 gi|218352282|emb|CAU98039.1| flagellar motor switching and energizing component [Escherichia
           coli 55989]
 gi|218361293|emb|CAQ98877.1| flagellar motor switching and energizing component [Escherichia
           coli IAI1]
 gi|218365571|emb|CAR03298.1| flagellar motor switching and energizing component [Escherichia
           coli S88]
 gi|218369480|emb|CAR17245.1| flagellar motor switching and energizing component [Escherichia
           coli IAI39]
 gi|218427504|emb|CAR08399.2| flagellar motor switching and energizing component [Escherichia
           coli ED1a]
 gi|218432535|emb|CAR13428.1| flagellar motor switching and energizing component [Escherichia
           coli UMN026]
 gi|222033684|emb|CAP76425.1| flagellar motor switch protein fliM [Escherichia coli LF82]
 gi|227837199|gb|EEJ47665.1| flagellar motor switch protein FliM [Escherichia coli 83972]
 gi|254592995|gb|ACT72356.1| flagellar motor switching and energizing component [Escherichia
           coli O157:H7 str. TW14359]
 gi|257754569|dbj|BAI26071.1| flagellar motor switching and energizing component FliM
           [Escherichia coli O26:H11 str. 11368]
 gi|257759491|dbj|BAI30988.1| flagellar motor switching and energizing component FliM
           [Escherichia coli O103:H2 str. 12009]
 gi|257764894|dbj|BAI36389.1| flagellar motor switching and energizing component FliM
           [Escherichia coli O111:H- str. 11128]
 gi|281179007|dbj|BAI55337.1| flagellar motor switch protein FliM [Escherichia coli SE15]
 gi|284921853|emb|CBG34928.1| flagellar motor switch protein FliM [Escherichia coli 042]
 gi|290762995|gb|ADD56956.1| Flagellar motor switch protein FliM [Escherichia coli O55:H7 str.
           CB9615]
 gi|291323155|gb|EFE62583.1| flagellar motor switch protein FliM [Escherichia coli B088]
 gi|291427636|gb|EFF00663.1| flagellar motor switch protein fliM [Escherichia coli FVEC1412]
 gi|291432903|gb|EFF05882.1| flagellar motor switch protein FliM [Escherichia coli B185]
 gi|291470769|gb|EFF13253.1| flagellar motor switch protein FliM [Escherichia coli B354]
 gi|294492735|gb|ADE91491.1| flagellar motor switch protein FliM [Escherichia coli IHE3034]
 gi|298278514|gb|EFI20028.1| flagellar motor switch protein fliM [Escherichia coli FVEC1302]
 gi|300316639|gb|EFJ66423.1| flagellar motor switch protein FliM [Escherichia coli MS 175-1]
 gi|300357183|gb|EFJ73053.1| flagellar motor switch protein FliM [Escherichia coli MS 198-1]
 gi|300399792|gb|EFJ83330.1| flagellar motor switch protein FliM [Escherichia coli MS 69-1]
 gi|300403262|gb|EFJ86800.1| flagellar motor switch protein FliM [Escherichia coli MS 84-1]
 gi|300412821|gb|EFJ96131.1| flagellar motor switch protein FliM [Escherichia coli MS 115-1]
 gi|300419855|gb|EFK03166.1| flagellar motor switch protein FliM [Escherichia coli MS 182-1]
 gi|300449197|gb|EFK12817.1| flagellar motor switch protein FliM [Escherichia coli MS 116-1]
 gi|300454794|gb|EFK18287.1| flagellar motor switch protein FliM [Escherichia coli MS 21-1]
 gi|300461015|gb|EFK24508.1| flagellar motor switch protein FliM [Escherichia coli MS 187-1]
 gi|300525168|gb|EFK46237.1| flagellar motor switch protein FliM [Escherichia coli MS 119-7]
 gi|300528807|gb|EFK49869.1| flagellar motor switch protein FliM [Escherichia coli MS 107-1]
 gi|300839494|gb|EFK67254.1| flagellar motor switch protein FliM [Escherichia coli MS 124-1]
 gi|300845732|gb|EFK73492.1| flagellar motor switch protein FliM [Escherichia coli MS 78-1]
 gi|301077071|gb|EFK91877.1| flagellar motor switch protein FliM [Escherichia coli MS 146-1]
 gi|305852391|gb|EFM52842.1| flagellar motor switch protein FliM [Escherichia coli NC101]
 gi|306907640|gb|EFN38143.1| flagellar motor switch protein FliM [Escherichia coli W]
 gi|307553958|gb|ADN46733.1| flagellar motor switch protein FliM [Escherichia coli ABU 83972]
 gi|307626579|gb|ADN70883.1| flagellar motor switch protein FliM [Escherichia coli UM146]
 gi|308120398|gb|EFO57660.1| flagellar motor switch protein FliM [Escherichia coli MS 145-7]
 gi|309702234|emb|CBJ01551.1| flagellar motor switch protein FliM [Escherichia coli ETEC H10407]
 gi|310332433|gb|EFP99668.1| flagellar motor switch protein FliM [Escherichia coli 1827-70]
 gi|312288606|gb|EFR16508.1| flagellar motor switch protein FliM [Escherichia coli 2362-75]
 gi|312946538|gb|ADR27365.1| flagellar motor switch protein FliM [Escherichia coli O83:H1 str.
           NRG 857C]
 gi|315061245|gb|ADT75572.1| flagellar motor switching and energizing component [Escherichia
           coli W]
 gi|315257223|gb|EFU37191.1| flagellar motor switch protein FliM [Escherichia coli MS 85-1]
 gi|315286659|gb|EFU46092.1| flagellar motor switch protein FliM [Escherichia coli MS 110-3]
 gi|315290262|gb|EFU49640.1| flagellar motor switch protein FliM [Escherichia coli MS 153-1]
 gi|315296479|gb|EFU55776.1| flagellar motor switch protein FliM [Escherichia coli MS 16-3]
 gi|320175465|gb|EFW50564.1| Flagellar motor switch protein FliM [Shigella dysenteriae CDC
           74-1112]
 gi|320184483|gb|EFW59287.1| Flagellar motor switch protein FliM [Shigella flexneri CDC 796-83]
 gi|320191919|gb|EFW66566.1| Flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC1212]
 gi|320194342|gb|EFW68973.1| Flagellar motor switch protein FliM [Escherichia coli WV_060327]
 gi|320198635|gb|EFW73235.1| Flagellar motor switch protein FliM [Escherichia coli EC4100B]
 gi|320641793|gb|EFX11181.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           G5101]
 gi|320647152|gb|EFX15985.1| flagellar motor switch protein FliM [Escherichia coli O157:H- str.
           493-89]
 gi|320652436|gb|EFX20734.1| flagellar motor switch protein FliM [Escherichia coli O157:H- str.
           H 2687]
 gi|320658038|gb|EFX25800.1| flagellar motor switch protein FliM [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320658610|gb|EFX26304.1| flagellar motor switch protein FliM [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320668508|gb|EFX35335.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323152724|gb|EFZ38996.1| flagellar motor switch protein FliM [Escherichia coli EPECa14]
 gi|323158576|gb|EFZ44590.1| flagellar motor switch protein FliM [Escherichia coli E128010]
 gi|323180802|gb|EFZ66342.1| flagellar motor switch protein FliM [Escherichia coli 1180]
 gi|323183929|gb|EFZ69316.1| flagellar motor switch protein FliM [Escherichia coli 1357]
 gi|323186821|gb|EFZ72141.1| flagellar motor switch protein FliM [Escherichia coli RN587/1]
 gi|323378178|gb|ADX50446.1| flagellar motor switch protein FliM [Escherichia coli KO11]
 gi|323937215|gb|EGB33495.1| flagellar motor switch protein FliM [Escherichia coli E1520]
 gi|323940396|gb|EGB36587.1| flagellar motor switch protein FliM [Escherichia coli E482]
 gi|323948351|gb|EGB44338.1| flagellar motor switch protein FliM [Escherichia coli H120]
 gi|323952438|gb|EGB48311.1| flagellar motor switch protein FliM [Escherichia coli H252]
 gi|323956341|gb|EGB52084.1| flagellar motor switch protein FliM [Escherichia coli H263]
 gi|323961989|gb|EGB57588.1| flagellar motor switch protein FliM [Escherichia coli H489]
 gi|323972755|gb|EGB67955.1| flagellar motor switch protein FliM [Escherichia coli TA007]
 gi|324005856|gb|EGB75075.1| flagellar motor switch protein FliM [Escherichia coli MS 57-2]
 gi|324013500|gb|EGB82719.1| flagellar motor switch protein FliM [Escherichia coli MS 60-1]
 gi|324018854|gb|EGB88073.1| flagellar motor switch protein FliM [Escherichia coli MS 117-3]
 gi|324118994|gb|EGC12883.1| flagellar motor switch protein FliM [Escherichia coli E1167]
 gi|326342355|gb|EGD66136.1| Flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           1044]
 gi|326344860|gb|EGD68607.1| Flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           1125]
 gi|330911751|gb|EGH40261.1| flagellar motor switch protein FliM [Escherichia coli AA86]
 gi|331056239|gb|EGI28248.1| flagellar motor switch protein FliM [Escherichia coli TA206]
 gi|331059240|gb|EGI31217.1| flagellar motor switch protein FliM [Escherichia coli TA143]
 gi|331063830|gb|EGI35741.1| flagellar motor switch protein FliM [Escherichia coli TA271]
 gi|331079712|gb|EGI50909.1| flagellar motor switch protein FliM [Escherichia coli H299]
 gi|332093098|gb|EGI98162.1| flagellar motor switch protein FliM [Shigella boydii 5216-82]
 gi|332096930|gb|EGJ01919.1| flagellar motor switch protein FliM [Shigella boydii 3594-74]
 gi|332343671|gb|AEE57005.1| flagellar motor switch protein FliM [Escherichia coli UMNK88]
          Length = 334

 Score =  153 bits (387), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 46/314 (14%), Positives = 96/314 (30%), Gaps = 10/314 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+  +      I      +   + +         +    DI+  +
Sbjct: 30  SGESDIRPYDPNTQRRVVRERLQALEI------INERFARHFRMGLFNLLRRSPDITVGA 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G       ++  
Sbjct: 84  IRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +                 ++     N     N+ V   
Sbjct: 144 REFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVR-SEMQVKFTNITTSPNDIVVNT 202

Query: 185 NMNMTIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     L+       S N+ ++  D   R+     + + 
Sbjct: 203 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELV 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK G V+P         I   +G  + + + G +   Y +RI   
Sbjct: 263 ANFADISLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRIEHL 320

Query: 304 INFDQKSLKNFLHK 317
           IN    SL     K
Sbjct: 321 INPILNSLNEEQPK 334


>gi|260598454|ref|YP_003211025.1| flagellar motor switch protein FliM [Cronobacter turicensis z3032]
 gi|260217631|emb|CBA31927.1| Flagellar motor switch protein fliM [Cronobacter turicensis z3032]
          Length = 334

 Score =  153 bits (387), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 42/299 (14%), Positives = 96/299 (32%), Gaps = 10/299 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +  P  P    R+  +    + +E I+      ++  L  + +       DI+  + +  
Sbjct: 33  DIRPYDPNTQRRVVRER--LQALEIINERFARQFRMGLFNLLR----RSPDITVGAIRIQ 86

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
            +     +       +   L           S +LV   ++NL G       ++  R  +
Sbjct: 87  PYHEFARNLPVPTNLNLIHLKPLRGTGLFVFSPSLVFIAVDNLFGGDGRFPTKVEGREFT 146

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++  R +       +                 ++     N     N+ V     ++
Sbjct: 147 HTEQRVINRMLKLALEAYSDAWKAINPLDVEYVR-SEMQVKFTNITTSPNDIVVNTPFHV 205

Query: 189 TIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            I N+   F + +P   +     L+       S  + +   D   R+     + +     
Sbjct: 206 EIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRQEDQHWRDNLVRQVQHSELELIANFA 265

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                L  ++ LK G V+P    ++    +  +G  + + + G V   Y +R+   IN 
Sbjct: 266 EIPLRLSKILKLKPGDVLPIEKPDRILVHV--DGVPVLTSQYGTVSGQYALRVEHLINP 322


>gi|157145261|ref|YP_001452580.1| flagellar motor switch protein FliM [Citrobacter koseri ATCC
           BAA-895]
 gi|157082466|gb|ABV12144.1| hypothetical protein CKO_00998 [Citrobacter koseri ATCC BAA-895]
          Length = 334

