BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780687|ref|YP_003065100.1| flagellar C-ring protein
[Candidatus Liberibacter asiaticus str. psy62]
         (318 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|302878292|ref|YP_003846856.1| flagellar motor switch protein FliM [Gallionella capsiferriformans
           ES-2]
 gi|302581081|gb|ADL55092.1| flagellar motor switch protein FliM [Gallionella capsiferriformans
           ES-2]
          Length = 329

 Score =  267 bits (683), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 40/312 (12%), Positives = 101/312 (32%), Gaps = 8/312 (2%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTI---EKISSSLGYLYKKFLPKIFKEKMDLD 57
           + G++  +   P   +   R       ++ +         +   + +         +   
Sbjct: 17  VNGETEDEKAHPEADVGEIRPYNLASQERIVRGRMPTMEIINERFARLFRIGLFNFIRRT 76

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
            +IS    +  KF   + +       +         N       NLV  +++N+ G    
Sbjct: 77  PEISVGPVRVLKFGEFVRNLAVPTNLNIIQPKPLRGNGLFIFDPNLVFLVVDNMFGGDGR 136

Query: 118 TIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLS 177
              ++  R  +  E+++ ++ +A +     +   T                 +       
Sbjct: 137 FHTRVEGREFTQTEQRIIQKMLAVVFETYAKAWETVYPLEFEFVRSEM--NPQFANIATP 194

Query: 178 NEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTY 236
           NE V     ++ +     +F + +P  TL     +   + Q +     +  +   +R+  
Sbjct: 195 NEVVIVTTFDIELGGNGGAFHICMPYSTLEPVKDLLFNNIQGEHLAVDKRWLQLLSRQVQ 254

Query: 237 QLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNY 296
              + +   +     TL+ V+ +++G VIP           S +G  I  C+ G     Y
Sbjct: 255 CAEIELAATLGQANITLERVLKMRVGDVIPLN--VDENITASIDGVPIMECKYGVFNNQY 312

Query: 297 TIRITDRINFDQ 308
            ++I   +  ++
Sbjct: 313 ALKIVKMLTTNE 324


>gi|152980580|ref|YP_001353124.1| flagellar motor switch protein FliM [Janthinobacterium sp.
           Marseille]
 gi|151280657|gb|ABR89067.1| FliM flagellar motor switch protein [Janthinobacterium sp.
           Marseille]
          Length = 332

 Score =  265 bits (678), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 42/306 (13%), Positives = 91/306 (29%), Gaps = 11/306 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
              P +     R+                +   + + L       +    ++S    +  
Sbjct: 33  GVRPYNLATQERIVRG------RMPTLEIINERFSRLLRIGLFNFLHRSAEVSIGPVRVS 86

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           K+S  I +       +   +        I    NLV  L++NL G       ++  R  +
Sbjct: 87  KYSEFIRNLVVPTNLNLIHMKPLRGTGLIVLDPNLVFLLVDNLFGGDGRFHTRVEGRDFT 146

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++ +R +  I     +            E        +       NE V      +
Sbjct: 147 QTEQRIIQRILGIIFETYAKSWEPVYPVE--FEYIRSEMNTQFANIATPNEVVVATTFTI 204

Query: 189 TIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            +  V+       P   +     +   S Q ++    +  I    ++     V I   + 
Sbjct: 205 ELGPVSGDMHFCTPYAMIEPIRDLLTSSMQGETLEMDKRWIRLMTQQIQTAEVEILANMG 264

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
             K TL D++ ++ G +IP             +   +  C  G++   Y +R+   I   
Sbjct: 265 SAKVTLGDILNMQKGDIIPIAVP--DTITAEVDSVPVMECSYGKLNGQYALRVEKLIYSA 322

Query: 308 QKSLKN 313
             + + 
Sbjct: 323 NDTTQG 328


>gi|91776323|ref|YP_546079.1| flagellar motor switch protein FliM [Methylobacillus flagellatus
           KT]
 gi|91710310|gb|ABE50238.1| flagellar motor switch protein FliM [Methylobacillus flagellatus
           KT]
          Length = 335

 Score =  265 bits (678), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 38/304 (12%), Positives = 97/304 (31%), Gaps = 7/304 (2%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEK--ISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
             +T  L P  +        ++    +      +   + + L       +    ++S   
Sbjct: 23  EDDTPALDPAGVREYNLATQERIVRGRMPTLEIINERFARLLRIGLFNFLRRTTEVSVGP 82

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +  K+S  I +       +   +        +     LV  +++NL G       ++  
Sbjct: 83  VKISKYSEFIRNLVVPTNLNLVQMKPLRGTALMVFDPTLVFLIVDNLFGGDGRFHTRVEG 142

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++ +R +A +     +      +     E        +       NE V + 
Sbjct: 143 RDFTQTEQRIIQRVLAIVFETYAKSWEPVYKLE--FEYIRSEMNTQFANIATPNEVVVST 200

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNID 243
             N+ + + +       P   +     +  S  Q ++    +  +    ++     V + 
Sbjct: 201 TFNIELGSASGEIHFCFPYSMIEPIRDLLTSPLQGEALGVDKRWVRLMTQQIQSAEVMLI 260

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
             +   + TL D++ +K+G VIP             +   +  C+ G     Y +R+   
Sbjct: 261 ADLAKAEMTLGDILNMKVGDVIPL--SISEEIEAKVDNVPVMQCKYGVFNGQYALRVEKL 318

Query: 304 INFD 307
           +  +
Sbjct: 319 LRSN 322


>gi|325981184|ref|YP_004293586.1| flagellar motor switch protein FliM [Nitrosomonas sp. AL212]
 gi|325530703|gb|ADZ25424.1| flagellar motor switch protein FliM [Nitrosomonas sp. AL212]
          Length = 325

 Score =  265 bits (677), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 39/309 (12%), Positives = 100/309 (32%), Gaps = 11/309 (3%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           ++ ++        +     R+                +   + + L       M   VDI
Sbjct: 25  VKEEAEKGGIRNYNLATQERIVRG------RMPTYEIINERFARLLRIGLFNFMRRTVDI 78

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           +    +  KFS  + +       +   +              L+  +++NL G       
Sbjct: 79  AVGPVKVIKFSEFVRNLVVPTNLNMVHMKPLRGTALFVFDPELIFLIVDNLFGGDGRYHT 138

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++  R  +  E+++ +R +  +     +   +        E        +  T    NE 
Sbjct: 139 RVEGRDFTQTEQRIIQRLLGVVFDEYEKSWKSVYPIQ--FEYVRSEMNPQFATIATPNEV 196

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLN 239
           V  +  ++ + N      + IP   +        S+ Q       +  I   +++     
Sbjct: 197 VVCVTFDIDMGNKGGGLHVCIPYSMVEPIRDTLYSALQGDHLEVDKRWIKLLSQQVQGAE 256

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           V +   +   K T + +++++ G +IP    +     +  +G  +  C  G +  +Y +R
Sbjct: 257 VELVANLGGAKVTFEQILSMQSGDIIPLEIPKS--ISVCVDGVPVMDCRYGTMNGHYALR 314

Query: 300 ITDRINFDQ 308
           +   I+  +
Sbjct: 315 VNSMISRSE 323


>gi|149928155|ref|ZP_01916401.1| flagellar motor switch protein M [Limnobacter sp. MED105]
 gi|149823140|gb|EDM82378.1| flagellar motor switch protein M [Limnobacter sp. MED105]
          Length = 348

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 44/312 (14%), Positives = 106/312 (33%), Gaps = 11/312 (3%)

Query: 6   IHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSC 65
            H+   P +     R+                +   + + +       M    +IS    
Sbjct: 30  THEGVRPYNLATQERIVRG------RMPTLEIINERFARLIRIGLFNFMRRSPEISVGPV 83

Query: 66  QSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNR 125
           +  K++  I +       +  ++     N       +LV  +++NL G       ++  R
Sbjct: 84  KVLKYNEFIRNLVVPTNLNIMAMKPLRGNALFIFDPSLVFAVIDNLFGGDGRFHTRVEGR 143

Query: 126 SLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTIN 185
             +  E+++  R +  I     +  +      P  E      + +       +E V T +
Sbjct: 144 DFTQTEQRIIARMLEVIREEFVKAWAPVFPLKP--EYLRSEMHTQFANIATPSEIVVTTS 201

Query: 186 MNMTIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDT 244
            ++ +     S  + IP  T+     +   S Q       +  +    ++     V++  
Sbjct: 202 FSIELGAGGGSLHICIPYSTMEPIRDLLYSSMQGDQAEPDKRWVTMLKKQVQMAEVDLVA 261

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
            +   + T+ D++ L+IG VIP             +   +++C  G  G  Y +++ + +
Sbjct: 262 SLASTQLTVADIMELRIGDVIPIE--IDKVIEARVDNVPVFNCSYGTSGGQYALKVEEVL 319

Query: 305 NFDQKSLKNFLH 316
               +S  + L+
Sbjct: 320 AVSNESHADALN 331


>gi|82702481|ref|YP_412047.1| flagellar motor switch protein FliM [Nitrosospira multiformis ATCC
           25196]
 gi|82410546|gb|ABB74655.1| flagellar motor switch protein FliM [Nitrosospira multiformis ATCC
           25196]
          Length = 326

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 38/305 (12%), Positives = 93/305 (30%), Gaps = 11/305 (3%)

Query: 3   GQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISY 62
             + +    P +     R+                +   + + L       M    +++ 
Sbjct: 27  QSTANPGFRPYNLATQERIVRG------RMPTLEIINERFARLLRLGLFNFMRRSANVTA 80

Query: 63  TSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQL 122
              +  KFS  + +       +   +              LV  +++NL G     +P+ 
Sbjct: 81  GPVRVMKFSEFVRNLAAPSNLNLVHIKPLRGTSLFVFDPTLVFLVVDNLFGGDGRFLPKT 140

Query: 123 YNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVT 182
             R  +  E+++ +R +  +     +            E        +       NE V 
Sbjct: 141 EGRDFTQTEQRIIQRLLNLVFDSYGKSWHPVYPIE--FEYLRAETNTQFANVATPNEVVV 198

Query: 183 TINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVN 241
                +   +V     + +P   L     +  S+ Q ++    +  +   +++     V 
Sbjct: 199 ATTFEVNFGSVVGEMHICMPYSILEPIRDLLSSTLQGEALEVDKRWVGRLSKQVQSAEVT 258

Query: 242 IDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
           +   +   +  L  ++ +K+G VIP           S +G  +  C+ G     Y +R+ 
Sbjct: 259 LLANLTHAQVRLDQILNMKVGDVIPLDIP--EFVTASVDGVPVMECKYGISNGRYALRME 316

Query: 302 DRINF 306
             +  
Sbjct: 317 KMLAS 321


>gi|188586031|ref|YP_001917576.1| flagellar motor switch protein FliM [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179350718|gb|ACB84988.1| flagellar motor switch protein FliM [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 333

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 41/314 (13%), Positives = 101/314 (32%), Gaps = 14/314 (4%)

Query: 2   RGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDIS 61
           + Q   +   P      A+        K   +    +   + + L       +   V+I 
Sbjct: 28  KQQDTQQKVKPYDFRRPAKF------SKDQIRTLQMINENFARLLSTYLSAYLRSYVEIE 81

Query: 62  YTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQ 121
             S     +   + S     +    S         +  + N+   +++ L+G   ET   
Sbjct: 82  LASVDQVTYDEFMRSLTNPTIMGIFSAPPMEGKSLMEMNPNIAFAVIDRLMGGPGETFES 141

Query: 122 LYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFV 181
                L+ +E+ +A++   ++   + +      E  P  E     +  +       NE V
Sbjct: 142 TG--ELTEIEEAVARKIFNRMLDSMLEAWKNVGELEPEFERIE--NNPQFTQIISPNEIV 197

Query: 182 TTINMNMTIENVASSFVLIIPQETLLKTTLISLSS----QNKSENQSEDLIDPFARKTYQ 237
             +  ++ +      F + +P   L        +         +  +E+       + ++
Sbjct: 198 AVVAFSVKVGEAEGLFNVCLPYIFLEPVIDRLSARFWFATGHQKKITEEESQALKNRLHK 257

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             V +   +   + ++K+ + L+ G VI      ++   L    K  +  + G +     
Sbjct: 258 TQVPVKAELARTRISVKEFLNLQEGDVISLNKPFESEIDLIVGKKTKFKGKPGSIKNKLA 317

Query: 298 IRITDRINFDQKSL 311
           ++IT  +     SL
Sbjct: 318 VQITQIVREGDDSL 331


>gi|74317625|ref|YP_315365.1| flagellar motor switch protein FliM [Thiobacillus denitrificans
           ATCC 25259]
 gi|74057120|gb|AAZ97560.1| flagellar motor switch protein FliM [Thiobacillus denitrificans
           ATCC 25259]
          Length = 334

 Score =  263 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 41/297 (13%), Positives = 94/297 (31%), Gaps = 11/297 (3%)

Query: 11  SPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKF 70
            P +     R+                +   + + L       +   V+IS    +  K+
Sbjct: 36  RPYNLATQERIVRG------RMPTLEIINERFARLLRIGLYNFLRRGVEISVGPVRVSKY 89

Query: 71  SHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTV 130
           S  I +       +            +  + +LV  +++NL G       ++  R  +  
Sbjct: 90  SEFIRNLVVPTNLNLVQFKPLRGTALMIFNPDLVFLMVDNLFGGDGRFHTRVEGRDFTQT 149

Query: 131 EKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTI 190
           E ++ +R +  +     +                     +       NE V  +   + +
Sbjct: 150 EHRIIQRILNIVFEAYGKSWEPVYPIEFEFIRSEM--NTQFANIATPNEVVVAVTFAIEL 207

Query: 191 ENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLK 249
             ++      +P   +     +   S Q ++    +  I    ++     V I   +   
Sbjct: 208 GQISGEMHFCMPYSMIEPIKDLLTSSLQAENLEVDKRWIRLMRQQIQLAEVEIVADLGTA 267

Query: 250 KTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
           + +L+D+V LK+G VIP             +G  +  C  G+    YT+R+   ++ 
Sbjct: 268 EVSLRDIVNLKVGDVIPLDIPP--TIEAKVDGVPVMECAYGKFNGQYTLRVEKLLST 322


>gi|71906405|ref|YP_283992.1| flagellar motor switch protein FliM [Dechloromonas aromatica RCB]
 gi|71846026|gb|AAZ45522.1| Flagellar motor switch protein FliM [Dechloromonas aromatica RCB]
          Length = 338

 Score =  263 bits (672), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 39/312 (12%), Positives = 96/312 (30%), Gaps = 7/312 (2%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEK--ISSSLGYLYKKFLPKIFKEKMDLDV 58
           + G++     S      +        ++    +      +   + ++L       M  + 
Sbjct: 18  VTGETDEPEESEGEGAGVRAYNIGTQERIVRGRMPTLELVNERFARYLRIGLFNYMHRNA 77

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           +IS    +  K+S  I +       +                 NLV  +++N+ G     
Sbjct: 78  EISVGPIRVQKYSEFIRNLVVPTNLNLVIAKPLRGTALFVFDPNLVFLVVDNMFGGDGRF 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSN 178
             ++  R  +  E+++ +  +  +    ++      + +   E        +       +
Sbjct: 138 HTRVEGRDFTPTEQRIIQGLLNVVFTEYSKSWKPVYDIN--FEYIRSEMNSQFANIATPS 195

Query: 179 EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQ 237
           E V +    +      +   +  P   L     +  S  Q+   +  +  I    ++   
Sbjct: 196 EIVVSTTFTLEFGGATADMHICFPYSMLEPIRDLLYSTMQSDQLSSDKRWIGTLRKQLQG 255

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             V I   +   K TL  ++ LK+G VIP             +   +  C  G+    Y 
Sbjct: 256 AEVEIVALLGSGKITLGQILKLKVGDVIPLHIP--DKIEALVDSVPLMECTYGQQSGQYA 313

Query: 298 IRITDRINFDQK 309
           +++   I    +
Sbjct: 314 LKVDRFIASSPE 325


>gi|253996306|ref|YP_003048370.1| flagellar motor switch protein FliM [Methylotenera mobilis JLW8]
 gi|253982985|gb|ACT47843.1| flagellar motor switch protein FliM [Methylotenera mobilis JLW8]
          Length = 334

 Score =  263 bits (672), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 37/311 (11%), Positives = 94/311 (30%), Gaps = 12/311 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S  +     +     R+                +   + + +       +   V++S   
Sbjct: 29  SEAEGVRDYNLATQERIVRG------RMPTLEIINERFARLVRIELFNFLRRTVEVSVGP 82

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +  K+S  I +       +   +        +     LV  +++N+ G       ++  
Sbjct: 83  VRITKYSDFIRNLVVPTNLNLVQMKPLRGTALMVFDPTLVFLVVDNMFGGDGRFHTRVEG 142

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++ +R +A +     +            E        +       NE V   
Sbjct: 143 RDFTQTEQRIIQRILAIVFETYAKSWEPVYPIE--FEYLRSEMNTQFANIATPNEVVVVT 200

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNID 243
             N+ +   +      +P   +     +  S  Q +     +  +    ++     + I 
Sbjct: 201 TFNVELGPASGEIHFCMPYSMVEPIRDLLTSPLQGEVLGADKRWVKLMTQQVQAAEIEIV 260

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
             +   +  L  V+ +K+G VIP             +G  +  C+ G     Y +R+   
Sbjct: 261 ADLATTEMHLGKVLNMKVGDVIPISM--DDAIEAKVDGVPVMLCKYGLFNGQYALRVEKL 318