 Score =  153 bits (386), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 46/310 (14%), Positives = 100/310 (32%), Gaps = 10/310 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +  P  P    R+  +    + +E I+      ++  L  + +       DI+  + +  
Sbjct: 34  DIRPYDPNTQRRVVRER--LQALEIINERFARQFRMGLFNLLR----RSPDITVGAIRIQ 87

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
            +     +       +   L        +  S +LV   ++NL G       ++  R  +
Sbjct: 88  PYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEGREFT 147

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++  R +       +                 ++     N     N+ V     ++
Sbjct: 148 HTEQRVINRMLKLALESYSDAWKAINPLEVEYVR-SEMQVKFTNITTSPNDIVVNTPFHV 206

Query: 189 TIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            I N+   F + +P   +     L+       S ++ ++  D   R+     + +     
Sbjct: 207 EIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRHEDQNWRDNLVRQVQHSELELVANFA 266

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
                L  ++ LK G V+P         I   +G  + + + G V   Y +R+   IN  
Sbjct: 267 DIPLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTVNGQYALRVEHLINPI 324

Query: 308 QKSLKNFLHK 317
             SL     K
Sbjct: 325 LNSLNEEQPK 334


>gi|193066386|ref|ZP_03047434.1| flagellar motor switch protein FliM [Escherichia coli E22]
 gi|192925971|gb|EDV80617.1| flagellar motor switch protein FliM [Escherichia coli E22]
          Length = 334

 Score =  153 bits (386), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 46/314 (14%), Positives = 96/314 (30%), Gaps = 10/314 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+  +      I      +   + +         +    DI+  +
Sbjct: 30  SGESDIRPYDPNTQRRVVRERLQALEI------INERFARHFRMGLFNLLRRSPDITVGA 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G       ++  
Sbjct: 84  IRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +                 ++     N     N+ V   
Sbjct: 144 REFTHTEQRVINRMLKLALEGYSDAWKALNPLEVEYVR-SEMQVKFTNITTSPNDIVVNT 202

Query: 185 NMNMTIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     L+       S N+ ++  D   R+     + + 
Sbjct: 203 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELV 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK G V+P         I   +G  + + + G +   Y +RI   
Sbjct: 263 ANFADISLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRIEHL 320

Query: 304 INFDQKSLKNFLHK 317
           IN    SL     K
Sbjct: 321 INPILNSLNEEQPK 334


>gi|311279113|ref|YP_003941344.1| flagellar motor switch protein FliM [Enterobacter cloacae SCF1]
 gi|308748308|gb|ADO48060.1| flagellar motor switch protein FliM [Enterobacter cloacae SCF1]
          Length = 334

 Score =  153 bits (386), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 39/299 (13%), Positives = 97/299 (32%), Gaps = 10/299 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +  P  P    R+  +    + +E I+      ++  L  + +       DI+  + +  
Sbjct: 34  DIRPYDPNTQRRVVRER--LQALEIINERFARQFRMGLFNLLR----RSPDITVGAIRIQ 87

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
            +     +       +   L           S +LV   ++NL G       ++  R  +
Sbjct: 88  PYHEFARNLPVPTNLNLIHLKPLRGTGLFVFSPSLVFIAVDNLFGGDGRFPTKVEGREFT 147

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++  R +       +                 ++     N     N+ V     ++
Sbjct: 148 HTEQRVINRMLKLALEAYSDAWKAINPLEVEYVR-SEMQVKFTNITTSPNDIVVNTPFHV 206

Query: 189 TIENVASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            I N+   F + +P   +     + ++     S ++ ++  +   R+     + +     
Sbjct: 207 EIGNLTGEFNICLPFSMIEPLREVLVNPPLENSRSEDQNWRENLVRQVQHSELELVANFA 266

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                L  ++ L+ G V+P         I   +G  + + + G +   Y +R+   IN 
Sbjct: 267 DISLRLSQILKLQPGDVLPIDKP--DRIIAHVDGVPVLTSQYGTLNGQYALRVEHLINP 323


>gi|291617855|ref|YP_003520597.1| FliM [Pantoea ananatis LMG 20103]
 gi|291152885|gb|ADD77469.1| FliM [Pantoea ananatis LMG 20103]
 gi|327394272|dbj|BAK11694.1| flagellar motor switch protein FliM [Pantoea ananatis AJ13355]
          Length = 335

 Score =  152 bits (385), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 42/306 (13%), Positives = 93/306 (30%), Gaps = 10/306 (3%)

Query: 2   RGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDIS 61
           +      +  P  P    R+  +      I      +   + +         +    DIS
Sbjct: 27  KQNGPEGDIRPYDPNTQRRVVRERLQALEI------INERFARSFRMALFNLLRRSPDIS 80

Query: 62  YTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQ 121
             + +   +     +       +   L        +  S +LV   ++NL G       +
Sbjct: 81  VGAIKIQPYHEFARNLPVPTNLNLIHLKPLRGTALVVFSPSLVFIAVDNLFGGDGRFPTK 140

Query: 122 LYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFV 181
           +  R  +  E+++ +R +       +                 ++     N     N+ V
Sbjct: 141 VEGREFTHTEQRVIRRMLKLALDGYSDAWKAIYPLDVEYVR-SEMQVKFTNITTSPNDIV 199

Query: 182 TTINMNMTIENVASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQLNV 240
                 + I N+   F + IP   +     + ++     S ++     D   ++     +
Sbjct: 200 VNTPFQVEIGNLVGEFNICIPFSMIEPLREMLVNPPLENSRSEDTHWRDNLVKQVQHSEL 259

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            +          L  V+ LK G V+P    E    I   +G  + + + G +   Y +R+
Sbjct: 260 ELIAHFAETSLRLSRVLQLKPGDVLPIEKPE--RIIAHVDGVPVLTSQYGTLNGQYALRV 317

Query: 301 TDRINF 306
              IN 
Sbjct: 318 EHLINP 323


>gi|194434971|ref|ZP_03067214.1| flagellar motor switch protein FliM [Shigella dysenteriae 1012]
 gi|194416806|gb|EDX32932.1| flagellar motor switch protein FliM [Shigella dysenteriae 1012]
          Length = 334

 Score =  152 bits (385), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 43/303 (14%), Positives = 93/303 (30%), Gaps = 10/303 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+  +      I      +   + +         +    DI+  +
Sbjct: 30  SGESDIRPYDPNTQRRVVRERLQALEI------INERFARHFRMGLFNLLRRSPDITVGA 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G       ++  
Sbjct: 84  IRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +                 ++     N     N+ V   
Sbjct: 144 REFTHTEQRVINRMLKLALEGYSDAWKAINPLDVEYVR-SEMQVKFTNITTSPNDIVVNT 202

Query: 185 NMNMTIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     L+       S N+ ++  D   R+     + + 
Sbjct: 203 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELV 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK G V+P         I   +G  + + + G +   Y +RI   
Sbjct: 263 ANFADISLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRIEHL 320

Query: 304 INF 306
           IN 
Sbjct: 321 INP 323


>gi|30063384|ref|NP_837555.1| flagellar motor switch protein FliM [Shigella flexneri 2a str.
           2457T]
 gi|56480007|ref|NP_707830.2| flagellar motor switch protein FliM [Shigella flexneri 2a str. 301]
 gi|30041636|gb|AAP17364.1| flagellar motor switch protein FliM [Shigella flexneri 2a str.
           2457T]
 gi|56383558|gb|AAN43537.2| flagellar motor switch protein FliM [Shigella flexneri 2a str. 301]
 gi|313650167|gb|EFS14580.1| flagellar motor switch protein FliM [Shigella flexneri 2a str.
           2457T]
 gi|332757511|gb|EGJ87846.1| flagellar motor switch protein FliM [Shigella flexneri K-671]
 gi|333017577|gb|EGK36889.1| flagellar motor switch protein FliM [Shigella flexneri K-304]
          Length = 334

 Score =  152 bits (385), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 43/303 (14%), Positives = 93/303 (30%), Gaps = 10/303 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+  +      I      +   + +         +    DI+  +
Sbjct: 30  SGESDIRPYDPNTQRRVVRERLQALEI------INERFARHFRMGLFNLLRRSPDITVGA 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G       ++  
Sbjct: 84  IRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +                 ++     N     N+ V   
Sbjct: 144 REFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVR-SEMQVEFTNITTSPNDIVVNT 202

Query: 185 NMNMTIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     L+       S N+ ++  D   R+     + + 
Sbjct: 203 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELV 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK G V+P         I   +G  + + + G +   Y +RI   
Sbjct: 263 ANFADISLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRIEHL 320

Query: 304 INF 306
           IN 
Sbjct: 321 INP 323


>gi|320182738|gb|EFW57622.1| Flagellar motor switch protein FliM [Shigella boydii ATCC 9905]
          Length = 334

 Score =  152 bits (385), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 43/303 (14%), Positives = 93/303 (30%), Gaps = 10/303 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+  +      I      +   + +         +    DI+  +
Sbjct: 30  SGESDIRPYDPNTQRRVVRERLQALEI------INERFARHFRMGLFNLLRRSPDITVGA 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G       ++  
Sbjct: 84  IRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +                 ++     N     N+ V   
Sbjct: 144 REFTHTEQRVINRMLKLALEGYSDAWKAINPLDVEYVR-SEMQVKFTNITTSPNDIVVNT 202

Query: 185 NMNMTIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     L+       S N+ ++  D   R+     + + 
Sbjct: 203 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELV 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK G V+P         I   +G  + + + G +   Y +RI   
Sbjct: 263 ANFADISLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRIEHL 320

Query: 304 INF 306
           IN 
Sbjct: 321 INP 323


>gi|332756101|gb|EGJ86454.1| flagellar motor switch protein FliM [Shigella flexneri 4343-70]
 gi|332757253|gb|EGJ87590.1| flagellar motor switch protein FliM [Shigella flexneri 2747-71]
 gi|332766683|gb|EGJ96887.1| flagellar motor switch protein FliM [Shigella flexneri 2930-71]
 gi|333003346|gb|EGK22892.1| flagellar motor switch protein FliM [Shigella flexneri K-218]
          Length = 334

 Score =  152 bits (385), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 43/303 (14%), Positives = 93/303 (30%), Gaps = 10/303 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+  +      I      +   + +         +    DI+  +
Sbjct: 30  SGESDIRPYDPNTQRRVVRERLQALEI------INERFARHFRMGLFNLLRRSPDITVGA 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G       ++  
Sbjct: 84  IRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +                 ++     N     N+ V   
Sbjct: 144 REFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVR-SEMQVEFTNITTSPNDIVVNT 202

Query: 185 NMNMTIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     L+       S N+ ++  D   R+     + + 
Sbjct: 203 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELV 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK G V+P         I   +G  + + + G +   Y +RI   
Sbjct: 263 ANFADISLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRIEHL 320

Query: 304 INF 306
           IN 
Sbjct: 321 INP 323


>gi|323968361|gb|EGB63768.1| flagellar motor switch protein FliM [Escherichia coli M863]
 gi|323977874|gb|EGB72960.1| flagellar motor switch protein FliM [Escherichia coli TW10509]
 gi|327253077|gb|EGE64731.1| flagellar motor switch protein FliM [Escherichia coli STEC_7v]
          Length = 334

 Score =  152 bits (385), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 42/299 (14%), Positives = 92/299 (30%), Gaps = 10/299 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +  P  P    R+  +      I      +   + +         +    DI+  + +  
Sbjct: 34  DIRPYDPNTQRRVVRERLQALEI------INERFARHFRMGLFNLLRRSPDITVGAIRIQ 87

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
            +     +       +   L        +  S +LV   ++NL G       ++  R  +
Sbjct: 88  PYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEGREFT 147

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++  R +       +                 ++     N     N+ V     ++
Sbjct: 148 HTEQRVINRMLKLALEGYSDAWKAINPLDVEYVR-SEMQVKFTNITTSPNDIVVNTPFHV 206

Query: 189 TIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            I N+   F + +P   +     L+       S N+ ++  D   R+     + +     
Sbjct: 207 EIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELVANFA 266

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                L  ++ LK G V+P         I   +G  + + + G +   Y +RI   IN 
Sbjct: 267 DISLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRIEHLINP 323


>gi|16760920|ref|NP_456537.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|29141388|ref|NP_804730.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|213424998|ref|ZP_03357748.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213584776|ref|ZP_03366602.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|213855271|ref|ZP_03383511.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|289829468|ref|ZP_06547080.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|25298898|pir||AI0752 flagellar motor switch protein FliM [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16503217|emb|CAD05724.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29137015|gb|AAO68579.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
          Length = 334

 Score =  152 bits (385), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 43/299 (14%), Positives = 97/299 (32%), Gaps = 10/299 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +  P  P    R+  +    + +E I+      ++  L  + +       DI+  + +  
Sbjct: 34  DIRPYDPNTQRRVVRER--LQALEIINERFARQFRMGLFNLLR----RSPDITVGAIRIQ 87

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
            +     +       +   L        +  S +LV   ++NL G       ++  R  +
Sbjct: 88  PYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFITVDNLFGGDGRFPTKVEGREFT 147

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++  R +       +                 ++     N     N+ V     ++
Sbjct: 148 HTEQRVINRMLKLALEGYSDAWKAINPLEVEYVR-SEMQVKFTNITTSPNDIVVNTPFHV 206

Query: 189 TIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            I N+   F + +P   +     L+       S ++ ++  D   R+     + +     
Sbjct: 207 EIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRHEDQNWRDNLVRQVQHSELELVANFA 266

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                L  ++ LK G V+P         I   +G  + + + G V   Y +R+   IN 
Sbjct: 267 DIPLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTVNGQYALRVEHLINP 323


>gi|218662604|ref|ZP_03518534.1| flagellar C-ring motor switch protein [Rhizobium etli IE4771]
          Length = 169

 Score =  152 bits (385), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 50/173 (28%), Positives = 78/173 (45%), Gaps = 5/173 (2%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           M       +   + P LLA+LTG LGD+  + KI S+ G +Y +F P + K +  LDV +
Sbjct: 1   MTMSDASHDKPAMDPALLAKLTGGLGDRGRVSKICSAFGEVYSEFFPDVIKGETGLDVTV 60

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           +Y  C+ G  +H+I     N     A+L +WS N  + C N  VITL+            
Sbjct: 61  NYLGCEIGYKNHLIDDLSANVTLVDATLRNWSQNVTLACGNGFVITLMGAPARRHRRYDR 120

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQES-SPNLEDFYDIDYLKKN 172
           +  +R LS +E  LA     +I+     C +  Q +     E F    +  + 
Sbjct: 121 EPADRLLSIIELDLAVMVFDKIAK----CCARGQRARRFRTEPFAPHAHDARP 169


>gi|161502902|ref|YP_001570014.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160864249|gb|ABX20872.1| hypothetical protein SARI_00961 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 334

 Score =  152 bits (385), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 43/299 (14%), Positives = 97/299 (32%), Gaps = 10/299 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +  P  P    R+  +    + +E I+      ++  L  + +       DI+  + +  
Sbjct: 34  DIRPYDPNTQRRVVRER--LQALEIINERFARQFRMGLFNLLR----RSPDITVGAIRIQ 87

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
            +     +       +   L        +  S +LV   ++NL G       ++  R  +
Sbjct: 88  PYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEGREFT 147

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++  R +       +                 ++     N     N+ V     ++
Sbjct: 148 HTEQRVINRMLKLALEGYSDAWKAINPLEVEYVR-SEMQVKFTNITTSPNDIVVNTPFHV 206

Query: 189 TIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            I N+   F + +P   +     L+       S ++ ++  D   R+     + +     
Sbjct: 207 EIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRHEDQNWRDNLVRQVQHSELELVANFA 266

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                L  ++ LK G V+P         I   +G  + + + G V   Y +R+   IN 
Sbjct: 267 DIPLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTVNGQYALRVEHLINP 323


>gi|16765314|ref|NP_460929.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|62180551|ref|YP_216968.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161613455|ref|YP_001587420.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167552791|ref|ZP_02346542.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|167993551|ref|ZP_02574645.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168234149|ref|ZP_02659207.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168239216|ref|ZP_02664274.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|168244827|ref|ZP_02669759.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|168259737|ref|ZP_02681710.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|168462482|ref|ZP_02696413.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|168823019|ref|ZP_02835019.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|194444199|ref|YP_002041241.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194451006|ref|YP_002046027.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194737897|ref|YP_002115010.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197249640|ref|YP_002146047.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197265099|ref|ZP_03165173.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|198245200|ref|YP_002215110.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|200389660|ref|ZP_03216271.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204931068|ref|ZP_03221894.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205352330|ref|YP_002226131.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|207856511|ref|YP_002243162.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|224583525|ref|YP_002637323.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|238912451|ref|ZP_04656288.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|120346|sp|P26418|FLIM_SALTY RecName: Full=Flagellar motor switch protein FliM
 gi|154035|gb|AAA27104.1| fliM flagellar switch protein [Salmonella enterica subsp. enterica
           serovar Typhimurium]
 gi|16420511|gb|AAL20888.1| flagellar biosynthesis protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|62128184|gb|AAX65887.1| flagellar biosynthesis, component of motor switch and energizing
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|161362819|gb|ABX66587.1| hypothetical protein SPAB_01172 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194402862|gb|ACF63084.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194409310|gb|ACF69529.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194713399|gb|ACF92620.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195634275|gb|EDX52627.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197213343|gb|ACH50740.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197243354|gb|EDY25974.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197288083|gb|EDY27470.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|197939716|gb|ACH77049.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|199602105|gb|EDZ00651.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204320112|gb|EDZ05317.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205272111|emb|CAR36964.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|205322661|gb|EDZ10500.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205328413|gb|EDZ15177.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205331867|gb|EDZ18631.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205336350|gb|EDZ23114.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205340670|gb|EDZ27434.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205350615|gb|EDZ37246.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|206708314|emb|CAR32617.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|224468052|gb|ACN45882.1| flagellar motor switch protein [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|261247142|emb|CBG24965.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267993965|gb|ACY88850.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301158490|emb|CBW18000.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312912966|dbj|BAJ36940.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|320085405|emb|CBY95186.1| Flagellar motor switch protein fliM [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|321224621|gb|EFX49684.1| Flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322616969|gb|EFY13877.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322618208|gb|EFY15100.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322625879|gb|EFY22698.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322626331|gb|EFY23141.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322632746|gb|EFY29491.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322639088|gb|EFY35781.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322640404|gb|EFY37060.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322647235|gb|EFY43734.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322649917|gb|EFY46338.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322655525|gb|EFY51833.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322660303|gb|EFY56541.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322662984|gb|EFY59191.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322668169|gb|EFY64328.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674072|gb|EFY70166.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322675576|gb|EFY71650.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322683013|gb|EFY79029.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322686707|gb|EFY82685.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|322715027|gb|EFZ06598.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
 gi|323130255|gb|ADX17685.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|323195405|gb|EFZ80585.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323198067|gb|EFZ83184.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323204461|gb|EFZ89467.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323207551|gb|EFZ92499.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323211010|gb|EFZ95870.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323217536|gb|EGA02255.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323220731|gb|EGA05175.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323226682|gb|EGA10879.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323231558|gb|EGA15671.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323236001|gb|EGA20080.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323240571|gb|EGA24614.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323245463|gb|EGA29463.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323247581|gb|EGA31532.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323253956|gb|EGA37780.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323255516|gb|EGA39277.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323262114|gb|EGA45677.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323266237|gb|EGA49727.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323270654|gb|EGA54095.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|326622858|gb|EGE29203.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326627380|gb|EGE33723.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
 gi|332988865|gb|AEF07848.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 334

 Score =  152 bits (385), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 43/299 (14%), Positives = 97/299 (32%), Gaps = 10/299 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +  P  P    R+  +    + +E I+      ++  L  + +       DI+  + +  
Sbjct: 34  DIRPYDPNTQRRVVRER--LQALEIINERFARQFRMGLFNLLR----RSPDITVGAIRIQ 87

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
            +     +       +   L        +  S +LV   ++NL G       ++  R  +
Sbjct: 88  PYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEGREFT 147

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++  R +       +                 ++     N     N+ V     ++
Sbjct: 148 HTEQRVINRMLKLALEGYSDAWKAINPLEVEYVR-SEMQVKFTNITTSPNDIVVNTPFHV 206

Query: 189 TIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            I N+   F + +P   +     L+       S ++ ++  D   R+     + +     
Sbjct: 207 EIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRHEDQNWRDNLVRQVQHSELELVANFA 266

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                L  ++ LK G V+P         I   +G  + + + G V   Y +R+   IN 
Sbjct: 267 DIPLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTVNGQYALRVEHLINP 323


>gi|260222423|emb|CBA31972.1| Flagellar motor switch protein fliM [Curvibacter putative symbiont
           of Hydra magnipapillata]
          Length = 334

 Score =  152 bits (385), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 45/276 (16%), Positives = 95/276 (34%), Gaps = 6/276 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + + L       +    +IS       ++S  +        F+  ++     +  + C
Sbjct: 59  ERFARNLRVGLFNFIRRSPEISVGPVVVQRYSAFLRELAVPTNFNIVAIRPLRGSGLVVC 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV  +++ L G   +   ++  R  S  E+++  R +  I+    +           
Sbjct: 119 EPALVFGVIDTLYGGIGKFQTRIEGRDFSATEQRVINRLVDVITTEYKKAWKGIYPLELE 178

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QN 218
            +   ++     N     +E V + +  + I ++  +     P  TL     +  SS Q 
Sbjct: 179 YQR-SEMQPQFANI-ATPSEIVISTSFQLEIGDITGAIHFSFPYSTLEPIRDVLYSSTQG 236

Query: 219 KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
            S       ++   R+     V I   +     T++ ++ +K G  I      +  A + 
Sbjct: 237 DSIEVDRRWVNVLTREIQAAEVTIVAELARADATVEQLLGMKKGDFIELDRAPRIQATV- 295

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRI-NFDQKSLKN 313
            +G  I+ C+ G     Y IRI   +   DQ  L  
Sbjct: 296 -DGVPIFECQYGTHNSKYAIRIEKALRGNDQNWLGE 330


>gi|15802380|ref|NP_288406.1| flagellar motor switch protein FliM [Escherichia coli O157:H7
           EDL933]
 gi|12516052|gb|AAG56960.1|AE005417_2 flagellar biosynthesis, component of motor switch and energizing,
           enabling rotation and determining its direction
           [Escherichia coli O157:H7 str. EDL933]
          Length = 334

 Score =  152 bits (384), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 46/314 (14%), Positives = 95/314 (30%), Gaps = 10/314 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+  +      I      +   + +         +    DI+   
Sbjct: 30  SGESDIRPYDPNTQRRVVRERLQALEI------INERFARHFRMGLFNLLRRSPDITVGX 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G       ++  
Sbjct: 84  IRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +                 ++     N     N+ V   
Sbjct: 144 REFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVR-SEMQVKFTNITTSPNDIVVNT 202

Query: 185 NMNMTIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     L+       S N+ ++  D   R+     + + 
Sbjct: 203 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELV 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK G V+P         I   +G  + + + G +   Y +RI   
Sbjct: 263 ANFADISLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRIEHL 320

Query: 304 INFDQKSLKNFLHK 317
           IN    SL     K
Sbjct: 321 INPILNSLNEEQPK 334


>gi|301029402|ref|ZP_07192496.1| flagellar motor switch protein FliM [Escherichia coli MS 196-1]
 gi|299877706|gb|EFI85917.1| flagellar motor switch protein FliM [Escherichia coli MS 196-1]
          Length = 334

 Score =  152 bits (384), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 46/314 (14%), Positives = 96/314 (30%), Gaps = 10/314 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+  +      I      +   + +         +    DI+  +
Sbjct: 30  SGESDIRPYDPNTQRRVVRERLQALEI------INERFARHFRMGLFNLLRRSPDITVGA 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G       ++  
Sbjct: 84  IRIQPYHEFARNLPVPTNLNLIHLKQLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +                 ++     N     N+ V   
Sbjct: 144 REFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVR-SEMQVKFTNITTSPNDIVVNT 202

Query: 185 NMNMTIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     L+       S N+ ++  D   R+     + + 
Sbjct: 203 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELV 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK G V+P         I   +G  + + + G +   Y +RI   
Sbjct: 263 ANFADISLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRIEHL 320

Query: 304 INFDQKSLKNFLHK 317
           IN    SL     K
Sbjct: 321 INPILNSLNEEQPK 334


>gi|238755314|ref|ZP_04616657.1| Flagellar motor switch protein fliM [Yersinia ruckeri ATCC 29473]
 gi|238706450|gb|EEP98824.1| Flagellar motor switch protein fliM [Yersinia ruckeri ATCC 29473]
          Length = 334