Query: 304 INFDQ-KSLKN 313
           +  +  + +K 
Sbjct: 319 LRSNSTEYIKG 329


>gi|302343739|ref|YP_003808268.1| flagellar motor switch protein FliM [Desulfarculus baarsii DSM
           2075]
 gi|301640352|gb|ADK85674.1| flagellar motor switch protein FliM [Desulfarculus baarsii DSM
           2075]
          Length = 328

 Score =  262 bits (670), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 41/314 (13%), Positives = 100/314 (31%), Gaps = 6/314 (1%)

Query: 1   MRGQSIHKNTSPL---HPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLD 57
           M G  I   T        +++  LT +    +        +   + +         +   
Sbjct: 17  MSGGEIEVETDAGPEADGVIVYDLTNQDRIIRGRMPTLEIINDRFARLFRTTLSSALRKI 76

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
           VD++ TS    KF   + S           +     +      + LV  L+E   G +  
Sbjct: 77  VDMTTTSVDMVKFGEFMRSLPVPTSLHIFKMDPLRGHAIFVLESKLVFNLVETFFGGAGG 136

Query: 118 TIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLS 177
              ++  R  + +E++L ++ +      +        E +  +         +  +    
Sbjct: 137 GNVKIEGRDFTAIEQQLTRKVVMLALKDMESAWKPVHEVT--MVYSRTEINPQFASIVPP 194

Query: 178 NEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTY 236
            + V  +   + +E+ A +  + IP  T+           Q+       + +  F ++  
Sbjct: 195 TDVVIVVKFELEMEHTAGTVTVCIPYSTIEPIRTKLYAGFQSDQLEVDHEWMRRFRKQLR 254

Query: 237 QLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNY 296
           +  V     +   + T  D++ LK+G V+          +    G   +    G++  N 
Sbjct: 255 EAEVEFTVELGRTELTSGDLLQLKVGDVLQLDSDINGHLVAMVEGVPKFLGRPGQMRGNK 314

Query: 297 TIRITDRINFDQKS 310
             R+    ++  + 
Sbjct: 315 AFRVEGFKDYGAEI 328


>gi|134095084|ref|YP_001100159.1| flagellar motor switch protein FliM [Herminiimonas arsenicoxydans]
 gi|55977142|gb|AAV68363.1| FliM [Herminiimonas arsenicoxydans]
 gi|133738987|emb|CAL62035.1| Flagellar motor switch protein FliM [Herminiimonas arsenicoxydans]
          Length = 332

 Score =  262 bits (669), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 44/306 (14%), Positives = 93/306 (30%), Gaps = 11/306 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
              P +     R+                +   + + L       +    ++S    +  
Sbjct: 33  GVRPYNLATQERIVRG------RMPTLEIINERFSRLLRIGLFNFLHRSAEVSIGPVRVS 86

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           K+S  I +       +   +        I    NLV  L++NL G       ++  R  +
Sbjct: 87  KYSEFIRNLVVPTNLNLIHMKPLRGIGLIVLDPNLVFLLVDNLFGGDGRFHTRVEGRDFT 146

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++ +R +  I     +            E        +       NE V      +
Sbjct: 147 QTEQRIIQRILGIIFETYAKSWEPVYPVE--FEYIRSEMNTQFANIATPNEVVVATTFTI 204

Query: 189 TIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            +  V+      +P   +     +   S Q ++    +  I    ++     V I   + 
Sbjct: 205 ELGPVSGDLHFCVPYSMIEPIRDLLTSSMQGETLEMDKRWIRLMTQQIQTAEVEILANMG 264

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
             K TL D++ +KIG +I              +G  +  C  G++   Y +R+   I   
Sbjct: 265 SAKVTLGDILNMKIGDIISIAVP--EQVTAEVDGVPVMECSYGKLNGQYALRVEKLIYSA 322

Query: 308 QKSLKN 313
             + + 
Sbjct: 323 NDTTQG 328


>gi|329901244|ref|ZP_08272769.1| Flagellar motor switch protein FliM [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327549176|gb|EGF33768.1| Flagellar motor switch protein FliM [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 333

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 40/301 (13%), Positives = 92/301 (30%), Gaps = 11/301 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
                P +     R+                +   + + L       +    ++S    +
Sbjct: 31  QSGVRPYNLATQERIVRG------RMPTLEIINERFARLLRIGLFNFLRRSAEVSIGPVR 84

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
             K+S  I +       +   +        +    NLV  +++NL G       ++  R 
Sbjct: 85  VSKYSEFIRNLVVPTNLNLVHMKPLRGTVLMVFDPNLVFLIVDNLFGGDGRFHTRVEGRD 144

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E+++ +R +A +     +            E        +       NE V     
Sbjct: 145 FTQTEQRIIQRILAIVFENYAKSWEPVYPVE--FEYIRSEMNTQFANIATPNEVVICTTF 202

Query: 187 NMTIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTR 245
            + +  V+      IP  T+     I   S Q ++    +  I    ++     V I   
Sbjct: 203 TIELGPVSGEMHFCIPYSTIEPIRDILTSSLQGETLEVDKRWIRLMTQQIQTAEVEIIAD 262

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
             + ++    ++ +K+G +IP         +   +G  +  C  G+    Y +R+   + 
Sbjct: 263 FGVARSNFGAILNMKVGDIIPLAVP--DVVLAKVDGVPVMECTYGKFNGQYALRVEKLLA 320

Query: 306 F 306
            
Sbjct: 321 Q 321


>gi|253998475|ref|YP_003050538.1| flagellar motor switch protein FliM [Methylovorus sp. SIP3-4]
 gi|313200550|ref|YP_004039208.1| flagellar motor switch protein flim [Methylovorus sp. MP688]
 gi|253985154|gb|ACT50011.1| flagellar motor switch protein FliM [Methylovorus sp. SIP3-4]
 gi|312439866|gb|ADQ83972.1| flagellar motor switch protein FliM [Methylovorus sp. MP688]
          Length = 334

 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 34/300 (11%), Positives = 92/300 (30%), Gaps = 11/300 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
                +     R+                +   + + L       M   V++S    +  
Sbjct: 33  GVREYNLATQERIVRG------RMPTLEIINERFARLLRIGLFNFMRRSVEVSVGPVRIS 86

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           K+S  + +       +   ++       +    +LV ++++N+ G       ++  R  +
Sbjct: 87  KYSEFVRNLVVPTNLNLVHMNPLRGTGLMVFDPSLVFSIVDNMFGGDGRFHTRIEGRDFT 146

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++ +R +A +     +      +     E        +       NE +     ++
Sbjct: 147 QTEQRIIQRVLAIVIENYEKSWEPVYQVK--FEYLRSEMNTQFANIATPNEVIVATTFSI 204

Query: 189 TIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            +           P   +     +   S Q +     +  +    ++     V +   + 
Sbjct: 205 ELGPAGGEIHFCFPYSMIEPVRDLLTSSLQGEVLGVDKRWVRLMTQQIQAAEVELVANLA 264

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
             +  L DV+ +K+G VIP             +   +  C+ G     Y++R+   +  +
Sbjct: 265 KARMQLGDVLNMKVGDVIPLN--ISETIEAHVDNVPVMECKYGVFNGQYSLRVEKLLRAN 322


>gi|297538201|ref|YP_003673970.1| flagellar motor switch protein FliM [Methylotenera sp. 301]
 gi|297257548|gb|ADI29393.1| flagellar motor switch protein FliM [Methylotenera sp. 301]
          Length = 334

 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 36/311 (11%), Positives = 95/311 (30%), Gaps = 12/311 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +    +     R+                +   + + +       +   V++S   
Sbjct: 29  SNAGDVRDYNLATQERIVRG------RMPTLEIINERFARLVRIELFNFLRRTVEVSVGP 82

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +  K+S  + +       +   +        +     LV  +++N+ G       ++  
Sbjct: 83  VRITKYSDFVRNLVVPTNLNLIQMKPLRGTALMVFDPTLVFLVVDNMFGGDGRFHTRVEG 142

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++ +R +  +    ++            E        +       NE V  +
Sbjct: 143 RDFTQTEQRIIQRILNIVFETYSKSWEPVYPVQ--FEYMRSEMNTQFANIATPNEVVIAV 200

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNID 243
             N+ +   +       P   L     +  S  Q +     +  +    ++     V I 
Sbjct: 201 TFNVELGPASGEIHFCFPYSMLEPLRDMLSSPLQGEVLGTDKRWVKLMTQQVQAAEVEIV 260

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
             +      + DV+ +K+G V+P     +       +G  +  C+ G     Y +R+   
Sbjct: 261 ADLAKTNMMIGDVLNMKVGDVVPLN--IEESIEAQVDGVPVMLCKYGMFNGQYALRVEKL 318

Query: 304 INFDQ-KSLKN 313
           +  +  + +K 
Sbjct: 319 LRSNSTEYIKG 329


>gi|254491591|ref|ZP_05104770.1| flagellar motor switch protein FliM [Methylophaga thiooxidans
           DMS010]
 gi|224463069|gb|EEF79339.1| flagellar motor switch protein FliM [Methylophaga thiooxydans
           DMS010]
          Length = 340

 Score =  258 bits (660), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 40/300 (13%), Positives = 86/300 (28%), Gaps = 11/300 (3%)

Query: 11  SPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKF 70
                    R+                +   + ++L     + +    +IS +  Q  KF
Sbjct: 38  RDYDFGNEERIIRG------RMPTLEMINERFGRYLRISLFDMLRRSAEISVSGIQVMKF 91

Query: 71  SHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTV 130
           S  +H+       +   L        I     LV T+L+N  G       ++  R  +  
Sbjct: 92  SEYMHTLFVPTSLNLIHLHPLRGTGLIVLEPKLVFTILDNYFGGEGRFQARIEGREFTAT 151

Query: 131 EKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTI 190
           E ++ +  +      L +  S   E              +       +E V     ++ +
Sbjct: 152 ELRVIRMVLNLCFTDLTEAWSPVMEVDFEFV--SHEVNPQFANIVSPSEVVVISTFHVEL 209

Query: 191 ENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLK 249
           +       L  P   L     +  +  Q+               +    +V I  ++   
Sbjct: 210 DGGGGDIHLTFPYSMLEPIRELLDTGLQSDRTADDGRWSKAMREELMVADVEIWAKLAET 269

Query: 250 KTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
             TL  +  LK G +IP    +    +       ++    G   +   ++I + I   + 
Sbjct: 270 SLTLAQIHKLKTGDIIPIQMPKN--VVAMVEDVPMFRASYGEHNEKAALKIAEVIEHPKD 327


>gi|257095345|ref|YP_003168986.1| flagellar motor switch protein FliM [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257047869|gb|ACV37057.1| flagellar motor switch protein FliM [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 334

 Score =  258 bits (659), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 35/302 (11%), Positives = 92/302 (30%), Gaps = 11/302 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
                P       R+                +   + ++L       M    +IS  S +
Sbjct: 32  DDGPRPYDLGTQERIVRG------RMPTLELVNERFARYLRIGLFNYMHRSTEISVGSIR 85

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
             K+S    +       +  +              +LV  +++N+ G       ++  R 
Sbjct: 86  VQKYSEFTRNLVVPTNLNLINAKPLRGTALFVFDPSLVFLVVDNMFGGDGRFHTRVEGRD 145

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E+++ K  +  +    ++      + +   E        +       +E V     
Sbjct: 146 FTATEQRIIKGLLGVVFTEYSRSWKPVYDLT--FEYVRSEMNSQFANIATPSEIVVATTF 203

Query: 187 NMTIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTR 245
           ++      +   +  P   +     +   + Q+   +     +    ++     V I  R
Sbjct: 204 SIEFGGSTADLHICFPYSMIEPIRDLLFSTMQSDQLSTDRRWVIMLRKQLTNAEVEITAR 263

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           +     +L+ ++ +K+G ++P         I   +   +  C  G+ G  Y I+I   + 
Sbjct: 264 LATATVSLRQILEMKVGDIVPIDIP--EKVIAQVDDVPLMECRYGQQGGQYAIKIDHFMT 321

Query: 306 FD 307
            +
Sbjct: 322 IE 323


>gi|186477685|ref|YP_001859155.1| flagellar motor switch protein FliM [Burkholderia phymatum STM815]
 gi|184194144|gb|ACC72109.1| flagellar motor switch protein FliM [Burkholderia phymatum STM815]
          Length = 332

 Score =  258 bits (659), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 37/308 (12%), Positives = 93/308 (30%), Gaps = 11/308 (3%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           QS      P +     R+                +   + + L       M    +IS  
Sbjct: 29  QSDRAGVRPYNIATQERIVRG------RMPGLEIINDRFARLLRVGIFNFMRRTAEISVG 82

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
             +  K+S    +       +   +             NLV  +++NL G       ++ 
Sbjct: 83  PVKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFDPNLVFFVVDNLFGGDGRFHTRVE 142

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  +  E+++  + +  +         + +    + E      + +       NE V  
Sbjct: 143 GREFTQTEQRIIHKLLNLVFEHYTAAWKSVRPL--SFEYTRSEMHTQFANVATPNEIVIV 200

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNI 242
              ++       +  + +P   +     +  S  Q ++       +   +++     V +
Sbjct: 201 TQFSIEFGPTGGTLHICMPYSMIEPIRDVLSSPIQGEALEVDRRWVRVLSQQVQAAEVEL 260

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
              +     T ++++ +K G V+P             +G  +  C  G     Y +R+  
Sbjct: 261 TADLAQIPVTFQEILNMKAGDVLPINIP--EHITAKVDGVPVMECGYGIFNGQYALRVQK 318

Query: 303 RINFDQKS 310
            I+  ++ 
Sbjct: 319 MISAAEQM 326


>gi|90406812|ref|ZP_01215004.1| flagellar motor switch protein [Psychromonas sp. CNPT3]
 gi|90312049|gb|EAS40142.1| flagellar motor switch protein [Psychromonas sp. CNPT3]
          Length = 352

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 39/308 (12%), Positives = 97/308 (31%), Gaps = 11/308 (3%)

Query: 2   RGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDIS 61
            G +   +          R+                +   + + L       +    ++S
Sbjct: 31  DGGAEDDSHIHFDFSSQDRIVRG------RMPTLELVNERFARHLRISLFNMLRHTAEVS 84

Query: 62  YTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQ 121
               Q  KF   +H+       +            +     LV  L+EN  G       +
Sbjct: 85  INGVQMLKFGEYVHTLFVPTSLNMVRFRPLKGTALVTMEARLVFILVENFFGGDGRYHAK 144

Query: 122 LYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFV 181
           +  R  +  E+++ +  +  I        +     + + E                 E +
Sbjct: 145 IEGREFTPTERRIIQMLLKIIFEDYKDAWAPV--MTADFEYLDSEVNPAMANIVSPTEVI 202

Query: 182 TTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNV 240
              + ++ ++     F + +P   L     +  +  Q+  E+  +        +   ++V
Sbjct: 203 VVNSFHIELDGGGGDFHIAMPYSMLEPIRELLDAGVQSDKEDTDQRWSQALEDEIMDVDV 262

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            +  ++  K+  L+D++   +G +IP         ++   G   +  +LG+   N  ++I
Sbjct: 263 YLTAKLLEKQLPLRDMINWSVGDIIPVELP--EELLVCVEGLPSFHAKLGKSNDNLALKI 320

Query: 301 TDRINFDQ 308
            DRI   +
Sbjct: 321 IDRIKRPE 328


>gi|295399820|ref|ZP_06809801.1| flagellar motor switch protein FliM [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|312111668|ref|YP_003989984.1| flagellar motor switch protein FliM [Geobacillus sp. Y4.1MC1]
 gi|294978223|gb|EFG53820.1| flagellar motor switch protein FliM [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|311216769|gb|ADP75373.1| flagellar motor switch protein FliM [Geobacillus sp. Y4.1MC1]
          Length = 334

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 44/316 (13%), Positives = 106/316 (33%), Gaps = 13/316 (4%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           ++ +   K           R        K   +  + +   + + L   F  ++   V I
Sbjct: 29  LKKEETGKRVKVYDFKRALRF------SKDQIRSLTRIHENFARLLTTFFAAQLRTYVQI 82

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S  S     +   I S  +    +   +   + +  +  + N+   +L+ ++G    ++ 
Sbjct: 83  SVASADQIPYEEFIRSIPKMTFLNVFEVPPLNGHILMEVNPNIAYAMLDRVMGGKGTSVN 142

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++ N  L+ +E ++      +  + L     +  E  P   DF      +       N+ 
Sbjct: 143 KIDN--LTEIETRIISNLFDKAFSNLRDAWESVAEIDPVFTDFEV--NPQFLQMISPNDT 198

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQ 237
           V  I++N  I   +    + IP   L             Q + +  S +  +   R+   
Sbjct: 199 VVVISLNTQIGETSGMMNICIPYVVLEPIIPKLSVHYWMQAQKKESSPEETEALERRIRF 258

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             + I   +     T++D + L++G VI      +   ++       ++ + G+  K   
Sbjct: 259 AKLPIIAELGTATITIQDFLQLEVGDVIELDQSIQQPLLIKVGDIPKFTGQPGKRNKRLA 318

Query: 298 IRITDRINFDQKSLKN 313
           ++I D     +     
Sbjct: 319 VQILDTFKGAENYDDE 334


>gi|88813208|ref|ZP_01128448.1| flagellar motor switch protein [Nitrococcus mobilis Nb-231]
 gi|88789530|gb|EAR20657.1| flagellar motor switch protein [Nitrococcus mobilis Nb-231]
          Length = 336