 Score =  152 bits (384), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 39/300 (13%), Positives = 90/300 (30%), Gaps = 12/300 (4%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +  P  P    R+  +      I      +   + +         +    DI+    +  
Sbjct: 33  DVKPYDPTTQRRVVRERLHALEI------INERFARHFRMGLFNLLRRSPDITVGPIKIQ 86

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
            +     +       +   L             +LV   ++NL G       ++  R  +
Sbjct: 87  PYHEFARNLPVPTNLNLVHLKPLRGTALFVFEPSLVFIAVDNLFGGDGRFPTKVEGREFT 146

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++  R +               +         +I     N     N+ V T   ++
Sbjct: 147 HTEQRVITRMLRLALDAYRDAWGAIYKIDVEYVR-SEIQVKFTNITTSPNDIVVTTPFHV 205

Query: 189 TIENVASSFVLIIPQETLLKTTLISLS--SQNKSENQSEDLIDPFARKTYQLNVNIDTRI 246
            I  ++  F + IP   +++     L+      S  +  +  +   ++     + +    
Sbjct: 206 EIGALSGEFNICIPFA-MIEPLRELLTNPPLENSRQEDSNWRETLVKQVQHSELELVANF 264

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                 L  ++ LK G V+P         I   +G  + + + G +   Y +R+   IN 
Sbjct: 265 AEIPLRLSQILKLKPGDVLPIDKP--DRLIAHVDGVPVLTSQYGTLNGQYALRVEHLINP 322


>gi|333003041|gb|EGK22595.1| flagellar motor switch protein FliM [Shigella flexneri VA-6]
          Length = 334

 Score =  152 bits (383), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 42/303 (13%), Positives = 93/303 (30%), Gaps = 10/303 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+  +      I      +   + +         +    DI+  +
Sbjct: 30  SGESDIRPYDPNTQRRVVRERLQALEI------INERFARHFRMGLFNLLRRSPDITVGA 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G       ++  
Sbjct: 84  IRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +                 ++     N     N+ V   
Sbjct: 144 REFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVR-SEMQVEFTNITTSPNDIVVNT 202

Query: 185 NMNMTIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     L+       S N+ ++  D   R+     + + 
Sbjct: 203 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELV 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK G ++P         I   +G  + + + G +   Y +RI   
Sbjct: 263 ANFADISLRLSQILKLKPGDILPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRIEHL 320

Query: 304 INF 306
           IN 
Sbjct: 321 INP 323


>gi|317492415|ref|ZP_07950844.1| flagellar motor switch protein FliM [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316919754|gb|EFV41084.1| flagellar motor switch protein FliM [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 337

 Score =  152 bits (383), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 45/299 (15%), Positives = 105/299 (35%), Gaps = 10/299 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +  P  P    R+  +    + +E I+      ++  L  + +       DI+  + +  
Sbjct: 36  DVRPYDPTTQRRVVRER--LQALEIINERFARQFRMGLFNLLR----RSPDITVGAVKIQ 89

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
            +     +       +   L+       +  + +LV   ++NL G       ++  R  +
Sbjct: 90  PYHEFARNLPVPTNLNLIHLNPLRGTALMVFAPSLVFMAVDNLFGGDGRFPTKVDGREFT 149

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++ KR +           S   +         +I     N     N+ V T    +
Sbjct: 150 HTEQRVIKRMLRLALDAYRDAWSAIYKLEVEYVR-SEIQVKFTNITTSPNDIVVTTPFTV 208

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSED-LIDPFARKTYQLNVNIDTRIN 247
            +  ++  F + IP   +     + ++   ++  Q +    D  +++     + +     
Sbjct: 209 EVGALSGEFNICIPFSMIEPLRELLVNPPLENSKQEDQHWRDTLSKQVQHSELELVANFV 268

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                L +V+ L+ G V+P    EK   I + +G  + +C+ G     Y +R+   IN 
Sbjct: 269 DIPLRLSEVLKLQPGDVLPIEKPEK--LIANVDGVPVLTCQYGSQNGQYALRVERLINP 325


>gi|146312182|ref|YP_001177256.1| flagellar motor switch protein FliM [Enterobacter sp. 638]
 gi|145319058|gb|ABP61205.1| flagellar motor switch protein FliM [Enterobacter sp. 638]
          Length = 334

 Score =  152 bits (383), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 43/311 (13%), Positives = 98/311 (31%), Gaps = 10/311 (3%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
               P  P    R+  +    + +E I+      ++  L  + +       DI+  + + 
Sbjct: 33  PEIRPYDPNTQRRVVRER--LQALEIINERFARQFRMGLFNLLR----RSPDITVGAIRI 86

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSL 127
             +     +       +   L           S +LV   ++NL G       ++  R  
Sbjct: 87  QPYHEFARNLPVPTNLNLIHLKPLRGTGLFVFSPSLVFIAVDNLFGGDGRFPTKVEGREF 146

Query: 128 STVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMN 187
           +  E+++  R +       +                 ++     N     N+ V     +
Sbjct: 147 THTEQRVINRMLKLALESYSDAWKAIHPLEVEYVR-SEMQVKFTNITTSPNDIVVNTPFH 205

Query: 188 MTIENVASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQLNVNIDTRI 246
           + I N+   F + +P   +     + ++     S N+ ++  +   R+     + +    
Sbjct: 206 VEIGNLTGEFNICLPFSMIEPLREVLVNPPLENSRNEDQNWRENLVRQVQHSQLELVASF 265

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                 L  ++ L+ G V+P         I   +   + + + G V   Y +R+   IN 
Sbjct: 266 ADIPLRLSQILKLQPGDVLPIEKP--DRIIAHVDDVPVLTSQYGTVNGQYALRVEHLINP 323

Query: 307 DQKSLKNFLHK 317
              SL     K
Sbjct: 324 ILNSLNEEQPK 334


>gi|299534775|ref|ZP_07048105.1| flagellar motor switch protein FliM [Lysinibacillus fusiformis ZC1]
 gi|298729863|gb|EFI70408.1| flagellar motor switch protein FliM [Lysinibacillus fusiformis ZC1]
          Length = 331

 Score =  152 bits (383), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 51/285 (17%), Positives = 111/285 (38%), Gaps = 13/285 (4%)

Query: 29  KTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASL 88
           +++ +I  +   L   F    F  ++   V I+  S     F   + S     + +   +
Sbjct: 54  RSLTRIHENFARLLTTF----FSAQLRSYVQITVASVDQIPFEEFVRSIPNMTLINVFEV 109

Query: 89  SSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQ 148
                N  +  + N+  ++L+ L+G S  +   + N  L+ +E K+      +    L +
Sbjct: 110 PPLDGNILMEINPNIAYSMLDRLMGGSGASHSNVDN--LTEIETKIMTNLFERSFDNLRE 167

Query: 149 CISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLK 208
                 E  P L +        +  +   NE V  I++N  I   +    + IP   +L+
Sbjct: 168 AWENVAEIDPILVELEVNPQFLQMIS--PNETVVVISLNTIIGETSGMINICIPH-VVLE 224

Query: 209 TTLISLS----SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
             + +LS     Q  ++  S +       +  Q  + +   + L   T++D +T+++G V
Sbjct: 225 PIVPNLSVRYWMQTNTKEMSPEQTKMLETRVKQAQLPLSVELGLTDITIEDFLTMQVGDV 284

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
           I    + +   +L       ++ + G+ GK   I+I D +    +
Sbjct: 285 IQLDQKIEAPLLLKVGTLPKFTVQPGKKGKKLAIQIIDPLKGGDE 329


>gi|300717238|ref|YP_003742041.1| flagellar motor switch protein [Erwinia billingiae Eb661]
 gi|299063074|emb|CAX60194.1| Flagellar motor switch protein [Erwinia billingiae Eb661]
          Length = 335

 Score =  152 bits (383), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 43/300 (14%), Positives = 100/300 (33%), Gaps = 12/300 (4%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +  P  P    R+  +    + +E I+      Y+  L  + +       DI+  + +  
Sbjct: 34  DIRPYDPNTQRRMVRER--LQALEIINERFARSYRMALFNLLR----RSPDITVGAIKIQ 87

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
            +     +       +   L        +  S +LV   ++NL G       ++  R  +
Sbjct: 88  PYHEFARNLPVPTNLNLIHLKPLRGTALVVFSPSLVFIAVDNLFGGDGRFPTKVEGREFT 147

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++ +R +       ++                ++     N     N+ V T    +
Sbjct: 148 ATEQRVIRRMLKLALEGYSEAWKPIYPLDVEYVR-SEMQVKFTNITTSPNDIVITTPFQV 206

Query: 189 TIENVASSFVLIIPQETLLKTTLISLS--SQNKSENQSEDLIDPFARKTYQLNVNIDTRI 246
            I N+   F + IP   +++    +L       S  + ++  D   ++     + +    
Sbjct: 207 EIGNLVGEFNICIPFS-MIEPLRETLVNPPLENSRQEDQNWRDTLVKQVQHSELELIANF 265

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                 +  ++ LK G V+P         I   +G  + + + G +   Y +R+   IN 
Sbjct: 266 GEVSMRISRLLALKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRVEHLINP 323


>gi|56413111|ref|YP_150186.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197362037|ref|YP_002141674.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|56127368|gb|AAV76874.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197093514|emb|CAR58975.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
          Length = 334

 Score =  151 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 43/299 (14%), Positives = 97/299 (32%), Gaps = 10/299 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +  P  P    R+  +    + +E I+      ++  L  + +       DI+  + +  
Sbjct: 34  DIRPYDPNTQRRVVRER--LQALEIINERFARQFRMGLFNLLR----RSPDITVGTIRIQ 87

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
            +     +       +   L        +  S +LV   ++NL G       ++  R  +
Sbjct: 88  PYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEGREFT 147

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++  R +       +                 ++     N     N+ V     ++
Sbjct: 148 HTEQRVINRMLKLALEGYSDAWKAINPLEVEYVR-SEMQVKFTNITTSPNDIVVNTPFHV 206

Query: 189 TIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            I N+   F + +P   +     L+       S ++ ++  D   R+     + +     
Sbjct: 207 EIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRHEDQNWRDNLVRQVQHSELELVANFA 266

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                L  ++ LK G V+P         I   +G  + + + G V   Y +R+   IN 
Sbjct: 267 DIPLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTVNGQYALRVEHLINP 323


>gi|283781536|ref|YP_003372291.1| flagellar motor switch protein FliM [Pirellula staleyi DSM 6068]
 gi|283439989|gb|ADB18431.1| flagellar motor switch protein FliM [Pirellula staleyi DSM 6068]
          Length = 362

 Score =  151 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 49/304 (16%), Positives = 106/304 (34%), Gaps = 14/304 (4%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
              +  +P       R+       + ++ +    G  +   L  + +      V++  TS
Sbjct: 44  RTREKVTPYDFKRPERV--GKEQMRALQSLHEGFGRNFGAALSALLRSI----VEVKLTS 97

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
                +S  + S +    F+         N  +  + +++  +++ LLG   E  P    
Sbjct: 98  VDQLTYSEFVFSLENPTCFNLLRAEPLEGNLILDINPSILYPIIDRLLGGGKEAGPV-AR 156

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R L+ +E +L  R        L            +++       L +      NE V  I
Sbjct: 157 RPLTEIELRLVSRITHLFLQELKHAWEGVLPLKLSVDRVESNPQLVQIV--PPNEVVVLI 214

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSE----NQSEDLIDPFARKTYQLNV 240
           +  +T+ +V     L IP  ++ +     L+S N         +   I   +++  Q  V
Sbjct: 215 SFELTLNDVRGMINLCIPFNSIER-IGSKLTSNNWVAYGKGGATPQSIAQISKRLDQSKV 273

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            +   +     T  D++ L++G +I      +T   ++  G   +    G +  +  +RI
Sbjct: 274 ELVVTLAETTITTGDMIGLRVGDIITTDKDIRTPLEIAVQGMAKFQASCGALKGHKAVRI 333

Query: 301 TDRI 304
              I
Sbjct: 334 EQSI 337


>gi|307718611|ref|YP_003874143.1| hypothetical protein STHERM_c09230 [Spirochaeta thermophila DSM
           6192]
 gi|306532336|gb|ADN01870.1| hypothetical protein STHERM_c09230 [Spirochaeta thermophila DSM
           6192]
 gi|315186376|gb|EFU20136.1| flagellar motor switch protein FliM [Spirochaeta thermophila DSM
           6578]
          Length = 341

 Score =  151 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 44/285 (15%), Positives = 100/285 (35%), Gaps = 11/285 (3%)