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 40/301 (13%), Positives = 93/301 (30%), Gaps = 11/301 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
             S        R+                +   + + L       +    ++S    +  
Sbjct: 35  GISAYEFQFQDRIVRG------RMPTLEMINERFARLLRTGLFNMLRKTAEVSVVGVELL 88

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           KFS  +H+       +   +              LV  L++N  G       ++  R  +
Sbjct: 89  KFSEYVHTLYLPTSLNLVKVPPLRGTGLCVLDPKLVFILVDNFFGGDGRYFSKIEGREFT 148

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E ++ ++ + Q  A L +  +         E        +       +E V     ++
Sbjct: 149 PTETRVIRKVLEQGFADLREAWNPVLPVD--FEFLNMEVNPQFANIVSPSEAVVVSRFHV 206

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            +        + +P   +     +  +  Q+   +  +  +     +     V +  R+ 
Sbjct: 207 ELNGGGGDLHITLPYTMIEPVRDVLSAGVQSDRNDVDQRWVRSLREEMKSAPVRLSCRLT 266

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
             + +L +++ L+ G +IP         +L A    +    LG  G N  ++IT+ I   
Sbjct: 267 EARVSLHELMRLQPGDIIPIEMP--ETVVLRAAEVPVLRGRLGCSGGNVAVKITEPIRAP 324

Query: 308 Q 308
           Q
Sbjct: 325 Q 325


>gi|119899013|ref|YP_934226.1| flagellar motor switch protein FliM [Azoarcus sp. BH72]
 gi|119671426|emb|CAL95339.1| flagellar motor switch protein FliM [Azoarcus sp. BH72]
          Length = 336

 Score =  256 bits (653), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 36/306 (11%), Positives = 99/306 (32%), Gaps = 11/306 (3%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           +       P +     R+                +   + ++L       M  + ++S  
Sbjct: 29  EVEQGGVRPYNLATQERIVRG------RMPTMELINERFARYLRIGLFNYMHRNAEVSVG 82

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
             +  K++  + +       +            +    NLV  +++N+ G       ++ 
Sbjct: 83  PIKVQKYAEFVRNLVVPTNLNLVLGKPLRGTGLVVFDPNLVFLVVDNMFGGDGRFHTRVE 142

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  +  E+++ +  +  +     +  +   +    LE        +       +E V +
Sbjct: 143 GRDFTPTEQRIIQGMLNVVFTEYAKAWAPVFKLE--LEYVRSEMNSQFANIATPSEIVVS 200

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQLNVNI 242
            + ++ +    +   +  P   +     +  S  Q+    Q    I   +R+     V +
Sbjct: 201 TSFSLELGGAQAEMHICFPYSMVEPIRDLLYSTMQSDHLTQDRRWITLLSRQLQTAEVEL 260

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
              +   + TL+D+V +++G VIP           + +G  +  C  G     +  ++  
Sbjct: 261 TCNLGTARVTLRDIVNMRVGDVIPLQ--VSELLQATVDGVPVLECRYGTQNGQFAFKVDR 318

Query: 303 RINFDQ 308
            +  D+
Sbjct: 319 FLGPDE 324


>gi|300311368|ref|YP_003775460.1| flagellar motor switch protein FliM [Herbaspirillum seropedicae
           SmR1]
 gi|300074153|gb|ADJ63552.1| flagellar motor switch FliM protein [Herbaspirillum seropedicae
           SmR1]
          Length = 334

 Score =  256 bits (653), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 33/297 (11%), Positives = 84/297 (28%), Gaps = 11/297 (3%)

Query: 10  TSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGK 69
               +     R+                +   + +         +    +IS    +  K
Sbjct: 35  VRTYNLATQERIVRG------RMPTLEIINERFARLFRIGLFNFIHRTAEISVGPVKVSK 88

Query: 70  FSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLST 129
           +S  I +       +   +  +     +      V  L++N+ G       ++  R  + 
Sbjct: 89  YSEFIRNLVVPTNLNLVHIKPFRGIGLVVFDPQFVFMLVDNMFGGDGRFHTRIEGREFTP 148

Query: 130 VEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMT 189
            E+++  R +        +                     +       NE V +    + 
Sbjct: 149 TEQRIIMRVLEITFETYAKSWEPIYPIEFEFIRSEM--NTQFANIATPNEVVVSTTFTVE 206

Query: 190 IENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINL 248
           +  V+    +  P   +         S Q ++    +  I    ++     V +      
Sbjct: 207 LGPVSGEIHICTPYSMIEPVRDRLTSSMQGEALEVDKRWIRLMKQQIQTAEVELIVNFGT 266

Query: 249 KKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
            +    D++ +++G VIP      T      +G  +  C  G+    Y +R+   ++
Sbjct: 267 ARVNFTDLLHMQVGDVIPLQ--TNTTVEAQVDGVPVMECSYGQSNGQYALRVEKLLS 321


>gi|134294173|ref|YP_001117908.1| flagellar motor switch protein FliM [Burkholderia vietnamiensis G4]
 gi|134137330|gb|ABO53073.1| flagellar motor switch protein FliM [Burkholderia vietnamiensis G4]
          Length = 332

 Score =  256 bits (653), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 35/311 (11%), Positives = 88/311 (28%), Gaps = 11/311 (3%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           +  Q       P +     R+                +   + + L       M    +I
Sbjct: 26  IDEQRDTSGVRPYNIATQERIVRG------RMPGLEIINDRFARLLRIGIFNFMRRTAEI 79

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S +  +  K+S    +       +   +             NLV  +++NL G       
Sbjct: 80  SVSQVKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFDPNLVFFVVDNLFGGDGRFHT 139

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++  R  +  E+++  + +  +         + +               +       NE 
Sbjct: 140 RVEGRDFTATEQRIIGKLLNLVFEHYTTAWKSVRPLQFEFVRSEMHT--QFANVATPNEI 197

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLN 239
           V     ++       +  + +P   +     +  S  Q ++       +   +++     
Sbjct: 198 VIVTQFSIEFGPTGGTLHICMPYSMVEPIRDVLSSPIQGEALEVDRRWVRVLSQQVQSAE 257

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           V +   +     T + ++ L+ G V+P             +G  +  C  G     Y +R
Sbjct: 258 VELTADLAEIPATFEKILNLRAGDVLPLE--IDDTITAKVDGVPVMECGYGIFNGQYALR 315

Query: 300 ITDRINFDQKS 310
           +   I+     
Sbjct: 316 VQKMISAGDTM 326


>gi|237653569|ref|YP_002889883.1| flagellar motor switch protein FliM [Thauera sp. MZ1T]
 gi|237624816|gb|ACR01506.1| flagellar motor switch protein FliM [Thauera sp. MZ1T]
          Length = 336

 Score =  255 bits (652), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 37/303 (12%), Positives = 97/303 (32%), Gaps = 11/303 (3%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
           +   P +     R+                +   + ++L       M  + ++S    + 
Sbjct: 33  EGVRPYNLATQERIVRG------RMPTLELINERFARYLRIGLFNYMHRNAEVSAGPIKV 86

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSL 127
            K++  + +       +  +         +    NLV  +++N+ G       ++  R  
Sbjct: 87  QKYAEFVRNLVVPTNLNLITAKPLRGTGLVVFDPNLVFLVVDNMFGGDGRFHTRVEGRDF 146

Query: 128 STVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMN 187
           +  E+++ +  +  + A   +  +      P           +       +E V + +++
Sbjct: 147 TPTEQRIIRGMLDVVFAEYVRAWAPVFNLQPEFIRSEM--NSQFANIATPSEVVVSTSLS 204

Query: 188 MTIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRI 246
           +      +   +  P   L     +   S Q+         I    R+     V +    
Sbjct: 205 VEFGGSQAEMHICFPYSMLEPIRDLLYSSMQSDHLTSDRRWIKLLTRQLQTAEVELACSF 264

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
              + +L+D+V +++G VIP   +         +G  ++ C  G     Y +R+   I  
Sbjct: 265 GTARVSLRDIVDMRVGDVIPLAVQP--VLQAEVDGVPVFECRQGTRNGRYALRVERFITA 322

Query: 307 DQK 309
           +  
Sbjct: 323 EDN 325


>gi|188592199|ref|YP_001796797.1| flim: flagellar motor switching and energizing component
           [Cupriavidus taiwanensis LMG 19424]
 gi|170938573|emb|CAP63560.1| FliM: flagellar motor switching and energizing component
           [Cupriavidus taiwanensis LMG 19424]
          Length = 339

 Score =  255 bits (651), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 41/302 (13%), Positives = 90/302 (29%), Gaps = 10/302 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
                P +     R+                +   + + L       +    DIS  S +
Sbjct: 35  EGGVRPYNLATQERIIRG------RLHTLEIINERFARSLRTALFNFIRRGADISVGSVR 88

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
             KF     +       +   L             NLV  +++NL G       ++  R 
Sbjct: 89  IEKFGDFARNLPMPTNLNLVHLKPLRGTALFVYDPNLVFLVVDNLFGGDGRFHTRVEGRD 148

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E+++ +R +            T        E      + K       NE V T   
Sbjct: 149 FTQTEQRIIQRMLELTLTSYGNAWRTVHPIE--TEYIRSEMHPKFANVATHNEAVVTTAF 206

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRI 246
           ++ +  V     + +P   +     + ++     +   +  +   + +     V +    
Sbjct: 207 HIELGAVGGQLHVCLPYAMIEPLKDLLMNPLQDEKEVDKGWVTQLSTQLRAAEVELVAEF 266

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
              ++T+ +V+ ++ G V+P             +G  +  C  G +   Y +R+   IN 
Sbjct: 267 AHLQSTVAEVLAMRAGDVLPIELP--EKVFGKVDGVPVMQCGFGTMNGQYALRVERMINH 324

Query: 307 DQ 308
             
Sbjct: 325 QD 326


>gi|308048759|ref|YP_003912325.1| flagellar motor switch protein FliM [Ferrimonas balearica DSM 9799]
 gi|307630949|gb|ADN75251.1| flagellar motor switch protein FliM [Ferrimonas balearica DSM 9799]
          Length = 357

 Score =  255 bits (651), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 41/310 (13%), Positives = 99/310 (31%), Gaps = 5/310 (1%)

Query: 6   IHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSC 65
                S      +   T +    +        +   + + L       M  + ++S    
Sbjct: 22  EDDQFSGGEGATIYDFTSQDRIVRGRMPTLELVNERFARHLRISLFNMMRRNAEVSINGV 81

Query: 66  QSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNR 125
           Q  KF   +H+       +            I     LV  L++N  G       ++  R
Sbjct: 82  QMVKFGEYVHTLFVPTSLNMVRFRPLKGTGLITMEARLVFILVDNFFGGDGRFQAKIEGR 141

Query: 126 SLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTIN 185
             +  E+++ +  +  +     +  +   +     E                 E V   +
Sbjct: 142 EFTPTERRIIQLLLKTVFEDYKESWAPVMDVE--FEYLDSEVNPAMANIVSPTEVVVVSS 199

Query: 186 MNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDT 244
            ++ ++     F + +P   +     +  +  Q+  ++           +   + V++ T
Sbjct: 200 FHIELDGGGGDFHITLPYSMIEPIRELLDAGVQSDKQDTDMRWAKALQDEIMDVPVDLST 259

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
            +  ++ TL+D++ +K G +IP         ++       +  +LGR G N  +RI +RI
Sbjct: 260 MLLEQELTLRDIMEMKAGDIIPVEMP--EHLLVRIEDLPTFRGKLGRKGDNVAVRIEERI 317

Query: 305 NFDQKSLKNF 314
              +      
Sbjct: 318 PRPKSYKNEL 327


>gi|107021592|ref|YP_619919.1| flagellar motor switch protein FliM [Burkholderia cenocepacia AU
           1054]
 gi|116688064|ref|YP_833687.1| flagellar motor switch protein FliM [Burkholderia cenocepacia
           HI2424]
 gi|170731414|ref|YP_001763361.1| flagellar motor switch protein FliM [Burkholderia cenocepacia
           MC0-3]
 gi|206561843|ref|YP_002232608.1| flagellar motor switch protein FliM [Burkholderia cenocepacia
           J2315]
 gi|254246641|ref|ZP_04939962.1| Flagellar motor switch protein [Burkholderia cenocepacia PC184]
 gi|105891781|gb|ABF74946.1| flagellar motor switch protein FliM [Burkholderia cenocepacia AU
           1054]
 gi|116646153|gb|ABK06794.1| flagellar motor switch protein FliM [Burkholderia cenocepacia
           HI2424]
 gi|124871417|gb|EAY63133.1| Flagellar motor switch protein [Burkholderia cenocepacia PC184]
 gi|169814656|gb|ACA89239.1| flagellar motor switch protein FliM [Burkholderia cenocepacia
           MC0-3]
 gi|198037885|emb|CAR53829.1| flagellar motor switch protein FliM [Burkholderia cenocepacia
           J2315]
          Length = 332

 Score =  255 bits (651), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 35/311 (11%), Positives = 89/311 (28%), Gaps = 11/311 (3%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           +  Q       P +     R+                +   + + L       M    +I
Sbjct: 26  VDEQRDTSGVRPYNIATQERIVRG------RMPGLEIINDRFARLLRIGIFNFMRRTAEI 79

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S +  +  K+S    +       +   +             NLV  +++NL G       
Sbjct: 80  SVSQVKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFDPNLVFFVVDNLFGGDGRFHT 139

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++  R  +  E+++  + +  +         + +               +       NE 
Sbjct: 140 RVEGRDFTATEQRIIGKLLNLVFEHYTTAWKSVRPLQFEFVRSEMHT--QFANVATPNEI 197

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLN 239
           V     ++       +  + +P   +     +  S  Q ++       +   +++     
Sbjct: 198 VIVTQFSIEFGPTGGTLHICMPYSMIEPIRDVLSSPIQGEALEVDRRWVRVLSQQVQAAE 257

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           V +   +    +T + ++ L+ G V+P     +       +G  +  C  G     Y +R
Sbjct: 258 VELTANLAEISSTFEKILNLRAGDVLPLE--IEDTITAKVDGVPVMECGYGIFNGQYALR 315

Query: 300 ITDRINFDQKS 310
           +   I      
Sbjct: 316 VQKMIGASDSM 326


>gi|254251031|ref|ZP_04944349.1| Flagellar motor switch protein [Burkholderia dolosa AUO158]
 gi|124893640|gb|EAY67520.1| Flagellar motor switch protein [Burkholderia dolosa AUO158]
          Length = 332

 Score =  255 bits (651), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 35/311 (11%), Positives = 88/311 (28%), Gaps = 11/311 (3%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           +  Q       P +     R+                +   + + L       M    +I
Sbjct: 26  VDEQRDASGVRPYNIATQERIVRG------RMPGLEIINDRFARLLRIGIFNFMRRTAEI 79

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S +  +  K+S    +       +   +             NLV  +++NL G       
Sbjct: 80  SVSQVKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFDPNLVFFVVDNLFGGDGRFHT 139

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++  R  +  E+++  + +  +         + +               +       NE 
Sbjct: 140 RVEGRDFTATEQRIIGKLLNLVFEHYTVAWKSVRPLQFEFVRSEMHT--QFANVATPNEI 197

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLN 239
           V     ++       +  + +P   +     +  S  Q ++       +   +++     
Sbjct: 198 VIVTQFSIEFGPTGGTLHICMPYSMIEPIRDVLSSPIQGEALEVDRRWVRVLSQQVQAAE 257

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           V +   +     T + ++ L+ G V+P             +G  +  C  G     Y +R
Sbjct: 258 VELTADLAEIPVTFEKILNLRAGDVLPLEIP--DTITAKVDGVPVMECGYGIFNGQYALR 315

Query: 300 ITDRINFDQKS 310
           +   I+     
Sbjct: 316 VQKMISAGDTM 326


>gi|309779462|ref|ZP_07674223.1| flagellar motor switch protein FliM [Ralstonia sp. 5_7_47FAA]
 gi|308921703|gb|EFP67339.1| flagellar motor switch protein FliM [Ralstonia sp. 5_7_47FAA]
          Length = 336

 Score =  255 bits (651), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 38/308 (12%), Positives = 97/308 (31%), Gaps = 7/308 (2%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEK--ISSSLGYLYKKFLPKIFKEKMDLDV 58
           +   +         P  +        ++    +      +   + +         M  + 
Sbjct: 19  VSDDADDDPVEAADPSGIRSYNLGSQERIVRGRMPTLEIINERFARNWRIGLFNFMRRNA 78

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           +IS    +  K+S  I +       +   +             NL+  +++NL G     
Sbjct: 79  EISVGPVKVQKYSEFIRNLVVPTSLNLVHVKPLRGTALFVFDPNLIFLVVDNLFGGDGRF 138

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSN 178
             ++  R  + VE+++ +R +  +     +                     +       N
Sbjct: 139 HMRVEGRDFTDVEQRIIQRMLHLVFEHYAKAWQPVYPIDFEFLRMEMHT--EFANVATPN 196

Query: 179 EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQ 237
           E V T + ++ + +      + +P   +        S+ Q ++    +  +   +++   
Sbjct: 197 EVVITTSFSIELGSNGGDVHICMPYTMIEPIRDRLTSAIQGEALEVDKRWLRLLSQQVQT 256

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             V +   +   K  + D++ +K+G VIP       C     +G  +  C  G     Y 
Sbjct: 257 AEVELIADLATAKVQVSDILNMKVGDVIPLEL--DDCVTAKVDGVPVMECNYGTFNGQYA 314

Query: 298 IRITDRIN 305
           +R+   +N
Sbjct: 315 LRVNRMLN 322


>gi|114332022|ref|YP_748244.1| flagellar motor switch protein FliM [Nitrosomonas eutropha C91]
 gi|114309036|gb|ABI60279.1| flagellar motor switch protein FliM [Nitrosomonas eutropha C91]
          Length = 330

 Score =  255 bits (651), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 43/301 (14%), Positives = 90/301 (29%), Gaps = 11/301 (3%)

Query: 2   RGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDIS 61
            G +      P       R+                +   +   L       +   VDIS
Sbjct: 31  NGVTYPGGIRPYDMATQERIVRG------RMPALEIINARFANSLQIGLYNFLRRGVDIS 84

Query: 62  YTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQ 121
             S ++ K+S    S       +  S+        I    NL+  +++N+ G       +
Sbjct: 85  AGSIKTIKYSEFTRSLVVPANINMVSMKPLRGTALITIDPNLIFLIVDNMFGGDGRFHTR 144

Query: 122 LYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFV 181
           +  R  +  E+ + +R +  +     +   +        E        +        + V
Sbjct: 145 VEGREFTLTEQGIIRRLLDVLFENYEKAWKSVYPV--RFEYIRAEMNPQFANIATPTDVV 202

Query: 182 TTINMNMTIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNV 240
              +  + +      F +  P   L     +   S Q        + I    R+     +
Sbjct: 203 VASSFELNLGGNRGEFYICTPYTMLEPIRDLLNNSMQEDHAEVDNNWIKSLTRQVQGAEI 262

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            I   +   + TL  ++ ++ G VI          +  ANG  I  C  G +  +Y +++
Sbjct: 263 EIIANLGHTRVTLHQILNMQEGDVIALDIP--DTVVAMANGVPIMDCHYGILNDHYALKV 320

Query: 301 T 301
            
Sbjct: 321 K 321


>gi|30248480|ref|NP_840550.1| flagellar motor switch protein FliM [Nitrosomonas europaea ATCC
           19718]
 gi|30138366|emb|CAD84375.1| Flagellar motor switch protein FliM [Nitrosomonas europaea ATCC
           19718]
          Length = 330

 Score =  254 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 41/301 (13%), Positives = 90/301 (29%), Gaps = 11/301 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
              P +     R+                +   +   L       +   VDIS  S ++ 
Sbjct: 38  GVRPYNMATQERIVRG------RMPALEIINARFANSLQIGLYNFLRRGVDISAGSIKTI 91

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           K+S    S       +  S+             NL+  +++N+ G       ++  R  +
Sbjct: 92  KYSEFTRSLVVPANINLVSMKPLRGTALFTIDPNLIFLIVDNMFGGDGRFHTRVEGREFT 151

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+ + +R +  +     +   +        E        +        + V      +
Sbjct: 152 LTEQGIIRRLLDVLFEHYEKAWQSVYPVK--FEYIRAEMNPQFANIVTPTDIVVASAFEL 209

Query: 189 TIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            +      F   IP   L     +   S Q       ++ I    R+     + I   + 
Sbjct: 210 NLGGNRGEFYTCIPYTMLEPIRDLLNNSMQEDRAEVDKNWIKSLTRQVQGAEIEIIANLG 269

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
             + TL  ++ ++ G VI          +  AN   I  C  G +  +Y +++    + +
Sbjct: 270 QTQVTLHQILNMQEGDVIALDIP--DTVVAIANNVPIMDCHYGILNGHYALKVKTVRSPN 327

Query: 308 Q 308
           +
Sbjct: 328 E 328


>gi|85859177|ref|YP_461379.1| flagellar motor switch protein [Syntrophus aciditrophicus SB]
 gi|85722268|gb|ABC77211.1| flagellar motor switch protein [Syntrophus aciditrophicus SB]
          Length = 333

 Score =  254 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 41/301 (13%), Positives = 94/301 (31%), Gaps = 10/301 (3%)

Query: 13  LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSH 72
                  R+                    + +         +   V ++  S    KF  
Sbjct: 38  YDLASQDRIIRG------RMPTLEMTNEKFARMFRTTLSSMLRKVVAVNSMSVDMIKFGE 91

Query: 73  IIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEK 132
            + +           +     N      + ++ TL++ L G + + + ++  R  + +E 
Sbjct: 92  FLKTLPVPTSLHIFRMEPLRGNAIFVMESKVIFTLVDVLFGGAGKELFKVEGREFTAIET 151

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            L K+ I    + L +   T  +    +         +        + V  ++  + +E 
Sbjct: 152 NLIKKVILSALSDLEKAWKTMHDI--RVIYQRSEINPQFAQIVPPTDLVFVVDFEIEVEY 209

Query: 193 VASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
           +     L IP  T+        +  Q++     +  +  F       +++I   +     
Sbjct: 210 ITGILKLCIPYSTVEPIREKLQAGFQSEQLEVDKVWMKRFRDNLMLAHLDILIELGSTLI 269

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSL 311
           + KDVV LK G VI           +   G   +    G    N  +RI++ +  D++ +
Sbjct: 270 SAKDVVNLKPGDVITLDQYCTDPVNIFVEGMMKFKGYPGTYKGNQAVRISEIV-QDKEVM 328

Query: 312 K 312
            
Sbjct: 329 D 329


>gi|239826624|ref|YP_002949248.1| flagellar motor switch protein FliM [Geobacillus sp. WCH70]
 gi|239806917|gb|ACS23982.1| flagellar motor switch protein FliM [Geobacillus sp. WCH70]
          Length = 334

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 42/289 (14%), Positives = 101/289 (34%), Gaps = 7/289 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +  + +   + + L   F  ++   V IS  S     +   I S  +    +   
Sbjct: 50  SKDQIRSLTRIHENFARLLTTFFAAQLRTYVQISVASADQIPYEEFIRSIPKMTFLNVFE 109

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +   + +  I  + N+   +L+ ++G    +I ++ N  L+ +E ++      +  + L 
Sbjct: 110 VPPLNGHILIEVNPNIAYAMLDRVMGGRGTSINKVDN--LTEIETRIMSNLFDKAFSNLR 167

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
               +  E  P   DF      +       N+ V  I++N  +   +    + IP   L 
Sbjct: 168 DAWESIAEIDPIFTDFEV--NPQFLQVISPNDTVVVISLNTKVGETSGMINICIPHVVLE 225

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                       Q + +  S +  +   R+     + I   +     T+++ + L++G V
Sbjct: 226 PIIPKLSVHYWMQAQKKESSPEETEAIERRIRFAKLPIIAELGTATITIQEFLQLEVGDV 285

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKN 313
           I      +   ++       +  + G+  K   ++I D    ++     
Sbjct: 286 IELDQSIQQPLLIKVGDIPKFIGQPGKRNKRLAVQILDAFKGEEDYNDE 334


>gi|91785619|ref|YP_560825.1| flagellar motor switch protein FliM [Burkholderia xenovorans LB400]
 gi|296157439|ref|ZP_06840274.1| flagellar motor switch protein FliM [Burkholderia sp. Ch1-1]
 gi|91689573|gb|ABE32773.1| Flagellar motor switch protein FliM [Burkholderia xenovorans LB400]
 gi|295892211|gb|EFG71994.1| flagellar motor switch protein FliM [Burkholderia sp. Ch1-1]
          Length = 332

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 36/308 (11%), Positives = 87/308 (28%), Gaps = 11/308 (3%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           QS      P +     R+                +   + + L       M    +IS  
Sbjct: 29  QSDRAGVRPYNIATQERIVRG------RMPGLEIINDRFARLLRVGIFNFMRRSAEISVG 82

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
             +  K+S    +       +   +             NLV  +++NL G       ++ 
Sbjct: 83  PVKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFDPNLVFFVVDNLFGGDGRFHTRVE 142

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  +  E+++  + +  +         + +               +       NE V  
Sbjct: 143 GRDFTQTEQRIINKLLNLVFDNYTASWKSVRPLQFEYVRSEMHT--QFANVATPNEIVIV 200

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNI 242
              ++       +  + +P   +     I  S  Q ++       +   +++     V +
Sbjct: 201 TQFSIEFGTTGGTLHICMPYSMIEPIRDILSSPIQGEALEVDRRWVRVLSQQVQAAEVEL 260

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
              +     T + ++ ++ G V+P             +G  +  C  G     Y +R+  
Sbjct: 261 TADLAKVPVTFEQILNMRKGDVLPINIP--EHITAKVDGVPVMECGYGIFNGQYALRVQK 318

Query: 303 RINFDQKS 310
            I+     
Sbjct: 319 MISAADTM 326


>gi|172059107|ref|YP_001806759.1| flagellar motor switch protein FliM [Burkholderia ambifaria MC40-6]
 gi|171991624|gb|ACB62543.1| flagellar motor switch protein FliM [Burkholderia ambifaria MC40-6]
          Length = 332

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 34/304 (11%), Positives = 88/304 (28%), Gaps = 11/304 (3%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
               P +     R+                +   + + L       M    +IS +  + 
Sbjct: 33  SGVRPYNIATQERIVRG------RMPGLEIINDRFARLLRIGIFNFMRRTAEISVSQVKV 86

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSL 127
            K+S    +       +   +             NLV  +++NL G       ++  R  
Sbjct: 87  QKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFDPNLVFFVVDNLFGGDGRFHTRVEGRDF 146

Query: 128 STVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMN 187
           +  E+++  + +  +         + +               +       NE V     +
Sbjct: 147 TATEQRIIGKLLNLVFEHYATAWKSVRPLQFEFVRSEMHT--QFANVATPNEIVIVTQFS 204

Query: 188 MTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRI 246
           +       +  + +P   +     +  S  Q ++       +   +++     V +   +
Sbjct: 205 IEFGPTGGTLHICMPYSMIEPIRDVLSSPIQGEALEVDRRWVRVLSQQVQSAEVELSANL 264

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
               +T + ++ L+ G V+P     +       +G  +  C  G     Y +R+   I+ 
Sbjct: 265 AEIPSTFEKILNLRAGDVLPLE--IEDTITAKVDGVPVMECGYGIFNGQYALRVQKMISA 322

Query: 307 DQKS 310
               
Sbjct: 323 SDTM 326


>gi|255021379|ref|ZP_05293427.1| Flagellar motor switch protein FliM [Acidithiobacillus caldus ATCC
           51756]
 gi|254969242|gb|EET26756.1| Flagellar motor switch protein FliM [Acidithiobacillus caldus ATCC
           51756]
          Length = 337

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 35/302 (11%), Positives = 91/302 (30%), Gaps = 11/302 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +  P       R+                +     +         +    +IS    +  
Sbjct: 35  SVQPYDLANQDRIVRG------RMPTLEVVNERLARLWRVSLFNFLRRSAEISVGPVRLV 88

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           K+S  I S       +   +     +        L+  +++N  G       ++  R  +
Sbjct: 89  KYSEFIRSLMVPSNINIVQVKPLRGSALFVFDARLIFAVVDNYFGGDGRFHARIEGREFT 148

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
            +E+++ KR +  +        S   +  P L         +  +     E V     N+
Sbjct: 149 PLEQRIIKRLLDLVFKDFKSAWSPVIDLQPELSRSEV--NPQFVSIATPTEVVIVSTFNI 206

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSSQN-KSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            +E+   SF + +P   +        +          +  +     +  +  + +     
Sbjct: 207 ELESGTGSFQICLPYGMVEPVRDQLTAGTTADRSEIDKRWVQSLHDELREATLELRVEFA 266

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
               +++ ++ L++G VIP         +   +G  ++    G  G  Y I+  + +  +
Sbjct: 267 RLPISVRQLLALRVGDVIPLERP--ETLVARVDGIPVFRGPYGVHGGKYAIQFHEALPPE 324

Query: 308 QK 309
            +
Sbjct: 325 TE 326


>gi|115350088|ref|YP_771927.1| flagellar motor switch protein FliM [Burkholderia ambifaria AMMD]
 gi|115280076|gb|ABI85593.1| flagellar motor switch protein FliM [Burkholderia ambifaria AMMD]
          Length = 332

 Score =  254 bits (648), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 34/304 (11%), Positives = 89/304 (29%), Gaps = 11/304 (3%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
            +  P +     R+                +   + + L       M    +IS +  + 
Sbjct: 33  SSVRPYNIATQERIVRG------RMPGLEIINDRFARLLRIGIFNFMRRTAEISVSQVKV 86

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSL 127
            K+S    +       +   +             NLV  +++NL G       ++  R  
Sbjct: 87  QKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFDPNLVFFVVDNLFGGDGRFHTRVEGRDF 146

Query: 128 STVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMN 187
           +  E+++  + +  +         + +               +       NE V     +
Sbjct: 147 TATEQRIIGKLLNLVFEHYATAWKSVRPLQFEFVRSEMHT--QFANVATPNEIVIVTQFS 204

Query: 188 MTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRI 246
           +       +  + +P   +     +  S  Q ++       +   +++     V +   +
Sbjct: 205 IEFGPTGGTLHICMPYSMIEPIRDVLSSPIQGEALEVDRRWVRVLSQQVQSAEVELSANL 264

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
               +T + ++ L+ G V+P     +       +G  +  C  G     Y +R+   I+ 
Sbjct: 265 AEIPSTFEKILNLRAGDVLPLE--IEDTITAKVDGVPVMECGYGIFNGQYALRVQKMISA 322

Query: 307 DQKS 310
               
Sbjct: 323 SDTM 326


>gi|78064701|ref|YP_367470.1| flagellar motor switch protein FliM [Burkholderia sp. 383]
 gi|77965446|gb|ABB06826.1| Flagellar motor switch protein FliM [Burkholderia sp. 383]
          Length = 332

 Score =  254 bits (648), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 34/311 (10%), Positives = 89/311 (28%), Gaps = 11/311 (3%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           +  Q       P +     R+                +   + + L       M    +I
Sbjct: 26  VDEQRDTSGVRPYNIATQERIVRG------RMPGLEIINDRFARLLRIGIFNFMRRTAEI 79

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S +  +  K+S    +       +   +             NLV  +++NL G       
Sbjct: 80  SVSQVKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFDPNLVFFVVDNLFGGDGRFHT 139

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++  R  +  E+++  + +  +         + +               +       NE 
Sbjct: 140 RVEGRDFTATEQRIIGKLLNLVFEHYTTAWKSVRPLQFEFVRSEMHT--QFANVATPNEI 197

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLN 239
           V     ++       +  + +P   +     +  S  Q ++       +   +++     
Sbjct: 198 VIVTQFSIEFGPTGGTLHICMPYSMIEPIRDVLSSPIQGEALEVDRRWVRVLSQQVQAAE 257

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           V +   +    +  + ++ L+ G V+P     +       +G  +  C  G     Y +R
Sbjct: 258 VELTANLAEISSNFEKILNLRAGDVLPLE--IEDTITAKVDGVPVMECGYGIFNGQYALR 315

Query: 300 ITDRINFDQKS 310
           +   I+     
Sbjct: 316 VQKMISAGDSM 326


>gi|319649555|ref|ZP_08003711.1| flagellar motor switch protein M [Bacillus sp. 2_A_57_CT2]
 gi|317398717|gb|EFV79399.1| flagellar motor switch protein M [Bacillus sp. 2_A_57_CT2]
          Length = 332

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 52/312 (16%), Positives = 109/312 (34%), Gaps = 13/312 (4%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           ++ +   K           R        K   +  + +   + + L   F  ++   V I
Sbjct: 28  LKKEQTEKKVKVYDFKRALRF------SKDQIRSLTRIHENFARLLTTFFSAQLRTYVQI 81

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S  S     +   I S  +  + +   +        +  + N+   +++ L+G    +I 
Sbjct: 82  SVASADQIPYEEFIRSIPKMTILNVIEVPPLDGRILMEVNPNVAYAMMDRLMGGRGTSIN 141

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++ N  L+ +E K+   T  +    L +  ST  +  P L DF      +       NE 
Sbjct: 142 KVDN--LTEIETKIMSATFERAFENLREAWSTIADIDPLLADFEV--NPQFLQMVSPNET 197

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQ 237
           V  I++N TI   +    + IP   L             Q   + +  ++I    R  ++
Sbjct: 198 VVVISLNTTIGETSGMINICIPHVVLEPIIPKLSVHYWMQTDKKEREPEVIARLERNIHK 257

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             V +   +      ++D ++L IG VI          I+       +  + G++ K   
Sbjct: 258 AEVPVICELGSSDIAIQDFLSLDIGDVIELNQGIDQALIIKVGNIPKFIGQPGKMNKKMA 317

Query: 298 IRITDRINFDQK 309
           ++I D +    +
Sbjct: 318 VQILDTVKGGDE 329


>gi|170698080|ref|ZP_02889161.1| flagellar motor switch protein FliM [Burkholderia ambifaria
           IOP40-10]
 gi|170137041|gb|EDT05288.1| flagellar motor switch protein FliM [Burkholderia ambifaria
           IOP40-10]
          Length = 332

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 34/304 (11%), Positives = 88/304 (28%), Gaps = 11/304 (3%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
               P +     R+                +   + + L       M    +IS +  + 
Sbjct: 33  SGVRPYNIATQERIVRG------RMPGLEIINDRFARLLRIGIFNFMRRTAEISVSQVKV 86

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSL 127
            K+S    +       +   +             NLV  +++NL G       ++  R  
Sbjct: 87  QKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFDPNLVFFVVDNLFGGDGRFHTRVEGRDF 146

Query: 128 STVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMN 187
           +  E+++  + +  +         + +               +       NE V     +
Sbjct: 147 TATEQRIIGKLLNLVFEHYATAWKSVRPLQFEFVRSEMHT--QFANVATPNEIVIVTQFS 204