Query: 29  KTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASL 88
           +TI  +  +   L    L    +      V +   S     +   I S          ++
Sbjct: 53  RTISIMHETFARLTTTSLSAQLRSL----VQVHVASVDQLTYEEFIRSIPNPTTIGIINM 108

Query: 89  SSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQ 148
                +  +     +  ++++ L G   +      +R LS +E  + +  + +I   + +
Sbjct: 109 DPLKGSAILEIDPTITYSIIDRLFGGPGDGSVVPRDRDLSDIETTVMEGIMVRILGNMRE 168

Query: 149 CISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLK 208
             S   +  P L          +       E V  + +   + +V       IP  T ++
Sbjct: 169 AWSQVIDLRPRLGQIDTNPQFAQIV--PPTEMVVLVTLETKVGDVEGMMNFCIPYLT-IE 225

Query: 209 TTLISLSSQNKSENQSEDLIDP----FARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
             +  LS+Q    +  +            +   + VN+   +      ++D+++++ G V
Sbjct: 226 PIISKLSAQYWYSSVRKGGTTENLAILKERISSVEVNLVVEVGSMNLKMRDILSIQKGDV 285

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
           I    R K   +L    +  + C  GRVGK   +++ ++I   Q+
Sbjct: 286 IMLPTRVKEPLVLKIENRPKFYCRPGRVGKKLAVQLVEKIEESQE 330


>gi|194471387|ref|ZP_03077371.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194457751|gb|EDX46590.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
          Length = 334

 Score =  151 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 43/299 (14%), Positives = 98/299 (32%), Gaps = 10/299 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +  P  P    R+  +    + +E I+      ++  L  + +       DI+  + +  
Sbjct: 34  DIRPYDPNTQRRVVRER--LQALEIINERFARQFRMGLFNLLR----RSPDITVGAIRIQ 87

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
            +     +       +   L        +  S +LV   ++NL G       ++  R  +
Sbjct: 88  PYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEGREFT 147

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++  R +       +                 ++     N     N+ V     ++
Sbjct: 148 HTEQRVINRMLKLALEGYSDAWKAINPLEVEYVR-SEMQVKFTNITTSPNDIVVNTPFHV 206

Query: 189 TIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            I N+   F + +P   +     L+       S ++ ++  D   R+     + +     
Sbjct: 207 EIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRHEDQNWRDNLVRQVQHSELELVANFA 266

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                L  ++ LK G V+P         I   +G  + + + G V   Y++R+   IN 
Sbjct: 267 DIPLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTVNGQYSLRVEHLINP 323


>gi|261340410|ref|ZP_05968268.1| flagellar motor switch protein FliM [Enterobacter cancerogenus ATCC
           35316]
 gi|288317502|gb|EFC56440.1| flagellar motor switch protein FliM [Enterobacter cancerogenus ATCC
           35316]
          Length = 334

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 41/299 (13%), Positives = 97/299 (32%), Gaps = 10/299 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           N  P  P    R+  +    + +E I+      ++  L  + +       DI+  + +  
Sbjct: 34  NIRPYDPNTQRRVVRER--LQALEIINERFARQFRMGLFNLLR----RSPDITVGAIRIQ 87

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
            +     +       +   L        +  S +LV   ++NL G       ++  R  +
Sbjct: 88  PYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEGREFT 147

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++  R +       +                 ++     N     N+ V     ++
Sbjct: 148 HTEQRVINRMLKLALESYSDAWKAINPLEVEYVR-SEMQVKFTNITTSPNDIVVNTPFHV 206

Query: 189 TIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            I N+   F + +P   +     L+       S ++ ++  +   R+     + +     
Sbjct: 207 EIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRHEDQNWRENLVRQVQHSQLELVANFA 266

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                L  ++ L+ G V+P         I   +G  + + + G +   Y +R+   IN 
Sbjct: 267 DVSMRLSQILKLQPGDVLPIDKP--DRIIAHVDGVPVLTSQYGTINGQYALRVEHLINP 323


>gi|74312485|ref|YP_310904.1| flagellar motor switch protein FliM [Shigella sonnei Ss046]
 gi|73855962|gb|AAZ88669.1| flagellar motor switch protein FliM [Shigella sonnei Ss046]
 gi|323168934|gb|EFZ54614.1| flagellar motor switch protein FliM [Shigella sonnei 53G]
          Length = 334

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 46/314 (14%), Positives = 97/314 (30%), Gaps = 10/314 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+  +      I      +   + +         +    DI+  +
Sbjct: 30  SGESDIRPYDPNTQRRVVRERLQALEI------INERFARHFRMGLFNLLRRSPDITVGA 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G +     ++  
Sbjct: 84  IRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGNGRFPTKVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +                 ++     N     N+ V   
Sbjct: 144 REFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVR-SEMQVKFTNITTSPNDIVVNT 202

Query: 185 NMNMTIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     L+       S N+ ++  D   R+     + + 
Sbjct: 203 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELV 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK G V+P         I   +G  + + + G +   Y +RI   
Sbjct: 263 ANFADISLRLSQILKLKPGDVLPIEKP--DGIIAHVDGVPVLTSQYGTLNGQYALRIEHL 320

Query: 304 INFDQKSLKNFLHK 317
           IN    SL     K
Sbjct: 321 INPILNSLNEEQPK 334


>gi|329298601|ref|ZP_08255937.1| flagellar motor switch protein FliM [Plautia stali symbiont]
          Length = 269

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 37/254 (14%), Positives = 81/254 (31%), Gaps = 4/254 (1%)

Query: 54  MDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLG 113
           +    DIS  + +   +     +       +   L        +  S +LV   ++NL G
Sbjct: 7   LRRSPDISVGAIKIQPYHEFARNLPVPTNLNLIHLQPLRGTALVVFSPSLVFIAVDNLFG 66

Query: 114 ASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNT 173
                  ++  R  +  E+++ +R +       +                 ++     N 
Sbjct: 67  GDGRFPTKVEGREFTHTEQRVIRRMLKLALEGYSDAWKAIYPLEVEYVR-SEMQVKFINI 125

Query: 174 NRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFA 232
               N+ V      + I N+   F + IP   +     L+       S  +     D   
Sbjct: 126 TTSPNDIVVNTPFQVEIGNLVGEFNICIPFSMIEPLRELLVNPPLENSRQEDNHWRDNLV 185

Query: 233 RKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRV 292
           ++     + +          L  ++ LK+G V+P         I   +G  + + + G +
Sbjct: 186 KQVQHSELELIAHFAETSLRLSRILQLKLGDVLPIEKP--DRIIAHVDGVPVLTSQYGTL 243

Query: 293 GKNYTIRITDRINF 306
              Y +R+  +IN 
Sbjct: 244 NGQYALRVEHQINP 257


>gi|283785715|ref|YP_003365580.1| flagellar motor switch protein FliM [Citrobacter rodentium ICC168]
 gi|282949169|emb|CBG88777.1| flagellar motor switch protein FliM [Citrobacter rodentium ICC168]
          Length = 334

 Score =  151 bits (381), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 41/299 (13%), Positives = 98/299 (32%), Gaps = 10/299 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +  P  P    R+  +    + +E I+      ++  L  + +       DI+  + +  
Sbjct: 34  DIRPYDPNTQRRVVRER--LQALEIINERFARQFRMGLFNLLR----RSPDITVGAIRIQ 87

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
            +     +       +   L        +  S +LV   ++NL G       ++  R  +
Sbjct: 88  PYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEGREFT 147

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++  R +       +                 ++     N     N+ V     ++
Sbjct: 148 HTEQRVINRMLKLALEGYSDAWKAINPLEVEYVR-SEMQVKFTNITTSPNDIVVNTPFHV 206

Query: 189 TIENVASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            I N+   F + +P   +     + ++     S ++ ++  D   R+     + +     
Sbjct: 207 EIGNLTGEFNICLPFSMIEPLREMLVNPPLENSRHEDQNWRDNLVRQVQHSELELVANFA 266

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                L  ++ L+ G V+P         I   +G  + + + G V   Y +R+   IN 
Sbjct: 267 DIPLRLSQILKLQPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTVNGQYALRVEHLINP 323


>gi|42524697|ref|NP_970077.1| flagellar motor switch protein FliM [Bdellovibrio bacteriovorus
           HD100]
 gi|39576907|emb|CAE78136.1| flagellar motor switch protein FliM [Bdellovibrio bacteriovorus
           HD100]
          Length = 333

 Score =  151 bits (381), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 32/269 (11%), Positives = 89/269 (33%), Gaps = 4/269 (1%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + +         +     I+ TS +  KF   I++       S     +   +     
Sbjct: 67  EKFMRAFRVSLSSALRKIASITLTSTEFLKFGEFINTLPMPTCMSVLRFGNLRGSALFVI 126

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
            + L   L+++  G +     ++  +  + +E  + ++ +      +    ++ ++   +
Sbjct: 127 ESKLAYALVDSFFGGADRPYTKIDGKDFTPIELSIVQKVVGLAINDMEMAWASIEKIGCS 186

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
                              + V     ++ +EN   +  ++IP  T+  +K  L +    
Sbjct: 187 FVRTEVNPQFVGIV--PPTDVVIASTFDVELENATGTISIVIPYATIEPIKQKLQTGFQV 244

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
              +   +        +  + ++ I   +   +  LKD++ LK+G VIP          +
Sbjct: 245 ETDQTDKKLWTAIIQEQLLETDMEIKVNLGETEIKLKDLMNLKVGDVIPLDQDASGEFDV 304

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINF 306
           +  G   +    G       +++T  +  
Sbjct: 305 AVEGVRKFKGYYGIHHGTVAVQVTRPVEK 333


>gi|295098287|emb|CBK87377.1| flagellar motor switch protein FliM [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 334

 Score =  150 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 44/310 (14%), Positives = 100/310 (32%), Gaps = 10/310 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           N  P  P    R+  +    + +E I+      ++  L  + +       DI+  + +  
Sbjct: 34  NIRPYDPNTQRRVVRER--LQALEIINERFARQFRMGLFNLLR----RSPDITVGAIRIQ 87

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
            +     +       +   L        +  S +LV   ++NL G       ++  R  +
Sbjct: 88  PYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEGREFT 147

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++  R +       +                 ++     N     N+ V     ++
Sbjct: 148 HTEQRVINRMLKLALESYSDAWKAINPLEVEYVR-SEMQVKFTNITTSPNDIVVNTPFHV 206

Query: 189 TIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            I N+   F + +P   +     L+       S ++ ++  +   R+     + +     
Sbjct: 207 EIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRHEDQNWRENLVRQVQHSQLELVANFA 266

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
                L  ++ L+ G V+P         I   +G  + + + G +   Y +R+   IN  
Sbjct: 267 DISMRLSQILKLQPGDVLPIDKP--DRIIAHVDGVPVLTSQYGTINGQYALRVEHLINPI 324

Query: 308 QKSLKNFLHK 317
             SL     K
Sbjct: 325 LNSLNEEQPK 334


>gi|294636877|ref|ZP_06715207.1| flagellar motor switch protein FliM [Edwardsiella tarda ATCC 23685]
 gi|291089907|gb|EFE22468.1| flagellar motor switch protein FliM [Edwardsiella tarda ATCC 23685]
          Length = 337

 Score =  150 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 36/268 (13%), Positives = 88/268 (32%), Gaps = 4/268 (1%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + +         +    DI+  + +   +     +       +   L        +  
Sbjct: 61  ERFARQFRMGLFNLLRRSPDITVGAVRIQPYHEFARNLPVPTNLNLVHLKPLRGTALMVF 120

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
             +LV   ++NL G       ++  R  +  E+++ +R +               +    
Sbjct: 121 EPSLVFMAVDNLFGGDGRFPTKVDGREFTHTEQRVIQRMLRLALDAYRDAWGAIFKLEVE 180

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK 219
                +I     N     N+ V T    + +  ++  F + IP   +     + ++   +
Sbjct: 181 YVR-SEIQVKFTNITTSPNDIVVTTPFTVEVGALSGEFNICIPFSMIEPLRELLVNPPLE 239

Query: 220 SENQSED-LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILS 278
           +  Q +    D  +++     + +          L DV+ L++G V+P         I +
Sbjct: 240 NSKQEDQHWRDTLSKQVQHSELELVANFVDIPLRLSDVLKLQVGDVLPIDRP--DRLIAN 297

Query: 279 ANGKEIYSCELGRVGKNYTIRITDRINF 306
            +G  + +C+ G     Y +R+   IN 
Sbjct: 298 VDGVPVLTCQYGCYHGQYALRVEKMINP 325