Query: 188 MTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRI 246
           +       +  + +P   +     +  S  Q ++       +   +++     V +   +
Sbjct: 205 IEFGPTGGTLHICMPYSMVEPIRDVLSSPIQGEALEVDRRWVRVLSQQVQSAEVELSANL 264

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
               +T + ++ L+ G V+P     +       +G  +  C  G     Y +R+   I+ 
Sbjct: 265 AEIPSTFEKILNLRAGDVLPLE--IEDTITAKVDGVPVMECGYGIFNGQYALRVQKMISA 322

Query: 307 DQKS 310
               
Sbjct: 323 SDTM 326


>gi|171316890|ref|ZP_02906099.1| flagellar motor switch protein FliM [Burkholderia ambifaria MEX-5]
 gi|171097971|gb|EDT42789.1| flagellar motor switch protein FliM [Burkholderia ambifaria MEX-5]
          Length = 332

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 34/304 (11%), Positives = 88/304 (28%), Gaps = 11/304 (3%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
               P +     R+                +   + + L       M    +IS +  + 
Sbjct: 33  SGVRPYNIATQERIVRG------RMPGLEIINDRFARLLRIGIFNFMRRTAEISVSQVKV 86

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSL 127
            K+S    +       +   +             NLV  +++NL G       ++  R  
Sbjct: 87  QKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFDPNLVFFVVDNLFGGDGRFHTRVEGRDF 146

Query: 128 STVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMN 187
           +  E+++  + +  +         + +               +       NE V     +
Sbjct: 147 TATEQRIIGKLLNLVFEHYATAWKSVRPLQFEFVRSEMHT--QFANVATPNEIVIVTQFS 204

Query: 188 MTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRI 246
           +       +  + +P   +     +  S  Q ++       +   +++     V +   +
Sbjct: 205 IEFGPTGGTLHICMPYSMVEPIRDVLSSPIQGEALEVDRRWVRVLSQQVQSAEVELSANL 264

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
               +T + ++ L+ G V+P     +       +G  +  C  G     Y +R+   I+ 
Sbjct: 265 AEIPSTFEKILNLRAGDVLPLE--IEDTITAKVDGVPVMECGYGIFNGQYALRVQKMISA 322

Query: 307 DQKS 310
               
Sbjct: 323 SDTM 326


>gi|167585018|ref|ZP_02377406.1| flagellar motor switch protein FliM [Burkholderia ubonensis Bu]
          Length = 332

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 34/303 (11%), Positives = 88/303 (29%), Gaps = 11/303 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
              P +     R+                +   + + L       M    +IS +  +  
Sbjct: 34  GIRPYNIATQERIVRG------RMPGLEIINDRFARLLRIGIFNFMRRTAEISVSQVKVQ 87

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           K+S    +       +   +             NLV  +++NL G       ++  R  +
Sbjct: 88  KYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFDPNLVFFVVDNLFGGDGRFHTRVEGRDFT 147

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++  + +  +         + +               +       NE V     ++
Sbjct: 148 ATEQRIIGKMLNLVFEHYTTAWKSVRPLQFEYVRSEMHT--QFANVATPNEIVIVTQFSI 205

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
                  +  + +P   +     +  S  Q ++       +   +++     V +   + 
Sbjct: 206 EFGPTGGTLHICMPYSMVEPIRDVLASPIQGEALEVDRRWVRVLSQQVQTAEVEVTANLA 265

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
               T + ++ L+ G V+P     +       +G  +  C  G     Y +R+   I+ +
Sbjct: 266 EIPVTFEQILNLRAGDVLPLA--IEDTITAKVDGVPVMECGYGIFNGQYALRVQKMISAN 323

Query: 308 QKS 310
              
Sbjct: 324 DTM 326


>gi|289670556|ref|ZP_06491631.1| flagellar motor switch protein FliM [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 337

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 43/302 (14%), Positives = 97/302 (32%), Gaps = 16/302 (5%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           + G++   + S    I+  R+                +   + +         +    D+
Sbjct: 31  LPGEARQYDLSSQDRIIRGRM-----------PTLEMVNERFARLWRIGLFNLIRRSADL 79

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S       KF+  +HS       +            I     LV T+++N  G       
Sbjct: 80  SVRGIDLVKFNEYMHSLYVPTNLNLIRFKPLRGTGLIVFEPTLVFTVVDNFFGGDGRYHT 139

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++  R  +  E ++ +  + Q  A L +  +   +     E                 E+
Sbjct: 140 RIEGREFTATEMRVVQLMLKQTFADLKEAWAPVMDVD--FEYINSEINPHFANIVTPREY 197

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLN 239
           V     ++ +E       + +P   L     +  +  Q+   ++ +        +     
Sbjct: 198 VVVCRFHVELEGGGGEIHITLPYSMLEPIRELLDAGIQSDRNDRDDSWNVMLREQLDTAE 257

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           V + + +  K+ TL+ +  LK+G V+P     +    L      +++ E G    N  ++
Sbjct: 258 VTLSSVLASKRMTLRQLTGLKVGDVLPIELPAQVP--LCVEDIPLFTGEFGVSNGNNAVK 315

Query: 300 IT 301
           IT
Sbjct: 316 IT 317


>gi|325928696|ref|ZP_08189868.1| flagellar motor switch protein FliM [Xanthomonas perforans 91-118]
 gi|325540928|gb|EGD12498.1| flagellar motor switch protein FliM [Xanthomonas perforans 91-118]
          Length = 337

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 41/302 (13%), Positives = 97/302 (32%), Gaps = 16/302 (5%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           + G++   + S    I+  R+                +   + +         +    D+
Sbjct: 31  LPGEARQYDLSSQDRIIRGRM-----------PTLEMVNERFARLWRIGLFNLIRRSADL 79

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S       KF+  +HS       +            I     LV T+++N  G       
Sbjct: 80  SVRGIDLVKFNEYMHSLYVPTNLNLIRFKPLRGTGLIVFEPTLVFTVVDNFFGGDGRFHT 139

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++  R  +  E ++ +  + Q  A L +  +   +     E                 E+
Sbjct: 140 RIEGREFTATEMRVIQLMLKQTFADLKEAWAPVMDVD--FEYINSEINPHFANIVTPREY 197

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLN 239
           V     ++ +E       + +P   L     +  +  Q+   ++ +        +     
Sbjct: 198 VVVCRFHVELEGGGGEIHITLPYSMLEPIRELLDAGIQSDRNDRDDSWNVMLREQLDTAE 257

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           V + + +  K+ +L+ +  LK+G ++P     +    L      +++ E G    N  ++
Sbjct: 258 VTLSSVLASKRMSLRQLTGLKVGDILPIDLPAQVP--LCVEDIPLFTGEFGVSNGNNAVK 315

Query: 300 IT 301
           IT
Sbjct: 316 IT 317


>gi|289208344|ref|YP_003460410.1| flagellar motor switch protein FliM [Thioalkalivibrio sp. K90mix]
 gi|288943975|gb|ADC71674.1| flagellar motor switch protein FliM [Thioalkalivibrio sp. K90mix]
          Length = 324

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 32/299 (10%), Positives = 86/299 (28%), Gaps = 11/299 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
                  +     R+                +   + + L       +    ++S    +
Sbjct: 33  DGEAREFNFATQDRIVRG------RMPTLEMINERFARHLRVRLFNMLRRSAELSVVGTR 86

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
             KFS  +HS       +                  LV  L++N  G       ++  R 
Sbjct: 87  VSKFSEYMHSLFVPTSLNLVRAHPLHGTGLFVFDPKLVFILVDNFFGGDGRYHTRIEGRD 146

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            + +E ++    +      + +      +     E        +        E V     
Sbjct: 147 FTPMEMRVVHGILEGAFEDMVKAWQPVMDL--RFEFLNSEVNPQFANIVSPTEIVVISEF 204

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTR 245
           ++ ++    +    +P   +        +  Q+   +  +  +     +     V + + 
Sbjct: 205 HIELDGGGGNLHFTLPYSMIEPIREQLDTGLQSDRSDVDQRWMKALEEEIQDAEVEVSST 264

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
           +   + T+++++ ++ G +IP          L      ++  + G       I++TDRI
Sbjct: 265 LTETEVTVQELLDIQPGDIIPINLP--ETVTLKVEDIPLFRGKFGVSDGKNAIQVTDRI 321


>gi|21242691|ref|NP_642273.1| flagellar motor switch protein FliM [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|294664066|ref|ZP_06729468.1| flagellar motor switch protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|21108164|gb|AAM36809.1| flagellar protein [Xanthomonas axonopodis pv. citri str. 306]
 gi|292606169|gb|EFF49418.1| flagellar motor switch protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 337

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 41/302 (13%), Positives = 97/302 (32%), Gaps = 16/302 (5%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           + G++   + S    I+  R+                +   + +         +    D+
Sbjct: 31  LPGEARQYDLSSQDRIIRGRM-----------PTLEMVNERFARLWRIGLFNLIRRSADL 79

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S       KF+  +HS       +            I     LV T+++N  G       
Sbjct: 80  SVRGIDLVKFNEYMHSLYVPTNLNLIRFKPLRGTGLIVFEPTLVFTVVDNFFGGDGRFHT 139

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++  R  +  E ++ +  + Q  A L +  +   +     E                 E+
Sbjct: 140 RIEGREFTATEMRVIQLMLKQTFADLKEAWAPVMDVD--FEYINSEINPHFANIVTPREY 197

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLN 239
           V     ++ +E       + +P   L     +  +  Q+   ++ +        +     
Sbjct: 198 VVVCRFHVELEGGGGEIHITLPYSMLEPIRELLDAGIQSDRNDRDDSWNVMLREQLDTAE 257

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           V + + +  K+ +L+ +  LK+G ++P     +    L      +++ E G    N  ++
Sbjct: 258 VTLSSVLASKRMSLRQLTGLKVGDILPIDLPAQVP--LCVEDIPLFTGEFGVSNGNNAVK 315

Query: 300 IT 301
           IT
Sbjct: 316 IT 317


>gi|209695733|ref|YP_002263663.1| flagellar motor switch protein FliM [Aliivibrio salmonicida
           LFI1238]
 gi|208009686|emb|CAQ79985.1| polar flagellar switch protein FliM (flagellar motor switch protein
           FliM) [Aliivibrio salmonicida LFI1238]
          Length = 343

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 32/297 (10%), Positives = 87/297 (29%), Gaps = 11/297 (3%)

Query: 13  LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSH 72
                  R+                +   + + +       +    ++S       KF  
Sbjct: 37  FDFSSQDRIVRG------RMPTLELINERFARHMRISLFNMLRKTAEVSINGVSMVKFGE 90

Query: 73  IIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEK 132
             ++       +            +     LV  L+EN  G       ++  R  +  E+
Sbjct: 91  YQNTLYVPTSLNMVRFRPLKGTALVTMEARLVFILVENFFGGDGRFHAKIEGREFTPTER 150

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
           ++ +  +  +     +  S         E                 E +   + ++ ++ 
Sbjct: 151 RIIQLLLKVVFEDYKEAWSPVMGVE--FEYLDSEVNPTMANIVSPTEVIVVSSFHIEVDG 208

Query: 193 VASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
               F ++ P   +     +  +  Q+   +           +   + V +   +   + 
Sbjct: 209 GGGDFHVVFPYSMVEPIRELLDAGVQSDKMDTDVRWSKALRDEIMDVPVEMKVNLLESEI 268

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
           +L+D++ L+ G +IP        A +       Y  ++G+ G    ++IT++I    
Sbjct: 269 SLRDLMDLQAGDIIPIEMP--EAATVFVEDLPTYRGKVGKSGDKLAVQITEKIKRPD 323


>gi|212639555|ref|YP_002316075.1| flagellar motor switch protein FliM [Anoxybacillus flavithermus
           WK1]
 gi|212561035|gb|ACJ34090.1| Flagellar motor switch protein FliM [Anoxybacillus flavithermus
           WK1]
          Length = 335

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 44/284 (15%), Positives = 104/284 (36%), Gaps = 7/284 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +  + +   + + L   F  ++   V IS  S     +   I S  +  + +   
Sbjct: 52  SKDQIRSLTRMHENFARLLTTFFSAQLRTYVQISVASADQLPYEEFIRSIPKMTILTVFE 111

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +        +  + N+   +L+ +LG    ++ ++ N  L+ +E K+      +  + L 
Sbjct: 112 VPPLDGRVLLEVNPNIAYAMLDRVLGGRGVSLNKIEN--LTEIETKIMSNLFEKAFSNLR 169

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +   +  +  P L DF      +       NE V  I++N  I + +    + IP   L 
Sbjct: 170 EAWESVADIDPMLTDFEV--NPQFLQMVSPNETVVVISLNTQIGDTSGMINICIPHVVLE 227

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                       Q + + +  + +    ++  Q  V +   +     ++++ + L +G V
Sbjct: 228 PIIPKLSVHYWMQTQKKAREPEEVATLQKRLKQTKVPMIAELGTSTISIQEFLQLSVGDV 287

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
           I      +   ++       +  + G++ K   I+I D I  + 
Sbjct: 288 IQLDQTVRDPLVIKVGDVPKFIGQPGKMNKRLAIQILDVIKGED 331


>gi|209522293|ref|ZP_03270920.1| flagellar motor switch protein FliM [Burkholderia sp. H160]
 gi|209497269|gb|EDZ97497.1| flagellar motor switch protein FliM [Burkholderia sp. H160]
          Length = 332

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 36/310 (11%), Positives = 88/310 (28%), Gaps = 11/310 (3%)

Query: 2   RGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDIS 61
             QS      P +     R+                +   + + L       M    +IS
Sbjct: 27  SEQSDRSGVRPYNIATQERIVRG------RMPGLEIINDRFARLLRVGIFNFMRRSAEIS 80

Query: 62  YTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQ 121
               +  K+S    +       +   +             NLV  +++NL G       +
Sbjct: 81  VGPVKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFDPNLVFFVVDNLFGGDGRFHTR 140

Query: 122 LYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFV 181
           +  R  +  E+++  + +            + +               +       NE V
Sbjct: 141 VEGRDFTQTEQRIIMKLLNLTFEHYTASWKSVRPLQFEYVRSEMHT--QFANVATPNEIV 198

Query: 182 TTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNV 240
                ++   +   +  + +P   +     I  S  Q ++ +     +   +++     V
Sbjct: 199 IVTQFSIEFGSTGGTLHICMPYSMIEPIRDILSSPIQGEAMDVDRRWVRVLSQQVQAAEV 258

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            +   +     T + ++ ++ G V+P             +G  +  C  G     Y +R+
Sbjct: 259 QLTADLAQVPVTFEQILNMRKGDVLPINIP--ERITAKVDGVPVMECGYGIFNGQYALRV 316

Query: 301 TDRINFDQKS 310
              I+     
Sbjct: 317 QKMISAADTM 326


>gi|53717666|ref|YP_106652.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           K96243]
 gi|76811753|ref|YP_331656.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           1710b]
 gi|126441392|ref|YP_001057084.1| flagellar motor switch protein FliM [Burkholderia pseudomallei 668]
 gi|126453439|ref|YP_001064314.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           1106a]
 gi|134281495|ref|ZP_01768203.1| flagellar motor switch protein FliM [Burkholderia pseudomallei 305]
 gi|167717395|ref|ZP_02400631.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           DM98]
 gi|167736438|ref|ZP_02409212.1| flagellar motor switch protein FliM [Burkholderia pseudomallei 14]
 gi|167813512|ref|ZP_02445192.1| flagellar motor switch protein FliM [Burkholderia pseudomallei 91]
 gi|167822054|ref|ZP_02453525.1| flagellar motor switch protein FliM [Burkholderia pseudomallei 9]
 gi|167843667|ref|ZP_02469175.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           B7210]
 gi|167892138|ref|ZP_02479540.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           7894]
 gi|167900650|ref|ZP_02487855.1| flagellar motor switch protein FliM [Burkholderia pseudomallei NCTC
           13177]
 gi|167908870|ref|ZP_02495961.1| flagellar motor switch protein FliM [Burkholderia pseudomallei 112]
 gi|167916909|ref|ZP_02504000.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           BCC215]
 gi|217424100|ref|ZP_03455600.1| flagellar motor switch protein FliM [Burkholderia pseudomallei 576]
 gi|226193119|ref|ZP_03788729.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           Pakistan 9]
 gi|237814422|ref|YP_002898873.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           MSHR346]
 gi|242315986|ref|ZP_04815002.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           1106b]
 gi|254184092|ref|ZP_04890683.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           1655]
 gi|254186558|ref|ZP_04893075.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254194648|ref|ZP_04901079.1| flagellar motor switch protein FliM [Burkholderia pseudomallei S13]
 gi|254258129|ref|ZP_04949183.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           1710a]
 gi|254298640|ref|ZP_04966091.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           406e]
 gi|52208080|emb|CAH34010.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           K96243]
 gi|76581206|gb|ABA50681.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           1710b]
 gi|126220885|gb|ABN84391.1| flagellar motor switch protein FliM [Burkholderia pseudomallei 668]
 gi|126227081|gb|ABN90621.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           1106a]
 gi|134247162|gb|EBA47248.1| flagellar motor switch protein FliM [Burkholderia pseudomallei 305]
 gi|157808681|gb|EDO85851.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           406e]
 gi|157934243|gb|EDO89913.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           Pasteur 52237]
 gi|169651398|gb|EDS84091.1| flagellar motor switch protein FliM [Burkholderia pseudomallei S13]
 gi|184214624|gb|EDU11667.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           1655]
 gi|217393163|gb|EEC33185.1| flagellar motor switch protein FliM [Burkholderia pseudomallei 576]
 gi|225934719|gb|EEH30696.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           Pakistan 9]
 gi|237504112|gb|ACQ96430.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           MSHR346]
 gi|242139225|gb|EES25627.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           1106b]
 gi|254216818|gb|EET06202.1| flagellar motor switch protein FliM [Burkholderia pseudomallei
           1710a]
          Length = 332

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 35/307 (11%), Positives = 88/307 (28%), Gaps = 11/307 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           +      P +     R+                +   + + L       M    +IS + 
Sbjct: 30  AEASGIRPYNIATQERIVRG------RMPGLEIINDRFARLLRIGIFNFMRRTAEISVSQ 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +  K+S    +       +   +             NLV  +++NL G       ++  
Sbjct: 84  VKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFDPNLVFFVVDNLFGGDGRFHTRVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  + +  +         + +               +       NE V   
Sbjct: 144 RDFTATEQRIIGKLLNLVFEHYASAWKSVRPLQFEFVRSEMHT--QFANVATPNEIVIVT 201

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNID 243
             ++       +  + +P   +     +  S  Q ++       +   +++     V + 
Sbjct: 202 QFSIEFGPTGGTLHICMPYSMIEPIRDVLSSPIQGEALEVDRRWVRVLSQQVQSAEVELV 261

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
             +    TT + ++ L+ G V+P             +G  +  C  G     Y +R+   
Sbjct: 262 ADLAEVPTTFEKILNLRTGDVLPLDIT--DSITAKVDGVPVMECGYGIFNGQYALRVQRM 319

Query: 304 INFDQKS 310
           I+     
Sbjct: 320 ISASDTM 326


>gi|315127312|ref|YP_004069315.1| flagellar motor switch protein FliM [Pseudoalteromonas sp. SM9913]
 gi|315015826|gb|ADT69164.1| flagellar motor switch protein FliM [Pseudoalteromonas sp. SM9913]
          Length = 363

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 41/314 (13%), Positives = 97/314 (30%), Gaps = 11/314 (3%)

Query: 2   RGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDIS 61
            G+    +T         R+                +   + + +       M    ++S
Sbjct: 27  DGEDGEGSTLQYDFSSQDRIVRG------RMPTLEIVNERFARHMRISLFNMMRRTAEVS 80

Query: 62  YTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQ 121
               Q  KF   IH+       +            I     LV  L++N  G       +
Sbjct: 81  INGVQMIKFGEYIHTLFVPTSLNMVRFRPLKGTGLITMEARLVFILVDNFFGGDGRYHAK 140

Query: 122 LYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFV 181
           +  R  +  E+++ +  +  I     +  +   +   + E                 E V
Sbjct: 141 IEGREFTPTERRIVQMLLKIIFEDYKEAWAPVMDV--SFEYLDSEVNPAMANIVSPTEVV 198

Query: 182 TTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNV 240
              + ++ ++     F + +P   L     +  +  Q+ +E+           +   + V
Sbjct: 199 VISSFHIELDGGGGDFHIALPYSMLEPIRELLDAGVQSDTEDTDLRWSKALRDEIMDVEV 258

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
           ++ T++     +LK ++ LK G +IP          +       +  ++GR   N  ++I
Sbjct: 259 DLSTQLLEVDLSLKQIMELKAGDIIPVEMP--EHITVFVEELPTFRAKMGRSRDNVALQI 316

Query: 301 TDRINFDQKSLKNF 314
           +++I          
Sbjct: 317 SEKIKRPDSVKSEL 330


>gi|78047547|ref|YP_363722.1| flagellar motor switch protein FliM [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|78035977|emb|CAJ23668.1| flagellar motor switch protein FliM [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 337

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 41/302 (13%), Positives = 97/302 (32%), Gaps = 16/302 (5%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           + G++   + S    I+  R+                +   + +         +    D+
Sbjct: 31  LPGEARQYDLSSQDRIIRGRM-----------PTLEMVNERFARLWRIGLFNLIRRSADL 79

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S       KF+  +HS       +            I     LV T+++N  G       
Sbjct: 80  SVRGIDLVKFNEYMHSLYVPTNLNLIRFKPLRGTGLIVFEPTLVFTVVDNFFGGDGRFHT 139

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++  R  +  E ++ +  + Q  A L +  +   +     E                 E+
Sbjct: 140 RIEGREFTATEMRVIQLMLKQTFADLKEAWAPVMDVD--FEYINSEINPHFANIVTPREY 197

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLN 239
           V     ++ +E       + +P   L     +  +  Q+   ++ +        +     
Sbjct: 198 VVVCRFHVELEGGGGEIHITLPYSMLEPIRELLDAGIQSDRNDRDDSWNVMLREQLDTAE 257

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           V + + +  K+ +L+ +  LK+G ++P     +    L      +++ E G    N  ++
Sbjct: 258 VTLSSVLASKRMSLRQLTGLKVGDILPIDLPAQVP--LCVEDIPLFTGEFGVSNGNNAVK 315

Query: 300 IT 301
           IT
Sbjct: 316 IT 317


>gi|307731349|ref|YP_003908573.1| flagellar motor switch protein FliM [Burkholderia sp. CCGE1003]
 gi|307585884|gb|ADN59282.1| flagellar motor switch protein FliM [Burkholderia sp. CCGE1003]
          Length = 332

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 36/308 (11%), Positives = 87/308 (28%), Gaps = 11/308 (3%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           QS      P +     R+                +   + + L       M    +IS  
Sbjct: 29  QSERVGVRPYNIATQERIVRG------RMPGLEIINDRFARLLRVGIFNFMRRSAEISVG 82

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
             +  K+S    +       +   +             NLV  +++NL G       ++ 
Sbjct: 83  PVKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFDPNLVFFVVDNLFGGDGRFHTRVE 142

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  +  E+++  + +  +         + +               +       NE V  
Sbjct: 143 GREFTQTEQRIISKLLNLVFEHYAASWKSVRPLQFEYMRSEMHT--QFANVATPNEIVIV 200

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNI 242
              ++       +  + +P   +     I  S  Q ++       +   +++     V +
Sbjct: 201 TQFSIEFGTTGGTLHICMPYSMIEPIRDILSSPIQGEALEVDRRWVRVLSQQVQSAEVEL 260

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
              +     T + ++ ++ G V+P             +G  +  C  G     Y +R+  
Sbjct: 261 TADLAQVPITFEQILNMRKGDVLPINIP--EQITAKVDGVPVMECGYGIFNGQYALRVQR 318

Query: 303 RINFDQKS 310
            I+     
Sbjct: 319 MISAADTM 326


>gi|56460301|ref|YP_155582.1| flagellar motor switch protein FliM [Idiomarina loihiensis L2TR]
 gi|56179311|gb|AAV82033.1| Flagellar motor switch protein [Idiomarina loihiensis L2TR]
          Length = 356

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 36/306 (11%), Positives = 96/306 (31%), Gaps = 11/306 (3%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           +S   +          R+                +   + + +       M    ++S  
Sbjct: 30  ESASADALDYDFSSQDRIVRG------RMPTLEIVNERFARHMRVSLFNMMRRTAEVSIN 83

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
             Q  KF   +H+       +            I     LV  L++N  G       ++ 
Sbjct: 84  GVQMIKFGEYVHTLFVPTSLNMVRFRPLKGTALITMEARLVFILVDNFFGGDGRYHAKIE 143

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  +  E+++ +  +  +     +  +   +     E                 E +  
Sbjct: 144 GREFTPTERRIIQMLLKLVFEDYKEAWAPVMDV--GFEYLDSEVNPAMANIVSPTEVIVI 201

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNI 242
            + ++ ++     F + +P   L     +  +  Q+  E+           +   + V +
Sbjct: 202 SSFHIELDGGGGDFHIALPYSMLEPIRELLDAGVQSDKEDTDMRWSKALRDEIMDVPVEM 261

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
             ++   + +L++V+ L+ G VIP    +     +       +  ++GR   N  ++I++
Sbjct: 262 IAKLAQTEMSLREVMDLREGDVIPLELPDD--LTVLIEDLPTFHAKMGRSRDNVALKISE 319

Query: 303 RINFDQ 308
           +I   +
Sbjct: 320 KIKRPE 325


>gi|187925747|ref|YP_001897389.1| flagellar motor switch protein FliM [Burkholderia phytofirmans
           PsJN]
 gi|187716941|gb|ACD18165.1| flagellar motor switch protein FliM [Burkholderia phytofirmans
           PsJN]
          Length = 332

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 36/308 (11%), Positives = 88/308 (28%), Gaps = 11/308 (3%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           QS      P +     R+                +   + + L       M    +IS  
Sbjct: 29  QSDRVGVRPYNIATQERIVRG------RMPGLEIINDRFARLLRVGIFNFMRRSAEISVG 82

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
             +  K+S    +       +   +             NLV  +++NL G       ++ 
Sbjct: 83  PVKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFDPNLVFFVVDNLFGGDGRFHTRVE 142

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  +  E+++  + +  +         + +               +       NE V  
Sbjct: 143 GRDFTQTEQRIINKLLNLVFDNYTASWKSVRPLQFEYVRSEMHT--QFANVATPNEIVIV 200

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNI 242
              ++       +  + +P   +     I  S  Q ++       +   +++     V +
Sbjct: 201 TQFSIEFGTTGGTLHICMPYSMIEPIRDILSSPIQGEALEVDRRWVRVLSQQVQAAEVEL 260

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
              +     T + ++ ++ G V+P             +G  +  C  G     Y +R+  
Sbjct: 261 TADLAQVPVTFEQILNMRKGDVLPINIP--EHITAKVDGVPVMECGYGIFNGQYALRVQK 318

Query: 303 RINFDQKS 310
            I+  +  
Sbjct: 319 MISAAETM 326


>gi|289666107|ref|ZP_06487688.1| flagellar motor switch protein FliM [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 337

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 43/302 (14%), Positives = 97/302 (32%), Gaps = 16/302 (5%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           + G++   + S    I+  R+                +   + +         +    D+
Sbjct: 31  LPGEARQYDLSSQDRIIRGRM-----------PTLEMVNERFARLWRIGLFNLIRRSADL 79

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S       KF+  +HS       +            I     LV T+++N  G       
Sbjct: 80  SVRGIDLVKFNEYMHSLYVPTNLNLIRFKPLRGTGLIVFEPTLVFTVVDNFFGGDGRYHT 139

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++  R  +  E ++ +  + Q  A L +  +   +     E                 E+
Sbjct: 140 RIEGREFTATEMRVVQLMLKQTFADLKEAWAPVMDVD--FEYINSEINPHFANIVTPREY 197

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLN 239
           V     ++ +E       + +P   L     +  +  Q+   ++ +        +     
Sbjct: 198 VVVCRFHVELEGGGGEIHITLPYSMLEPIRELLDAGIQSDRNDRDDSWNVMLREQLDTAE 257

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           V + + +  K+ TL+ +  LK+G V+P     +    L      +++ E G    N  ++
Sbjct: 258 VTLSSVLASKRMTLRQLTGLKVGDVLPIELPAQVP--LCVEDIPLFTGEFGISNGNNAVK 315

Query: 300 IT 301
           IT
Sbjct: 316 IT 317


>gi|77359748|ref|YP_339323.1| flagellar motor switch protein FliM [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76874659|emb|CAI85880.1| flagellar biosynthesis; component of motor switch and energizing
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 363

 Score =  253 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 41/313 (13%), Positives = 96/313 (30%), Gaps = 11/313 (3%)

Query: 3   GQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISY 62
           G+    NT         R+                +   + + +       M    ++S 
Sbjct: 28  GEDGEGNTLQYDFSSQDRIVRG------RMPTLEIVNERFARHMRISLFNMMRRTAEVSI 81

Query: 63  TSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQL 122
              Q  KF   +H+       +            I     LV  L++N  G       ++
Sbjct: 82  NGVQMIKFGEYVHTLFVPTSLNMVRFRPLKGTGLITMEARLVFILVDNFFGGDGRYHAKI 141

Query: 123 YNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVT 182
             R  +  E+++ +  +  I     +  +   +   + E                 E V 
Sbjct: 142 EGREFTPTERRIVQMLLKIIFEDYKEAWAPVMDV--SFEYLDSEVNPAMANIVSPTEVVV 199

Query: 183 TINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVN 241
             + ++ ++     F + +P   L     +  +  Q+ +E+           +   + V 
Sbjct: 200 ISSFHIELDGGGGDFHIALPYSMLEPIRELLDAGVQSDTEDTDLRWSKALRDEIMDVEVE 259

Query: 242 IDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
           + T++     TLK ++ LK G +IP          +       +  ++GR   +  ++I+
Sbjct: 260 LSTQLLEVDLTLKQIMELKAGDIIPVEMP--EHITVFVEELPTFRAKMGRSRDSVALQIS 317

Query: 302 DRINFDQKSLKNF 314
           ++I          
Sbjct: 318 EKIKRPDSVKSEL 330


>gi|88858101|ref|ZP_01132743.1| flagellar motor switch protein [Pseudoalteromonas tunicata D2]
 gi|88819718|gb|EAR29531.1| flagellar motor switch protein [Pseudoalteromonas tunicata D2]
          Length = 364

 Score =  253 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 41/300 (13%), Positives = 94/300 (31%), Gaps = 11/300 (3%)

Query: 10  TSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGK 69
            S        R+                +   + + +       M    ++S    Q  K
Sbjct: 36  ASQYDFSSQDRIVRG------RMPTLEIVNERFARHMRISLFNMMRRTAEVSINGVQMIK 89

Query: 70  FSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLST 129
           F   IH+       +            I     LV  L++N  G       ++  R  + 
Sbjct: 90  FGEYIHTLFVPTSLNMVRFRPLKGTGLITMEARLVFILVDNFFGGDGRYHAKIEGREFTP 149

Query: 130 VEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMT 189
            E+++ +  +  I     +  +   +   + E                 E V   + ++ 
Sbjct: 150 TERRIVQMLLKIIFEDYKEAWAPVMDV--SFEYLDSEVNPAMANIVSPTEVVVISSFHIE 207

Query: 190 IENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINL 248
           ++     F + +P   L     +  +  Q+ +E+           +   + V + TR+  
Sbjct: 208 LDGGGGDFHIALPYSMLEPIRELLDAGVQSDTEDTDLRWSKALRDEIMDVEVGLSTRMLE 267

Query: 249 KKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
            K +L+ ++ L+ G VIP          +       +  ++GR   N  ++I+++I    
Sbjct: 268 VKLSLEQIMNLQAGDVIPVEMP--EHITVFIEDLPTFRAKMGRSRDNVALQISEKIKRPD 325


>gi|89098632|ref|ZP_01171514.1| flagellar motor switch protein M [Bacillus sp. NRRL B-14911]
 gi|89086594|gb|EAR65713.1| flagellar motor switch protein M [Bacillus sp. NRRL B-14911]
          Length = 332

 Score =  253 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 45/311 (14%), Positives = 101/311 (32%), Gaps = 13/311 (4%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           ++ +   K           R        K   +  + +   + + L   F  ++   V I
Sbjct: 28  LKKEQSEKKVKVYDFKRALRF------SKDQVRSLTRIHENFARLLTTFFSAQLRTYVQI 81

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S  S     +   I S  +  + +   +        +  + N+   +++ ++G    +I 
Sbjct: 82  SVASADQIPYEEFIRSIPKMTILNVFEVPPLDGRILMEVNPNIAYAMMDRMMGGRGSSIN 141

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++    L+ +E K+   T  +    L +  ST  E  P L         +       NE 
Sbjct: 142 KVDT--LTEIETKIMSNTFERAFEHLREAWSTITEIDPFL--AEFEINPQFLQMVSPNET 197

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQ 237
           V  I++N  I   +    + IP   L             Q + + +  + +        +
Sbjct: 198 VVVISLNTMIGETSGMINICIPHVVLEPIIPKLSVHYWMQTEKKEREPEELGRLEDSIQK 257

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             V +   +     +++D + L +G VI           +       ++ + G+  K   
Sbjct: 258 AQVPVSAELGSADISIQDFLMLDLGDVIELNQAIDRPLTIKIGDIPKFTGQPGKANKKLA 317

Query: 298 IRITDRINFDQ 308
           I+I D +    
Sbjct: 318 IQILDTLKGGD 328


>gi|296133037|ref|YP_003640284.1| flagellar motor switch protein FliM [Thermincola sp. JR]
 gi|296031615|gb|ADG82383.1| flagellar motor switch protein FliM [Thermincola potens JR]
          Length = 333

 Score =  252 bits (644), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 42/285 (14%), Positives = 98/285 (34%), Gaps = 7/285 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K       ++   + + L       +   V ++  S +   +   I S     + +   
Sbjct: 50  SKEQIHTLQAIHENFARLLATFLSAHLRTVVTMNVHSVEQITYDEFIRSLPNPTLLNIFM 109

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +   + N  +  + N+  T+L+ L G   +   ++  R L+ +E+ + ++ I +   +L 
Sbjct: 110 MEPLAGNAILEVNPNVTFTILDRLFGGPGQAPEKM--RGLTDIERTVIEKVIIRCLQILK 167

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +         P LE                 E V  I+++ TI +      L IP   L 
Sbjct: 168 EAWENIIVFDPKLEIIET--NPMFTQIVSPTEMVVLISIHATIGDNEGIMNLCIPFIVLE 225

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                          ++  + + I    R+  +  + +   +      L +++ L+ G V
Sbjct: 226 PIISKLTAHFWFAGTAKTVTAEHIQNTQRRLEKAKITLSAVLGETTIKLGELLELQPGDV 285

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
           I   +R      +    ++ +    G VG    ++IT  +    +
Sbjct: 286 IQLDNRTTDELKILVGDRKKFYGRPGTVGSRLAVQITRLVKEGDE 330