>gi|16129892|ref|NP_416455.1| flagellar motor switching and energizing component [Escherichia
           coli str. K-12 substr. MG1655]
 gi|89108777|ref|AP_002557.1| flagellar motor switching and energizing component [Escherichia
           coli str. K-12 substr. W3110]
 gi|170081589|ref|YP_001730909.1| flagellar motor switching and energizing component [Escherichia
           coli str. K-12 substr. DH10B]
 gi|238901150|ref|YP_002926946.1| flagellar motor switching and energizing component [Escherichia
           coli BW2952]
 gi|253773106|ref|YP_003035937.1| flagellar motor switch protein FliM [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|120345|sp|P06974|FLIM_ECOLI RecName: Full=Flagellar motor switch protein FliM
 gi|145981|gb|AAA23786.1| FlaAII protein [Escherichia coli]
 gi|1736611|dbj|BAA15770.1| flagellar motor switching and energizing component [Escherichia
           coli str. K12 substr. W3110]
 gi|1788255|gb|AAC75012.1| flagellar motor switching and energizing component [Escherichia
           coli str. K-12 substr. MG1655]
 gi|169889424|gb|ACB03131.1| flagellar motor switching and energizing component [Escherichia
           coli str. K-12 substr. DH10B]
 gi|238861113|gb|ACR63111.1| flagellar motor switching and energizing component [Escherichia
           coli BW2952]
 gi|253324150|gb|ACT28752.1| flagellar motor switch protein FliM [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|260448942|gb|ACX39364.1| flagellar motor switch protein FliM [Escherichia coli DH1]
 gi|315136582|dbj|BAJ43741.1| flagellar motor switch protein FliM [Escherichia coli DH1]
          Length = 334

 Score =  150 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 42/303 (13%), Positives = 92/303 (30%), Gaps = 10/303 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+  +      I      +   + +         +    DI+  +
Sbjct: 30  SGESDIRPYDPNTQRRVVRERLQALEI------INERFARHFRMGLFNLLRRSPDITVGA 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G       ++  
Sbjct: 84  IRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +                 ++     N     N+ V   
Sbjct: 144 REFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVR-SEMQVKFTNITTSPNDIVVNT 202

Query: 185 NMNMTIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     L+       S N+ ++  D   R+     + + 
Sbjct: 203 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELV 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ L  G V+P         I   +G  + + + G +   Y +RI   
Sbjct: 263 ANFADISLRLSQILKLNPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRIEHL 320

Query: 304 INF 306
           IN 
Sbjct: 321 INP 323


>gi|310659031|ref|YP_003936752.1| flim [Clostridium sticklandii DSM 519]
 gi|308825809|emb|CBH21847.1| FliM [Clostridium sticklandii]
          Length = 332

 Score =  150 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 49/289 (16%), Positives = 108/289 (37%), Gaps = 13/289 (4%)

Query: 29  KTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASL 88
           KT+  I  +   +   +L    +    +DV     S +   +    +S     + S    
Sbjct: 53  KTLHMIHENFSRILNTYLSGYLRSITQIDV----ISVEELSYYEFNNSISNPALISVIDF 108

Query: 89  SSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQ 148
                      SN L  T+++ +LG + +   +  +R  + +E  +  + +A +S +L +
Sbjct: 109 MPLPGQIIFEMSNRLAFTMIDRILGGNGKY--ESESRPFTEIETTILNKLMANVSRLLIE 166

Query: 149 CISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLK 208
                 E  P L+         +  +  SNE V  I +   + ++     + +P   +L+
Sbjct: 167 PWENVIELDPELDKIETNSQFAQIVS--SNETVALITLRANVGDIEGLMNICMPH-IVLE 223

Query: 209 TTLISLSSQNKSENQSEDLIDP----FARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
             L +LS++       ++L +        +  + N++I+  +     T+++ + L+ G V
Sbjct: 224 PILPNLSTKFWFSTVKKELNEDDKGYLETRVKRANIDINAVVGDTYITVEEFIYLQEGDV 283

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKN 313
           I    +      L   GK  Y    G +  N   +IT  +    +    
Sbjct: 284 IKLSRKIDEDLELHVEGKTKYLGRPGTLKNNMAFKITKVVEKGDEDYDE 332


>gi|308187297|ref|YP_003931428.1| Flagellar motor switch protein fliM [Pantoea vagans C9-1]
 gi|308057807|gb|ADO09979.1| Flagellar motor switch protein fliM [Pantoea vagans C9-1]
          Length = 335

 Score =  150 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 41/306 (13%), Positives = 90/306 (29%), Gaps = 10/306 (3%)

Query: 2   RGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDIS 61
           +      +  P  P    R+  +      I      +   + +         +    DIS
Sbjct: 27  KQNGPEGDIRPYDPNTQRRVVRERLQALEI------INERFARSFRMTLFNLLRRSPDIS 80

Query: 62  YTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQ 121
             + +   +     +       +   L        +  S +LV   ++NL G       +
Sbjct: 81  VGAIKIQPYHEFARNLPVPTNLNLIHLKPLRGTALVVFSPSLVFIAVDNLFGGDGRFPTK 140

Query: 122 LYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFV 181
           +  R  +  E+++ +R +       +                 ++     N     N+ V
Sbjct: 141 VEGREFTHTEQRVIRRMLKLALDGYSDAWKAIYPLDVEYVR-SEMQVKFTNITTSPNDIV 199

Query: 182 TTINMNMTIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNV 240
                 + I N+   F + IP   +     L+       S  +     D   ++     +
Sbjct: 200 VNTPFQVEIGNLVGEFNICIPFSMIEPLRELLVNPPLENSRQEDNHWRDNLVKQVQHSEL 259

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            +          L  ++ LK G V+P    E    I   +   + + + G +   Y +R+
Sbjct: 260 ELIAHFAETSLRLSRILQLKPGDVLPIEKPE--RIIAHVDSVPVLTSQYGTMNGQYALRV 317

Query: 301 TDRINF 306
              IN 
Sbjct: 318 EHLINP 323


>gi|312172110|emb|CBX80367.1| Flagellar motor switch protein FliM [Erwinia amylovora ATCC
           BAA-2158]
          Length = 336

 Score =  150 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 45/297 (15%), Positives = 101/297 (34%), Gaps = 12/297 (4%)

Query: 12  PLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFS 71
           P  P    R+  +    + +E I+      Y+  L  + +       DI+  + +   + 
Sbjct: 38  PYDPNTQRRVVRER--LQALEIINERFARSYRMALFNLLR----RSPDITVGAIKIQPYH 91

Query: 72  HIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVE 131
               +       +   L        +  S +LV   ++NL G       ++  R  +  E
Sbjct: 92  EFARNLPVPTNLNLIHLKPLRGTALVVFSPSLVFIAVDNLFGGDGRFPTKVEGREFTHTE 151

Query: 132 KKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIE 191
           +++ +R +       ++                ++     N     N+ V T   ++ I 
Sbjct: 152 QRVIRRMLKLALESYSEAWKPIYPLDVEYVR-SEMQVKFTNITTSPNDIVVTTPFHVEIG 210

Query: 192 NVASSFVLIIPQETLLKTTLISLS--SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLK 249
           N+   F + IP   +++    +L       S  + E+  D   ++     + +       
Sbjct: 211 NLTGEFNICIPFS-MIEPLRETLVNPPLENSLTEDENWRDTLVKQVQHSELELVANFADV 269

Query: 250 KTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
              +  ++ LK G V+P         I   +G  + + + G + K Y +R+   IN 
Sbjct: 270 SMRISRLLALKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNKQYALRVEHLINP 324


>gi|126653737|ref|ZP_01725655.1| flagellar motor switch protein M [Bacillus sp. B14905]
 gi|126589701|gb|EAZ83837.1| flagellar motor switch protein M [Bacillus sp. B14905]
          Length = 331

 Score =  150 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 51/285 (17%), Positives = 110/285 (38%), Gaps = 13/285 (4%)

Query: 29  KTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASL 88
           +++ +I  +   L   F    F  ++   V I+  S     F   + S     + +   +
Sbjct: 54  RSLTRIHENFARLLTTF----FSAQLRSYVQITVASVDQIPFEEFVRSIPNMTLINVFEV 109

Query: 89  SSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQ 148
                N  +  + N+  ++L+ L+G S  +   + N  L+ +E K+      +    L +
Sbjct: 110 PPLDGNILMEINPNIAYSMLDRLMGGSGASHSNVDN--LTEIETKIMTNLFERSFDNLRE 167

Query: 149 CISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLK 208
                 E  P L +        +  +   NE V  I++N  I   +    + IP   +L+
Sbjct: 168 AWENVAEIDPILVELEVNPQFLQMIS--PNETVVVISLNTIIGETSGMINICIPH-VVLE 224

Query: 209 TTLISLS----SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
             + +LS     Q  ++  S +       +  Q  + +   + L   T++D +T+++G V
Sbjct: 225 PIVPNLSVRYWMQTNTKEMSPEQTKMLETRVKQAKLPLSVELGLTDITIEDFLTMQVGDV 284

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
           I    +     +L       ++ + G+ GK   I+I D +    +
Sbjct: 285 IQLEQKINDPLLLKVGTLPKFTVQPGKQGKKLAIQIIDPLKGGDE 329


>gi|304398862|ref|ZP_07380732.1| flagellar motor switch protein FliM [Pantoea sp. aB]
 gi|304353566|gb|EFM17943.1| flagellar motor switch protein FliM [Pantoea sp. aB]
          Length = 335

 Score =  150 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 41/306 (13%), Positives = 90/306 (29%), Gaps = 10/306 (3%)

Query: 2   RGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDIS 61
           +      +  P  P    R+  +      I      +   + +         +    DIS
Sbjct: 27  KQNGPEGDIRPYDPNTQRRVVRERLQALEI------INERFARSFRMALFNLLRRSPDIS 80

Query: 62  YTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQ 121
             + +   +     +       +   L        +  S +LV   ++NL G       +
Sbjct: 81  VGAIKIQPYHEFARNLPVPTNLNLIHLKPLRGTALVVFSPSLVFIAVDNLFGGDGRFPTK 140

Query: 122 LYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFV 181
           +  R  +  E+++ +R +       +                 ++     N     N+ V
Sbjct: 141 VEGREFTHTEQRVIRRMLKLALDGYSDAWKAIYPLDVEYVR-SEMQVKFTNITTSPNDIV 199

Query: 182 TTINMNMTIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNV 240
                 + I N+   F + IP   +     L+       S  +     D   ++     +
Sbjct: 200 VNTPFQVEIGNLVGEFNICIPFSMIEPLRELLVNPPLENSRQEDNHWRDNLVKQVQHSEL 259

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            +          L  ++ LK G V+P    E    I   +   + + + G +   Y +R+
Sbjct: 260 ELIAHFAETSLRLSRILQLKPGDVLPIEKPE--RIIAHVDSVPVLTSQYGTMNGQYALRV 317

Query: 301 TDRINF 306
              IN 
Sbjct: 318 EHLINP 323


>gi|77918773|ref|YP_356588.1| flagellar biosynthesis protein, component of motor switch
           [Pelobacter carbinolicus DSM 2380]
 gi|77544856|gb|ABA88418.1| flagellar biosynthesis protein, component of motor switch
           [Pelobacter carbinolicus DSM 2380]
          Length = 331

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 47/262 (17%), Positives = 97/262 (37%), Gaps = 5/262 (1%)

Query: 49  IFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLL 108
               +M   + +  +  Q  ++   +             L              L   LL
Sbjct: 72  SLTNRMQRSIGVRRSIMQVYEYDTFLQQLAGRDALGVIRLDPLRWRGVFIFKEKLAFYLL 131

Query: 109 ENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDY 168
           E+LLG + +    L  RSL+ +E  + + TIA     LN+  +  ++   +L        
Sbjct: 132 EHLLGGAPDVNLNLPGRSLTAIETSVLRNTIADACLDLNKTFAPLEKIESSLVKIESSTR 191

Query: 169 LKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISL--SSQNKSENQSED 226
           L        +  V   +  +T  N+    VL++P   +L      +   S   SE+Q   
Sbjct: 192 LINIV--PGDASVLAAHFVVTGNNLEDEIVLVLPMA-MLDPLKEKMREGSAVFSESQDRP 248