>gi|319787093|ref|YP_004146568.1| flagellar motor switch protein FliM [Pseudoxanthomonas suwonensis
           11-1]
 gi|317465605|gb|ADV27337.1| flagellar motor switch protein FliM [Pseudoxanthomonas suwonensis
           11-1]
          Length = 339

 Score =  252 bits (644), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 35/301 (11%), Positives = 86/301 (28%), Gaps = 11/301 (3%)

Query: 10  TSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGK 69
             P       R+                +   + +         +    DIS       K
Sbjct: 36  ARPYDFASQDRIIRG------RMPTLEMVNERFARLWRIGLFNLIRRSADISVRGIDMIK 89

Query: 70  FSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLST 129
           F   +HS       +            +     LV  +++N  G       ++  R  + 
Sbjct: 90  FGEYMHSLYVPTNLNLVRFKPLRGMGLVVFEPKLVFAVVDNFFGGDGRYPTRIEGREFTV 149

Query: 130 VEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMT 189
            E ++ +  + Q  A L +  +   +     E                 E+V     ++ 
Sbjct: 150 TEMRVIQLMLRQTFADLVEAWAPVMDVE--FEYINSEINPHFANIVTPREYVVVSRFHVE 207

Query: 190 IENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINL 248
           ++       + +P   L     +  +  Q+   ++ E        +     V + + +  
Sbjct: 208 LDGGGGEIHVTLPYSMLEPIRELLDAGIQSDRIDRDESWNTTLREQLQLAEVTVSSVLAQ 267

Query: 249 KKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
           K+  L+ +  LK+G ++P          +      +++ + G       ++IT       
Sbjct: 268 KRIDLRQLTRLKVGDILPIDLST--TVPVCVENIPVFTGQFGVSNGCNAVKITRTHPPGS 325

Query: 309 K 309
           +
Sbjct: 326 E 326


>gi|73539704|ref|YP_300071.1| flagellar motor switch protein FliM [Ralstonia eutropha JMP134]
 gi|72123041|gb|AAZ65227.1| Flagellar motor switch protein FliM [Ralstonia eutropha JMP134]
          Length = 337

 Score =  252 bits (644), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 40/302 (13%), Positives = 89/302 (29%), Gaps = 10/302 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
                P +     R+                +   + + L       +    DI+  S +
Sbjct: 36  EGGVRPYNLATQERVIRG------RLHTLEIINERFARSLRTALFNFIRRGADITVGSVR 89

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
             KF     +       +   +             NLV  +++NL G       ++  R 
Sbjct: 90  IEKFGDFARNLPMPTNLNLVHMKPLRGTALFVYDPNLVFLVVDNLFGGDGRFHTRVEGRD 149

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E+++ +R +            T                 K       NE V T   
Sbjct: 150 FTQTEQRIIQRMLEMTLTSYGNAWRTVYPIETEYVRSEMHT--KFANVATVNEAVITTAF 207

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRI 246
           ++ +  V     + +P   +     + ++     +   +  +   + +    +V +    
Sbjct: 208 HIELGAVGGQLHVCLPYAMIEPLKDLLMNPLQDEKEVDKSWLAKLSTQLRAADVEVVAEF 267

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
              ++T+ +V+ L+ G V+P             NG  +  C  G +   Y +R+   IN 
Sbjct: 268 THVQSTVAEVLALRAGDVLPIELP--EHVFGKVNGVPVMQCGFGTINGQYALRVERMINH 325

Query: 307 DQ 308
             
Sbjct: 326 QD 327


>gi|116694517|ref|YP_728728.1| flagellar motor switch protein [Ralstonia eutropha H16]
 gi|113529016|emb|CAJ95363.1| flagellar motor switch protein [Ralstonia eutropha H16]
          Length = 339

 Score =  252 bits (644), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 40/302 (13%), Positives = 91/302 (30%), Gaps = 10/302 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
                P +     R+                +   + + +       +    DI+  S +
Sbjct: 35  EGGVRPYNLATQERIIRG------RLHTLEIINERFARSMRTALFNFIRRGADITVGSIR 88

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
             KF     +       +   L             NLV  +++NL G       ++  R 
Sbjct: 89  IEKFGDFARNLPMPTNLNLVHLKPLRGTALFVYDPNLVFLVVDNLFGGDGRFHTRVEGRD 148

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E+++ +R +    A       T        E      + K       NE V T   
Sbjct: 149 FTQTEQRIIQRMLELTLASYGNAWRTVHPIE--TEYIRSEMHPKFANVATHNEAVVTTAF 206

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRI 246
           ++ +  V     + +P   +     + ++     +   +  +   + +     V +    
Sbjct: 207 HIELGAVGGQLHVCLPYAMIEPLKDLLMNPLQDEKEVDKGWVTQLSTQLRAAEVELVAEF 266

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
              ++T+ +V+ ++ G V+P             +G  +  C  G +   Y +R+   IN 
Sbjct: 267 AHLQSTVAEVLAMRAGDVLPIELP--EKVFGKVDGVPVMQCGFGTMNGQYALRVERMINH 324

Query: 307 DQ 308
             
Sbjct: 325 QD 326


>gi|53723902|ref|YP_104282.1| flagellar motor switch protein FliM [Burkholderia mallei ATCC
           23344]
 gi|67641904|ref|ZP_00440669.1| flagellar motor switch protein FliM [Burkholderia mallei GB8 horse
           4]
 gi|121600665|ref|YP_994775.1| flagellar motor switch protein FliM [Burkholderia mallei SAVP1]
 gi|124385588|ref|YP_001027842.1| flagellar motor switch protein FliM [Burkholderia mallei NCTC
           10229]
 gi|126451066|ref|YP_001082210.1| flagellar motor switch protein FliM [Burkholderia mallei NCTC
           10247]
 gi|167000456|ref|ZP_02266270.1| flagellar motor switch protein FliM [Burkholderia mallei PRL-20]
 gi|254174753|ref|ZP_04881414.1| flagellar motor switch protein FliM [Burkholderia mallei ATCC
           10399]
 gi|254201359|ref|ZP_04907723.1| flagellar motor switch protein FliM [Burkholderia mallei FMH]
 gi|254206701|ref|ZP_04913052.1| flagellar motor switch protein FliM [Burkholderia mallei JHU]
 gi|254357364|ref|ZP_04973638.1| flagellar motor switch protein FliM [Burkholderia mallei
           2002721280]
 gi|52427325|gb|AAU47918.1| flagellar motor switch protein FliM [Burkholderia mallei ATCC
           23344]
 gi|121229475|gb|ABM51993.1| flagellar motor switch protein FliM [Burkholderia mallei SAVP1]
 gi|124293608|gb|ABN02877.1| flagellar motor switch protein FliM [Burkholderia mallei NCTC
           10229]
 gi|126243936|gb|ABO07029.1| flagellar motor switch protein FliM [Burkholderia mallei NCTC
           10247]
 gi|147747253|gb|EDK54329.1| flagellar motor switch protein FliM [Burkholderia mallei FMH]
 gi|147752243|gb|EDK59309.1| flagellar motor switch protein FliM [Burkholderia mallei JHU]
 gi|148026428|gb|EDK84513.1| flagellar motor switch protein FliM [Burkholderia mallei
           2002721280]
 gi|160695798|gb|EDP85768.1| flagellar motor switch protein FliM [Burkholderia mallei ATCC
           10399]
 gi|238522917|gb|EEP86359.1| flagellar motor switch protein FliM [Burkholderia mallei GB8 horse
           4]
 gi|243063644|gb|EES45830.1| flagellar motor switch protein FliM [Burkholderia mallei PRL-20]
          Length = 332

 Score =  252 bits (644), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 35/307 (11%), Positives = 88/307 (28%), Gaps = 11/307 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           +      P +     R+                +   + + L       M    +IS + 
Sbjct: 30  AEASGIRPYNIATQERIVRG------RMPGLEIINDRFARLLRIGIFNFMRRTAEISVSQ 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +  K+S    +       +   +             NLV  +++NL G       ++  
Sbjct: 84  VKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFDPNLVFFVVDNLFGGDGRFHTRVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  + +  +         + +               +       NE V   
Sbjct: 144 RDFTATEQRIIGKLLNLVFEHYASAWKSVRPLQFEFVRSEMHT--QFANVATPNEIVIAT 201

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNID 243
             ++       +  + +P   +     +  S  Q ++       +   +++     V + 
Sbjct: 202 QFSIEFGPTGGTLHICMPYSMIEPIRDVLSSPIQGEALEVDRRWVRVLSQQVQSAEVELV 261

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
             +    TT + ++ L+ G V+P             +G  +  C  G     Y +R+   
Sbjct: 262 ADLAEVPTTFEKILNLRTGDVLPLDIT--DSITAKVDGVPVMECGYGIFNGQYALRVQRM 319

Query: 304 INFDQKS 310
           I+     
Sbjct: 320 ISASDTM 326


>gi|325917742|ref|ZP_08179929.1| flagellar motor switch protein FliM [Xanthomonas vesicatoria ATCC
           35937]
 gi|325536041|gb|EGD07850.1| flagellar motor switch protein FliM [Xanthomonas vesicatoria ATCC
           35937]
          Length = 337

 Score =  252 bits (644), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 42/302 (13%), Positives = 97/302 (32%), Gaps = 16/302 (5%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           + G++   + S    I+  R+                +   + +         +    D+
Sbjct: 31  LPGEARQYDLSSQDRIIRGRM-----------PTLEMVNERFARLWRIGLFNLIRRSADL 79

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S       KF+  +HS       +            I     LV T+++N  G       
Sbjct: 80  SVRGIDLVKFNEYMHSLYVPTNLNLIRFKPLRGTGLIVFEPTLVFTVVDNFFGGDGRFHT 139

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++  R  +  E ++ +  + Q  A L +  +   E     E                 E+
Sbjct: 140 RIEGREFTATEMRVIQLMLKQTFADLKEAWAPVMEVD--FEYINSEINPHFANIVTPREY 197

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLN 239
           V     ++ +E       + +P   L     +  +  Q+   ++ +        +     
Sbjct: 198 VVVCRFHVELEGGGGEIHITLPYSMLEPIRELLDAGIQSDRNDRDDSWNVMLREQLNTAE 257

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           V + + +  K+ +L+ +  LK+G ++P     +    L      +++ E G    N  ++
Sbjct: 258 VTLSSVLASKRMSLRQLTGLKVGDILPIDLPAQVP--LCVEEIPMFTGEFGVSNGNNAVK 315

Query: 300 IT 301
           IT
Sbjct: 316 IT 317


>gi|34498585|ref|NP_902800.1| flagellar motor switch protein FliM [Chromobacterium violaceum ATCC
           12472]
 gi|34104439|gb|AAQ60797.1| flagellar motor switch protein [Chromobacterium violaceum ATCC
           12472]
          Length = 334

 Score =  252 bits (644), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 34/307 (11%), Positives = 89/307 (28%), Gaps = 11/307 (3%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
           +           R+                +   + + L       +  + +IS    + 
Sbjct: 32  QGVRGYDIGRQERIVRG------RMPTLEIINERFARNLRIGLFNFLRRNAEISVGPVRV 85

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSL 127
            K+S  I +       +   +        +    +LV  +++NL G+      ++  R  
Sbjct: 86  QKYSEFIRNLVVPTNLNLVHVKPLRGTGLLIFDPDLVFLIVDNLFGSDGRYHVRVEGRDF 145

Query: 128 STVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMN 187
           +  E+++  R +  +     +                     +        E V  +  +
Sbjct: 146 TPTEQRIIHRLLEVVFTECQKAWEPVYPIE--FVYLRSEMNTQFANIATPTEVVVAMTFH 203

Query: 188 MTIENVASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQLNVNIDTRI 246
           + +      F + +P   +     +  S  Q          ++    +     V +   +
Sbjct: 204 IELGAGGGDFHICLPYSMVEPIRDLLSSTMQADRTEVDNRWVNLMTHQVQAAEVELVASL 263

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
              K TL  ++ LK G V+              +G  ++    G V   Y +++   +  
Sbjct: 264 AHAKVTLGQILNLKNGDVVMIEIP--ERVEADVSGIPVFEASYGTVQGRYALKVEKILAG 321

Query: 307 DQKSLKN 313
             + L++
Sbjct: 322 TNEFLES 328


>gi|160896094|ref|YP_001561676.1| flagellar motor switch protein FliM [Delftia acidovorans SPH-1]
 gi|160361678|gb|ABX33291.1| flagellar motor switch protein FliM [Delftia acidovorans SPH-1]
          Length = 334

 Score =  252 bits (643), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 40/311 (12%), Positives = 102/311 (32%), Gaps = 7/311 (2%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEK--ISSSLGYLYKKFLPKIFKEKMDLDV 58
           + G+S    T  +   ++ +      ++    +      +   + +         +    
Sbjct: 18  VTGESQKSTTEEVEAGIIRQYDISSQERIVRGRMPTMEIVNERFARNFRIGLFNFIRRSP 77

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S  +    ++S  +        F+  ++     +  + C  +LV  +++ L G +   
Sbjct: 78  EVSVGTVSVQRYSAFLRELVVPTNFNIVAIRPLRGSGLVVCDPSLVFGVIDTLYGGTGRL 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSN 178
             ++  R  S  E+++  R +  I     +           L         +       +
Sbjct: 138 QTRIEGRDFSHTEQRVINRLVNVICEEYKKAWHGIYPLE--LGYQRSEMQPQFANIATPS 195

Query: 179 EFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQ 237
           E V +    + I +++ S  + +P  TL     +   S+Q  S       +    R+   
Sbjct: 196 EIVVSTAFQLEIGDISGSIHICMPYATLEPIRDVLYSSTQGDSIEVDRRWVKVLKREIQA 255

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             V +   +     T++ ++ ++ G  I            S  G  I+ C+ G     Y 
Sbjct: 256 AEVTLVAELARADATVEQLLAMRPGDFIELDREP--LIRASIGGVPIFECQYGTHNDKYA 313

Query: 298 IRITDRINFDQ 308
           IR+ + +    
Sbjct: 314 IRVENCLRGAD 324


>gi|170694407|ref|ZP_02885561.1| flagellar motor switch protein FliM [Burkholderia graminis C4D1M]
 gi|170140830|gb|EDT09004.1| flagellar motor switch protein FliM [Burkholderia graminis C4D1M]
          Length = 332

 Score =  252 bits (643), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 36/308 (11%), Positives = 86/308 (27%), Gaps = 11/308 (3%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           QS      P +     R+                +   + + L       M    +IS  
Sbjct: 29  QSERVGVRPYNIATQERIVRG------RMPGLEIINDRFARLLRVGIFNFMRRSAEISVG 82

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
             +  K+S    +       +   +             NLV  +++NL G       ++ 
Sbjct: 83  PVKVQKYSEFTRNLPIPTNLNLVHIKPLRGTSLFVFDPNLVFFVVDNLFGGDGRFHTRVE 142

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  +  E+++  + +            + +               +       NE V  
Sbjct: 143 GRDFTQTEQRIIMKLLNLTFEHYAASWKSVRPLQFEYMRSEMHT--QFANVATPNEIVIV 200

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNI 242
              ++       +  + +P   +     I  S  Q ++       +   +++     V +
Sbjct: 201 TQFSIEFGTTGGTLHICMPYSMIEPIRDILSSPIQGEALEVDRRWVRVLSQQVQAAEVEL 260

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
              +     T + ++ ++ G V+P             +G  +  C  G     Y +R+  
Sbjct: 261 TADLAQVPITFEQILNMRKGDVLPINIP--EHITAKVDGVPVMECGYGIFNGQYALRVQK 318

Query: 303 RINFDQKS 310
            I+     
Sbjct: 319 MISAADTM 326


>gi|166712025|ref|ZP_02243232.1| flagellar motor switch protein FliM [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 337

 Score =  252 bits (643), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 42/302 (13%), Positives = 98/302 (32%), Gaps = 16/302 (5%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           + G++   + S    I+  R+                +   + +         +    D+
Sbjct: 31  LPGEASQYDLSSQDRIIRGRM-----------PTLEMVNERFARLWRIGLFNLIRRSADL 79

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S       KF+  +HS       +            I     LV T+++N  G       
Sbjct: 80  SVRGIDLVKFNEYMHSLYVPTNLNLIRFKPLRGTGLIVFEPTLVFTVVDNFFGGDGRYHT 139

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++  R  +  E ++ +  + Q  A L +  +   +    LE                 E+
Sbjct: 140 RIEGREFTATEMRVVQLMLKQTFADLKEAWAPVMDVD--LEYINSEINPHFANIVTPREY 197

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLN 239
           V     ++ +E       + +P   L     +  +  Q+   ++ +        +     
Sbjct: 198 VVVCRFHVELEGGGGEIHITLPYSMLEPIRELLDAGIQSDRNDRDDSWNVMLREQLDTAE 257

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           V + + +  K+ +L+ +  LK+G ++P     +    L      +++ E G    N  ++
Sbjct: 258 VTLSSVLASKRMSLRQLTGLKVGDILPIDLPAQVP--LCVEEIPLFTGEFGVSNGNNAVK 315

Query: 300 IT 301
           IT
Sbjct: 316 IT 317


>gi|300113610|ref|YP_003760185.1| flagellar motor switch protein FliM [Nitrosococcus watsonii C-113]
 gi|299539547|gb|ADJ27864.1| flagellar motor switch protein FliM [Nitrosococcus watsonii C-113]
          Length = 336