Query: 227 LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYS 286
                 ++  Q++V++  ++     T++D++  K+G ++       +   + A G+  + 
Sbjct: 249 WQTQLEQEIEQMDVDLSAQMATLNLTVRDILNFKVGDILDLGCAPSSPLQVRAAGQPKFQ 308

Query: 287 CELGRVGKNYTIRITDRINFDQ 308
              G       +RI+ RIN + 
Sbjct: 309 AIAGTHQGKKAVRISGRINRNN 330


>gi|261344127|ref|ZP_05971771.1| flagellar motor switch protein FliM [Providencia rustigianii DSM
           4541]
 gi|282567719|gb|EFB73254.1| flagellar motor switch protein FliM [Providencia rustigianii DSM
           4541]
          Length = 335

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 35/276 (12%), Positives = 85/276 (30%), Gaps = 6/276 (2%)

Query: 40  YLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGC 99
             + +         +    DI+  + +   +     +       +   +           
Sbjct: 59  ERFARQFRMGLFNMLRRSPDITVGAIKVEPYHEFARNLPVPTNLNLIHMPPLRGTALFTF 118

Query: 100 SNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPN 159
              LV   ++NL G       +   +  +  E+++  R +               +    
Sbjct: 119 EPALVYIAVDNLFGGDGRFPVRSEGKEFTNTEQRIINRMLKLALNAYRDAWRPIADVEVE 178

Query: 160 LEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL--LKTTLISLSSQ 217
                +I     N     N+ V T    + I N    F + IP   +  L+  LI+    
Sbjct: 179 YVR-SEIQVKFTNITTSPNDIVVTTPFLVEIGNTVGEFSICIPIAMIEPLRERLINP-PT 236

Query: 218 NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAIL 277
            +   ++E  +     +  +  + +   +      +  ++ L+ G V+P         I+
Sbjct: 237 EQGHQENEAWVTNLVTQVKRSELELVANLVEIPLRISSLLQLQKGDVLPIDKP--DRLIV 294

Query: 278 SANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKN 313
           + +G  + + + G     Y +R+   IN    +L  
Sbjct: 295 NVDGVPVLTSQYGTQNGQYALRVEHLINPVLNTLDE 330


>gi|269139494|ref|YP_003296195.1| flagellar motor switch protein [Edwardsiella tarda EIB202]
 gi|267985155|gb|ACY84984.1| flagellar motor switch protein [Edwardsiella tarda EIB202]
 gi|304559383|gb|ADM42047.1| Flagellar motor switch protein FliM [Edwardsiella tarda FL6-60]
          Length = 337

 Score =  150 bits (379), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 40/299 (13%), Positives = 96/299 (32%), Gaps = 10/299 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +  P  P    R+  +      I      +   + +         +    DI+  + +  
Sbjct: 36  DVRPYDPTTQRRVVRERLQALEI------VNERFARQFRMGLFNLLRRSPDITVGAVRIQ 89

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
            +     +       +   L        +    +LV   ++NL G       ++  R  +
Sbjct: 90  PYHEFARNLPVPTNLNLVHLKPLRGTALMVFEPSLVFMAVDNLFGGDGRFPTKVDGREFT 149

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++ +R +               +         +I     N     N+ V T    +
Sbjct: 150 HTEQRVIQRMLRLALDAYRDAWGAIFKLDVEYVR-SEIQVKFTNITTSPNDIVVTTPFTV 208

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSED-LIDPFARKTYQLNVNIDTRIN 247
            +  ++  F + IP   +     + ++   ++  Q +    D  +++     + +     
Sbjct: 209 EVGALSGEFNICIPFSMIEPLRELLVNPPLENSKQEDQHWRDTLSKQVQHSELELVANFV 268

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                L DV+ L+IG V+P         + + +G  + +C+ G     Y +R+   IN 
Sbjct: 269 DVPLRLSDVLKLQIGDVLPIDRP--DRLVANVDGVPVLTCQYGCYHGQYALRVEKMINP 325


>gi|292487985|ref|YP_003530862.1| flagellar motor switch protein FliM [Erwinia amylovora CFBP1430]
 gi|292899205|ref|YP_003538574.1| flagellar motor switch protein [Erwinia amylovora ATCC 49946]
 gi|291199053|emb|CBJ46164.1| flagellar motor switch protein [Erwinia amylovora ATCC 49946]
 gi|291553409|emb|CBA20454.1| Flagellar motor switch protein FliM [Erwinia amylovora CFBP1430]
          Length = 336

 Score =  150 bits (379), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 45/297 (15%), Positives = 101/297 (34%), Gaps = 12/297 (4%)

Query: 12  PLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFS 71
           P  P    R+  +    + +E I+      Y+  L  + +       DI+  + +   + 
Sbjct: 38  PYDPNTQRRVVRER--LQALEIINERFARSYRMALFNLLR----RSPDITVGAIKIQPYH 91

Query: 72  HIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVE 131
               +       +   L        +  S +LV   ++NL G       ++  R  +  E
Sbjct: 92  EFARNLPVPTNLNLIHLKPLRGTALVVFSPSLVFIAVDNLFGGDGRFPTKVEGREFTHTE 151

Query: 132 KKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIE 191
           +++ +R +       ++                ++     N     N+ V T   ++ I 
Sbjct: 152 QRVIRRMLKLALEGYSEAWKPIYPLDVEYVR-SEMQVKFTNITTSPNDIVVTTPFHVEIG 210

Query: 192 NVASSFVLIIPQETLLKTTLISLS--SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLK 249
           N+   F + IP   +++    +L       S  + E+  D   ++     + +       
Sbjct: 211 NLTGEFNICIPFS-MIEPLRETLVNPPLENSLTEDENWRDTLVKQVQHSELELVANFADV 269

Query: 250 KTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
              +  ++ LK G V+P         I   +G  + + + G + K Y +R+   IN 
Sbjct: 270 SMRISRLLALKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNKQYALRVEHLINP 324


>gi|293115681|ref|ZP_06604569.1| flagellar motor switch protein FliM [Butyrivibrio crossotus DSM
           2876]
 gi|292808783|gb|EFF67988.1| flagellar motor switch protein FliM [Butyrivibrio crossotus DSM
           2876]
          Length = 329

 Score =  150 bits (379), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 40/284 (14%), Positives = 98/284 (34%), Gaps = 11/284 (3%)

Query: 29  KTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASL 88
           +T+E I    G L    LP   +      V +   + ++  +S   ++     +      
Sbjct: 54  RTLEIIFEHYGRLLSTNLPAYLRM----PVQVEVKTSEAVIYSEFSNALSNPVLLGVVDF 109

Query: 89  SSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQ 148
                N  +  ++NL   +++ LLG + +  P    R  S +E  + +R       +L +
Sbjct: 110 EPLDGNIVLEIASNLGFVIIDRLLGGAGK--PLSKGRDFSEIELSIIERIFNICVNLLRE 167

Query: 149 CISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLK 208
                    P +E         +  +   +E +  + +++ + +      + +P   L  
Sbjct: 168 PWQNVLSIVPRMERIETNSQFAQIIS--PSEMIAIVTISIKLGDTEGLMNVCLPYSVLEP 225

Query: 209 TTLISLSSQNKSENQSED---LIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVI 265
                 +    S  Q  D     D  +    +  + +   +     ++ D + L +G +I
Sbjct: 226 VMDKLNTKYWFSTMQHRDVKTYEDAISSLISKAQIPVKAVLGNSTISVNDFLNLNVGDII 285

Query: 266 PFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
               +      +       ++   G    NY +RIT+ +  +++
Sbjct: 286 RLDRKVDEELDVYVGNIHKFTALPGSADDNYAVRITNVLRGEEE 329


>gi|296133037|ref|YP_003640284.1| flagellar motor switch protein FliM [Thermincola sp. JR]
 gi|296031615|gb|ADG82383.1| flagellar motor switch protein FliM [Thermincola potens JR]
          Length = 333

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 46/284 (16%), Positives = 108/284 (38%), Gaps = 13/284 (4%)

Query: 30  TIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLS 89
           T++ I  +   L   FL    +      V ++  S +   +   I S     + +   + 
Sbjct: 56  TLQAIHENFARLLATFLSAHLRTV----VTMNVHSVEQITYDEFIRSLPNPTLLNIFMME 111

Query: 90  SWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQC 149
             + N  +  + N+  T+L+ L G   +   ++  R L+ +E+ + ++ I +   +L + 
Sbjct: 112 PLAGNAILEVNPNVTFTILDRLFGGPGQAPEKM--RGLTDIERTVIEKVIIRCLQILKEA 169

Query: 150 ISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKT 209
                   P LE         +  +    E V  I+++ TI +      L IP   +L+ 
Sbjct: 170 WENIIVFDPKLEIIETNPMFTQIVS--PTEMVVLISIHATIGDNEGIMNLCIPF-IVLEP 226

Query: 210 TLISLSS----QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVI 265
            +  L++       ++  + + I    R+  +  + +   +      L +++ L+ G VI
Sbjct: 227 IISKLTAHFWFAGTAKTVTAEHIQNTQRRLEKAKITLSAVLGETTIKLGELLELQPGDVI 286

Query: 266 PFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
              +R      +    ++ +    G VG    ++IT  +    +
Sbjct: 287 QLDNRTTDELKILVGDRKKFYGRPGTVGSRLAVQITRLVKEGDE 330


>gi|73532540|dbj|BAE19828.1| flagellar motor switch protein [Edwardsiella tarda]
          Length = 337

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 42/304 (13%), Positives = 101/304 (33%), Gaps = 20/304 (6%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKM----DLDVDISYTS 64
           +  P  P            ++ + +   +L  +  +   + F+  +        DI+  +
Sbjct: 36  DVRPYDP---------TTQRRVVRERLQAL-EIVNERFARQFRMGLFNLVRRSPDITVGA 85

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +    +LV   ++NL G       ++  
Sbjct: 86  VRIQPYHEFARNLPVPTNLNLVHLKPLRGTALMVFEPSLVFMAVDNLFGGDGRFPTKVDG 145

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++ +R +               +          I     N     N+ V T 
Sbjct: 146 REFTHTEQRVIQRMLRLALDAYRDAWGAIFKLDVKYVR-SKIQVKFTNITTSPNDIVVTT 204

Query: 185 NMNMTIENVASSFVLIIPQETL--LKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNI 242
              + +  ++  F + IP   +  L+  L++      S+ + +   D  +++     + +
Sbjct: 205 PFTVEVGALSGEFNICIPFSMIGTLRELLVNP-PLENSKQEDQHWRDTLSKQVQHSELEL 263

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
                     L DV+ L+IG V+P         + + +G  + +C+ G     Y +R+  
Sbjct: 264 VANFVDVPLRLSDVLKLQIGDVLPIDRP--DRLVANVDGVPVLTCQYGCYHGQYALRVEK 321

Query: 303 RINF 306
            IN 
Sbjct: 322 MINP 325


>gi|85859177|ref|YP_461379.1| flagellar motor switch protein [Syntrophus aciditrophicus SB]
 gi|85722268|gb|ABC77211.1| flagellar motor switch protein [Syntrophus aciditrophicus SB]
          Length = 333

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 49/289 (16%), Positives = 104/289 (35%), Gaps = 10/289 (3%)

Query: 26  GDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQ 85
           G   T+E  +     +++  L  + ++     V ++  S    KF   + +         
Sbjct: 49  GRMPTLEMTNEKFARMFRTTLSSMLRKV----VAVNSMSVDMIKFGEFLKTLPVPTSLHI 104

Query: 86  ASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAV 145
             +     N      + ++ TL++ L G + + + ++  R  + +E  L K+ I    + 
Sbjct: 105 FRMEPLRGNAIFVMESKVIFTLVDVLFGGAGKELFKVEGREFTAIETNLIKKVILSALSD 164

Query: 146 LNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQET 205
           L +   T  +     +         +       + V  ++  + +E +     L IP  T
Sbjct: 165 LEKAWKTMHDIRVIYQRSEINPQFAQIV--PPTDLVFVVDFEIEVEYITGILKLCIPYST 222

Query: 206 LLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKK--TTLKDVVTLKIGQ 263
           + +     L +  +SE    D +     +   +  ++D  I L     + KDVV LK G 
Sbjct: 223 V-EPIREKLQAGFQSEQLEVDKVWMKRFRDNLMLAHLDILIELGSTLISAKDVVNLKPGD 281

Query: 264 VIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLK 312
           VI           +   G   +    G    N  +RI++ I  D++ + 
Sbjct: 282 VITLDQYCTDPVNIFVEGMMKFKGYPGTYKGNQAVRISE-IVQDKEVMD 329


>gi|238785486|ref|ZP_04629469.1| Flagellar motor switch protein fliM [Yersinia bercovieri ATCC
           43970]
 gi|238713588|gb|EEQ05617.1| Flagellar motor switch protein fliM [Yersinia bercovieri ATCC
           43970]
          Length = 334

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 41/303 (13%), Positives = 98/303 (32%), Gaps = 12/303 (3%)

Query: 6   IHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSC 65
              +  P  P    R+  +      +E I+      ++  L  + +       DI+    
Sbjct: 30  TETDVKPYDPTTQRRVVRER--LHALEIINERFARQFRMGLFNLLR----RSPDITVGPI 83

Query: 66  QSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNR 125
           +   +     +       +   L           + +LV   ++NL G       ++  R
Sbjct: 84  KIQPYHDFARNLPVPTNLNLIHLKPLRGTALFVFAPSLVFIAVDNLFGGDGRFPTKVEGR 143

Query: 126 SLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTIN 185
             +  E+++  R +           +   +         +I     N     N+ V T  
Sbjct: 144 EFTHTEQRVINRMLRLALDAYRDAWAPIYKIDVEYVR-SEIQVKFTNITTSPNDIVVTTP 202

Query: 186 MNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSED--LIDPFARKTYQLNVNID 243
            ++ I  ++  F + IP   +++     L++     ++ ED    +   ++     + + 
Sbjct: 203 FHVEIGALSGEFNICIPFA-MIEPLRELLTNPPLENSRQEDSHWRETLVKQVQHSELELV 261

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ L+ G V+P         I   +G  + + + G +   Y +R+   
Sbjct: 262 ANFVDIPLRLSQILKLQPGDVLPIDKP--DRLIGHVDGVPVLTSQYGTLNGQYALRVEHL 319

Query: 304 INF 306
           IN 
Sbjct: 320 INP 322


>gi|310767337|gb|ADP12287.1| flagellar motor switch protein [Erwinia sp. Ejp617]
          Length = 336

 Score =  150 bits (378), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 45/297 (15%), Positives = 101/297 (34%), Gaps = 12/297 (4%)

Query: 12  PLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFS 71
           P  P    R+  +    + +E I+      Y+  L  + +       DI+  + +   + 
Sbjct: 38  PYDPNTQRRVVRER--LQALEIINERFARSYRMALFNLLR----RSPDITVGAIKIQPYH 91

Query: 72  HIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVE 131
               +       +   L        +  S +LV   ++NL G       ++  R  +  E
Sbjct: 92  EFARNLPVPTNLNLIHLKPLRGTALVVFSPSLVFIAVDNLFGGDGRFPTKVEGREFTHTE 151

Query: 132 KKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIE 191
           +++ +R +       ++                ++     N     N+ V T   ++ I 
Sbjct: 152 QRVIRRMLKLALEGYSEAWKPIYPLDVEYVR-SEMQVKFTNITTSPNDIVVTTPFHVEIG 210

Query: 192 NVASSFVLIIPQETLLKTTLISLS--SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLK 249
           N+   F + IP   +++    +L       S  + E+  D   ++     + +       
Sbjct: 211 NLTGEFNICIPFS-MIEPLRETLVNPPIENSLTEDENWRDTLVKQVQHSELELVANFADV 269

Query: 250 KTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
              +  ++ LK G V+P         I   +G  + + + G + K Y +R+   IN 
Sbjct: 270 SMRISRLLALKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNKQYALRVEHLINP 324


>gi|212639555|ref|YP_002316075.1| flagellar motor switch protein FliM [Anoxybacillus flavithermus
           WK1]
 gi|212561035|gb|ACJ34090.1| Flagellar motor switch protein FliM [Anoxybacillus flavithermus
           WK1]
          Length = 335

 Score =  150 bits (378), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 46/284 (16%), Positives = 111/284 (39%), Gaps = 13/284 (4%)

Query: 29  KTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASL 88
           +++ ++  +   L   F    F  ++   V IS  S     +   I S  +  + +   +
Sbjct: 57  RSLTRMHENFARLLTTF----FSAQLRTYVQISVASADQLPYEEFIRSIPKMTILTVFEV 112

Query: 89  SSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQ 148
                   +  + N+   +L+ +LG    ++ ++ N  L+ +E K+      +  + L +
Sbjct: 113 PPLDGRVLLEVNPNIAYAMLDRVLGGRGVSLNKIEN--LTEIETKIMSNLFEKAFSNLRE 170

Query: 149 CISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLK 208
              +  +  P L DF       +  +   NE V  I++N  I + +    + IP   +L+
Sbjct: 171 AWESVADIDPMLTDFEVNPQFLQMVS--PNETVVVISLNTQIGDTSGMINICIPH-VVLE 227

Query: 209 TTLISLS----SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
             +  LS     Q + + +  + +    ++  Q  V +   +     ++++ + L +G V
Sbjct: 228 PIIPKLSVHYWMQTQKKAREPEEVATLQKRLKQTKVPMIAELGTSTISIQEFLQLSVGDV 287

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
           I      +   ++       +  + G++ K   I+I D I  + 
Sbjct: 288 IQLDQTVRDPLVIKVGDVPKFIGQPGKMNKRLAIQILDVIKGED 331


>gi|296103565|ref|YP_003613711.1| flagellar motor switch protein FliM [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295058024|gb|ADF62762.1| flagellar motor switch protein FliM [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 334

 Score =  149 bits (377), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 40/299 (13%), Positives = 97/299 (32%), Gaps = 10/299 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +  P  P    R+  +    + +E I+      ++  L  + +       DI+  + +  
Sbjct: 34  DIRPYDPNTQRRVVRER--LQALEIINERFARQFRMGLFNLLR----RSPDITVGAIRIQ 87

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
            +     +       +   L        +  S +LV   ++NL G       ++  R  +
Sbjct: 88  PYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEGREFT 147

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++  R +       +                 ++     N     N+ V     ++
Sbjct: 148 HTEQRVINRMLKLALESYSDAWKAINPLEVEYVR-SEMQVKFTNITTSPNDIVVNTPFHV 206

Query: 189 TIENVASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            I N+   F + +P   +     L+       S ++ ++  +   R+     + +     
Sbjct: 207 EIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRHEDQNWRENLVRQVQHSQLELVASFA 266

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                L  ++ L+ G V+P         I   +G  + + + G +   Y +R+   IN 
Sbjct: 267 DIPLRLSQILKLQPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTINGQYALRVEHLINP 323


>gi|238916760|ref|YP_002930277.1| flagellar motor switch protein FliM [Eubacterium eligens ATCC
           27750]
 gi|238872120|gb|ACR71830.1| flagellar motor switch protein FliM [Eubacterium eligens ATCC
           27750]
          Length = 327

 Score =  149 bits (377), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 45/285 (15%), Positives = 103/285 (36%), Gaps = 13/285 (4%)

Query: 29  KTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASL 88
           +T+E I    G L    LP   ++     V +   + +   +S   ++     +     +
Sbjct: 52  RTLEIIFEHFGRLLATNLPAYLRKS----VSVDVVNSEVVIYSEFSNALSNPVLLGVVGM 107

Query: 89  SSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQ 148
              S N  +  ++NL   +++ LLG +  +      R  S +E  + +R       ++ +
Sbjct: 108 QPLSGNIIMEMASNLGFAIVDRLLGGAGNS--LDKERDFSEIELSILERIFTVCVNLMQE 165

Query: 149 CISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLK 208
                 + +P LE         +  +      + TIN+ +   +V     + +P  T L+
Sbjct: 166 PWENVVKVNPRLERIETNSQFAQIISPSETIAIVTINLKI--GDVEGLVNICLPFAT-LE 222

Query: 209 TTLISLSSQNKSENQSEDLI----DPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
             +  L+++    N  E       D       +  + +   +   K ++ D   L+IG +
Sbjct: 223 PVMDKLNTKYWFSNMQEKDTNTYEDAIETVIDKAMIPVKAVLGTSKISVSDFANLQIGDI 282

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
           I    +      +     + +    G     Y +R+T+ I  + +
Sbjct: 283 IRIDKKVDQELEVFVGNIKKFKALPGYYEDKYAVRVTEVIRKESE 327


>gi|167464156|ref|ZP_02329245.1| flagellar motor switch protein FliM [Paenibacillus larvae subsp.
           larvae BRL-230010]
 gi|322382382|ref|ZP_08056289.1| FliM-like protein [Paenibacillus larvae subsp. larvae B-3650]
 gi|321153735|gb|EFX46110.1| FliM-like protein [Paenibacillus larvae subsp. larvae B-3650]
          Length = 332

 Score =  149 bits (376), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 41/289 (14%), Positives = 105/289 (36%), Gaps = 13/289 (4%)

Query: 29  KTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASL 88
           +++ +I  +       +L   F  ++   V I+    +   +   I S  +  + +    
Sbjct: 53  RSLTRIHENFAR----YLTTYFSAQLRTFVQINVVQVEQLPYDEFIRSIPKMTILNIFEA 108

Query: 89  SSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQ 148
                   +    N+   +L++LLG    +  ++   +L+ +E  + +R  ++    L +
Sbjct: 109 EPLEGRMVMEVHPNVAYAMLDHLLGGVGVSPSKIN--ALTEIETIVMERIFSKAFDSLQE 166

Query: 149 CISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLK 208
              T  +  P LE         +  +   NE +  I+++  I +      L IP   +++
Sbjct: 167 AWKTVVDLQPRLEALETNPQFMQIVS--PNETIALISLSTKIGDTTGMINLCIPH-VVIE 223

Query: 209 TTLISLSSQNKSENQSE----DLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
             +  LS  +   +Q +    + ++    +  Q  +     +     T+ + + L +G V
Sbjct: 224 PIMPRLSVHSWFVSQKKSRAPEEVEALQFRLNQAKLPFVAELGSSHITVHEFLNLSVGDV 283

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKN 313
           I           +    K  Y+   G V     ++I + ++  ++    
Sbjct: 284 ITLQKPVNEPLKIRIGDKYKYTGSPGTVRGKMAVQINEPVSEGEEEYDE 332


>gi|92114085|ref|YP_574013.1| flagellar motor switch protein FliM [Chromohalobacter salexigens
           DSM 3043]
 gi|91797175|gb|ABE59314.1| flagellar motor switch protein FliM [Chromohalobacter salexigens
           DSM 3043]
          Length = 338

 Score =  149 bits (376), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 44/299 (14%), Positives = 98/299 (32%), Gaps = 10/299 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
              P  P    R+  +      I      +   + +         M    DI+  S +  
Sbjct: 36  KVRPFDPAKQHRIIRERLHALDI------INERFARQFRVALFNLMRRSADITVESVRYQ 89

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
            +S    +       +  ++     +  +    +LV  +++NL G     + +   R  +
Sbjct: 90  SYSEFSRNLPVPTNLNLITMKPLRGSALVVFPPSLVFMVVDNLFGGDGRFLTKSEGREFT 149

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++  R +       ++   +            ++     N     NE V     ++
Sbjct: 150 RTEQRIIHRMLKMALEGYSESWKSVYPLDIEYTR-SELQVKFANITNSPNEIVVNSTFHV 208

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            + N++S F + IP   +     I  S   +   ++ +      A +    +V +     
Sbjct: 209 EVGNLSSEFNICIPYSMIEPIRDILASPLHDTHPDEEQQWEARMAHEIRHSSVELTADFV 268

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                L+DV  L +G +IP    E     +S +G  + +C+ G       +R+   I  
Sbjct: 269 DIPLRLRDVTQLSVGDIIPIELPE--AVNVSVDGIPVMTCDYGSQKSQRALRVRHLIEH 325


>gi|238794009|ref|ZP_04637627.1| Flagellar motor switch protein fliM [Yersinia intermedia ATCC
           29909]
 gi|238726641|gb|EEQ18177.1| Flagellar motor switch protein fliM [Yersinia intermedia ATCC
           29909]
          Length = 334

 Score =  149 bits (376), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 41/300 (13%), Positives = 99/300 (33%), Gaps = 12/300 (4%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +  P  P    R+  +    + +E I+      ++  L  + +       DI+    +  
Sbjct: 33  DVKPYDPTTQRRVVRER--LQALEIINERFARQFRMGLFNLLR----RSPDITVGPIKIQ 86

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
            +     +       +   L           + +LV   ++NL G       ++  R  +
Sbjct: 87  PYHDFARNLPVPTNLNLIHLKPLRGTALFVFAPSLVFIAVDNLFGGDGRFPTK