 Score =  252 bits (643), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 40/309 (12%), Positives = 93/309 (30%), Gaps = 11/309 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
            K   P       R+       +    +   +   + +         +    +++    Q
Sbjct: 34  EKTIRPYDFSSEDRI------ARAYVPLLEMINERFARQFRLSLFNLLRRATEVTVGGVQ 87

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
             KFS  +H+       +   +              LV  L++   G S E   +L NR 
Sbjct: 88  VLKFSEYLHTLFMPTSLNLVQIHPLRGAGLFVFDPKLVFMLVDRYFGGSGEFYNRLENRE 147

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E  + +  + +    L Q        +   E        +  T    +E V     
Sbjct: 148 FTPTEMHIIQLVLERTFTDLKQAWEPVLAIN--FEYLQTEFNPRLATIASPSEIVVVSTF 205

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSSQNKS-ENQSEDLIDPFARKTYQLNVNIDTR 245
           ++  E     F + +P   L     +  + +                +      V +   
Sbjct: 206 HVEFEGGGGEFHIALPYTLLEPVRELLDTGKKDDFTQADGGWNQALRKNVSDAEVELSCT 265

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           +   + +LK+V+ LK G ++P      +     A+G  ++    G    +  +++ +R+ 
Sbjct: 266 LTEIRLSLKEVLALKSGDILPIELP--STVTALADGVPVFRVRYGIHNSSRALKVVERLL 323

Query: 306 FDQKSLKNF 314
             +   +  
Sbjct: 324 SPESFTEKL 332


>gi|145298353|ref|YP_001141194.1| flagellar motor switch protein FliM [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142851125|gb|ABO89446.1| Flagellar motor switch protein [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 356

 Score =  252 bits (643), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 38/307 (12%), Positives = 94/307 (30%), Gaps = 11/307 (3%)

Query: 3   GQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISY 62
           G +     +        R+                +   + + +       M    ++S 
Sbjct: 26  GAAGDPGVAQFDFSSQDRIVRG------RMPTLELVNERFARHMRISLFNMMRRTAEVSI 79

Query: 63  TSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQL 122
              Q  KF   +H+       +            I     LV  L+EN  G       ++
Sbjct: 80  NGVQMLKFGEYVHTLFVPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRYHAKI 139

Query: 123 YNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVT 182
             R  +  E+++ +  +  +        +   +     E                 E + 
Sbjct: 140 EGREFTPTERRIIQMLLKLVFEDYKDAWAPVMDV--GFEYLDSEVNPAMANIVSPTEVIV 197

Query: 183 TINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVN 241
             + ++ ++     F + +P   L     +  +  Q+   +           +   + V 
Sbjct: 198 VSSFHIELDGGGGDFHVAMPYSMLEPIRELLDAGVQSDKGDTDVRWSKALRDEIMDVKVE 257

Query: 242 IDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
           +  ++     TL++++ LK G +IP    E    ++       +  ++GR   N  ++IT
Sbjct: 258 LRAKLLETDLTLRELMELKPGDIIPVEMPEN--LLVYVEDLPTFHAKMGRTKDNVALKIT 315

Query: 302 DRINFDQ 308
           D++   +
Sbjct: 316 DKLKRPE 322


>gi|332533119|ref|ZP_08408988.1| flagellar motor switch protein FliM [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332037401|gb|EGI73855.1| flagellar motor switch protein FliM [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 363

 Score =  252 bits (643), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 41/307 (13%), Positives = 95/307 (30%), Gaps = 11/307 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +T         R+                +   + + +       M    ++S    Q  
Sbjct: 34  STLQYDFSSQDRIVRG------RMPTLEIVNERFARHMRISLFNMMRRTAEVSINGVQMI 87

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           KF   IH+       +            I     LV  L++N  G       ++  R  +
Sbjct: 88  KFGEYIHTLFVPTSLNMVRFRPLKGTGLITMEARLVFILVDNFFGGDGRYHAKIEGREFT 147

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++ +  +  I     +  +   +   + E                 E V   + ++
Sbjct: 148 PTERRIVQMLLKIIFEDYKEAWAPVMDV--SFEYLDSEVNPAMANIVSPTEVVVISSFHI 205

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            ++     F + +P   L     +  +  Q+ +E+           +   + V++ T++ 
Sbjct: 206 ELDGGGGDFHIALPYSMLEPIRELLDAGVQSDTEDTDLRWSKALRDEIMDVEVDMSTQLL 265

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
               TLK ++ LK G +IP          +       +  ++GR   N  ++I+++I   
Sbjct: 266 EVDLTLKQIMELKAGDIIPVEMP--EHITVFVEELPTFRAKMGRSRDNVALQISEKIKRP 323

Query: 308 QKSLKNF 314
                  
Sbjct: 324 DSVKSEL 330


>gi|94314217|ref|YP_587426.1| flagellar motor switch protein FliM [Cupriavidus metallidurans
           CH34]
 gi|93358069|gb|ABF12157.1| flagellar motor switch protein FliM [Cupriavidus metallidurans
           CH34]
          Length = 336

 Score =  252 bits (643), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 38/304 (12%), Positives = 93/304 (30%), Gaps = 10/304 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           +      P +     R+                +   + + L       +    DIS  +
Sbjct: 33  ADDGGVRPYNLANQERIVRG------RLHTLEIINERFARALRTALFNFIRRGADISVGT 86

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +  K+   + +       +   +             NLV  +++NL G       ++  
Sbjct: 87  VRIEKYGDFVRNLPVPTNLNLVHMKPLRGTALFVYDPNLVFLVVDNLFGGDGRFHTRVEG 146

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++ +R +    +   Q   T      +          K       N+ V T 
Sbjct: 147 RDFTQTEQRIIRRMLDLTLSSYGQAWRTVHPIEFDYVRSEMHT--KFANVAGPNDAVVTT 204

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDT 244
             ++ +  V     + IP   +     + ++         +  +   + +     V +  
Sbjct: 205 AFHIELGAVGGQLHICIPFSMIEPLRDLLMNPLQDEVEVDKRWLGQLSNQLRAAEVELVA 264

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
                ++T+ +V+ ++ G V+P             NG  +  C  G +   Y +R+   +
Sbjct: 265 EFTHLRSTVAEVLAMREGDVLPIELP--EHIFGKVNGVPVMQCGFGTMNGQYALRVERML 322

Query: 305 NFDQ 308
           N+  
Sbjct: 323 NYQD 326


>gi|330828806|ref|YP_004391758.1| flagellar motor switch protein FliM [Aeromonas veronii B565]
 gi|328803942|gb|AEB49141.1| Flagellar motor switch protein FliM [Aeromonas veronii B565]
          Length = 356

 Score =  251 bits (642), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 37/307 (12%), Positives = 95/307 (30%), Gaps = 11/307 (3%)

Query: 3   GQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISY 62
           G +     +        R+                +   + + +       M    ++S 
Sbjct: 26  GGAGDPGVAQFDFSSQDRIVRG------RMPTLELVNERFARHMRISLFNMMRRTAEVSI 79

Query: 63  TSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQL 122
              Q  KF   +H+       +            I     LV  L+EN  G       ++
Sbjct: 80  NGVQMLKFGEYVHTLFVPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRYHAKI 139

Query: 123 YNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVT 182
             R  +  E+++ +  +  +        +   +     E                 E + 
Sbjct: 140 EGREFTPTERRIIQMLLKLVFEDYKDAWAPVMDV--GFEYLDSEVNPAMANIVSPTEVIV 197

Query: 183 TINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVN 241
             + ++ ++     F + +P   L     +  +  Q+   +           +   + V 
Sbjct: 198 VSSFHIELDGGGGDFHVAMPYSMLEPIRELLDAGVQSDKGDTDVRWSKALRDEIMDVKVE 257

Query: 242 IDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
           +  ++   + TL++++ L+ G +IP    E    ++       +  ++GR   N  ++IT
Sbjct: 258 LRAKLLETELTLRELMELRPGDIIPVDMPEN--LLVFVEDLPTFHAKMGRTKDNVALKIT 315

Query: 302 DRINFDQ 308
           D++   +
Sbjct: 316 DKLKRPE 322


>gi|161523223|ref|YP_001578235.1| flagellar motor switch protein FliM [Burkholderia multivorans ATCC
           17616]
 gi|189348920|ref|YP_001944548.1| flagellar motor switch protein FliM [Burkholderia multivorans ATCC
           17616]
 gi|221201776|ref|ZP_03574813.1| flagellar motor switch protein FliM [Burkholderia multivorans
           CGD2M]
 gi|221207719|ref|ZP_03580727.1| flagellar motor switch protein FliM [Burkholderia multivorans CGD2]
 gi|221214537|ref|ZP_03587507.1| flagellar motor switch protein FliM [Burkholderia multivorans CGD1]
 gi|160340652|gb|ABX13738.1| flagellar motor switch protein FliM [Burkholderia multivorans ATCC
           17616]
 gi|189332942|dbj|BAG42012.1| flagellar motor switch protein [Burkholderia multivorans ATCC
           17616]
 gi|221165427|gb|EED97903.1| flagellar motor switch protein FliM [Burkholderia multivorans CGD1]
 gi|221172565|gb|EEE05004.1| flagellar motor switch protein FliM [Burkholderia multivorans CGD2]
 gi|221178196|gb|EEE10606.1| flagellar motor switch protein FliM [Burkholderia multivorans
           CGD2M]
          Length = 332

 Score =  251 bits (642), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 35/303 (11%), Positives = 87/303 (28%), Gaps = 11/303 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
              P +     R+                +   + + L       M    +IS +  +  
Sbjct: 34  GVRPYNIATQERIVRG------RMPGLEIINDRFARLLRIGIFNFMRRTAEISVSQVKVQ 87

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           K+S    +       +   +             NLV  +++NL G       ++  R  +
Sbjct: 88  KYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFDPNLVFFVVDNLFGGDGRFHTRVEGRDFT 147

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++  + +  +         + +               +       NE V     ++
Sbjct: 148 ATEQRIIGKLLNLVFEHYTVAWKSVRPLQFEFVRSEMHT--QFANVATPNEIVIVTQFSI 205

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
                  +  + +P   +     +  S  Q ++       +   +++     V +   + 
Sbjct: 206 EFGPTGGTLHICMPYSMIEPIRDVLSSPIQGEALEVDRRWVRVLSQQVQAAEVELTADLA 265

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
              TT + ++ L+ G V+P             +G  +  C  G     Y +R+   I+  
Sbjct: 266 EIPTTFEKILNLRAGDVLPLD--IADTITAKVDGVPVMECGYGIFNGQYALRVQKMISAS 323

Query: 308 QKS 310
              
Sbjct: 324 DTM 326


>gi|323527699|ref|YP_004229852.1| flagellar motor switch protein FliM [Burkholderia sp. CCGE1001]
 gi|323384701|gb|ADX56792.1| flagellar motor switch protein FliM [Burkholderia sp. CCGE1001]
          Length = 332

 Score =  251 bits (642), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 36/308 (11%), Positives = 86/308 (27%), Gaps = 11/308 (3%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           QS      P +     R+                +   + + L       M    +IS  
Sbjct: 29  QSERVGVRPYNIATQERIVRG------RMPGLEIINDRFARLLRVGIFNFMRRSAEISVG 82

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
             +  K+S    +       +   +             NLV  +++NL G       ++ 
Sbjct: 83  PVKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFDPNLVFFVVDNLFGGDGRFHTRVE 142

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  +  E+++  + +            + +               +       NE V  
Sbjct: 143 GRDFTQTEQRIIMKLLNLTFEHYAASWKSVRPLQFEYMRSEMHT--QFANVATPNEIVIV 200

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNI 242
              ++       +  + +P   +     I  S  Q ++       +   +++     V +
Sbjct: 201 TQFSIEFGTTGGTLHICMPYSMIEPIRDILSSPIQGEALEVDRRWVRVLSQQVQAAEVEL 260

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
              +     T + ++ ++ G V+P             +G  +  C  G     Y +R+  
Sbjct: 261 TADLAQVPITFEQILNMRKGDVLPINIP--EQITAKVDGVPVMECGYGIFNGQYALRVQK 318

Query: 303 RINFDQKS 310
            I+     
Sbjct: 319 MISAADTM 326


>gi|296135698|ref|YP_003642940.1| flagellar motor switch protein FliM [Thiomonas intermedia K12]
 gi|294339869|emb|CAZ88232.1| Flagellar motor switch [Thiomonas sp. 3As]
 gi|295795820|gb|ADG30610.1| flagellar motor switch protein FliM [Thiomonas intermedia K12]
          Length = 336

 Score =  251 bits (642), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 34/304 (11%), Positives = 90/304 (29%), Gaps = 11/304 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           +      P       R+                +   + +         +    +IS +S
Sbjct: 30  ADEGGVRPYDLASQDRIVRG------RMPTLEVINERFARLWRVSLFNFLRRASEISVSS 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +  K++  I         +   +              L+ ++++N  G       ++  
Sbjct: 84  VKLTKYNEFIRGLVVPSNLNLVQMKPLRGTALFIFDPRLIFSVIDNFFGGDGRFHARIEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  + +E+++ KR +  +        +      P L         +        E V   
Sbjct: 144 RDFTPLEQRIIKRMLDMVFKEYKTAWAPVLPLEPELTRSEV--NPQFVNIATPTEVVIVS 201

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQ-NKSENQSEDLIDPFARKTYQLNVNID 243
             ++ IE    S  + IP   +        +             +     +  +  V + 
Sbjct: 202 TFDVEIEGGGGSLHVCIPYSMVEPIRDQLTTGMTTDRSEVDHRWVKALQTEMREAEVEMR 261

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
             +  ++  +++++ L++G V+P         I   +G  +   E GR      ++I  +
Sbjct: 262 VELLQRQILVRELLNLRVGDVLPVDMP--ETVIARVDGIPVLLGEYGRHEDKMALKIRQQ 319

Query: 304 INFD 307
           +  +
Sbjct: 320 LFPE 323


>gi|124516745|gb|EAY58253.1| Flagellar motor switch protein FliM [Leptospirillum rubarum]
          Length = 338

 Score =  251 bits (642), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 41/304 (13%), Positives = 92/304 (30%), Gaps = 3/304 (0%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           ++  K      P+    L  +    +        +   + +F        +   V+ S  
Sbjct: 24  ETQAKAADSGEPVKQYNLASQERVIRGRMPTLEIINERFARFFQVTLSATLRKTVEFSPQ 83

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
             +  KF   +         +   L S   N  +     +V  L++++ G S     ++ 
Sbjct: 84  GIEMVKFGDFVKKIPMPSNINILRLESLRRNILLIIDARMVYLLVDHMFGGSGRGHVKIE 143

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  S +E ++++  +        +  +        +         +        E V T
Sbjct: 144 GRDFSPIEARISRNVMDLAIGDFEKAWAPVHPM--PITYIRSEINPQFAAIVAPTEMVVT 201

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISL-SSQNKSENQSEDLIDPFARKTYQLNVNI 242
           +   + I+    +  + IP  T+           Q+         I+    +  +  + I
Sbjct: 202 MAYRLEIDGQGRTIYICIPYSTIEPIKEKLYTGFQSDQYEVDSRWINRLQERVEEAPLEI 261

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
           +  I   + TL+D++  K G V            +   G   +    G    +  IRI  
Sbjct: 262 EAFIGETRFTLRDILGWKTGDVFSLDRYVSEPVEVRVEGIVRFLARPGIFRHHRAIRIER 321

Query: 303 RINF 306
           R+  
Sbjct: 322 RVPP 325


>gi|325920567|ref|ZP_08182489.1| flagellar motor switch protein FliM [Xanthomonas gardneri ATCC
           19865]
 gi|325548960|gb|EGD19892.1| flagellar motor switch protein FliM [Xanthomonas gardneri ATCC
           19865]
          Length = 337

 Score =  251 bits (642), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 42/302 (13%), Positives = 97/302 (32%), Gaps = 16/302 (5%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           + G++   + S    I+  R+                +   + +         +    D+
Sbjct: 31  LPGEARQYDLSSQDRIIRGRM-----------PTLEMVNERFARLWRIGLFNLIRRSADL 79

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S       KF+  +HS       +            I     LV T+++N  G       
Sbjct: 80  SVRGIDLVKFNEYMHSLYVPTNLNLIRFKPLRGTGLIVFEPTLVFTVVDNFFGGDGRYHT 139

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++  R  +  E ++ +  + Q  A L +  +   E     E                 E+
Sbjct: 140 RIEGREFTATEMRVVQLMLKQTFADLKEAWAPVMEVD--FEYINSEINPHFANIVTPREY 197

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLN 239
           V     ++ +E       + +P   L     +  +  Q+   ++ +        +     
Sbjct: 198 VVVCRFHVELEGGGGEIHITLPYSMLEPIRELLDAGIQSDRNDRDDSWNVMLREQLDTAE 257

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           V + + +  K+ +L+ +  LK+G ++P     +    L      +++ E G    N  ++
Sbjct: 258 VTLSSVLASKRMSLRQLTGLKVGDILPIDLPAQVP--LCVEEIPLFTGEFGVSNGNNAVK 315

Query: 300 IT 301
           IT
Sbjct: 316 IT 317


>gi|295678044|ref|YP_003606568.1| flagellar motor switch protein FliM [Burkholderia sp. CCGE1002]
 gi|295437887|gb|ADG17057.1| flagellar motor switch protein FliM [Burkholderia sp. CCGE1002]
          Length = 332

 Score =  251 bits (642), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 34/310 (10%), Positives = 88/310 (28%), Gaps = 11/310 (3%)

Query: 2   RGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDIS 61
             Q+      P +     R+                +   + + L       M    +IS
Sbjct: 27  SEQNDRTGVRPYNIATQERIVRG------RMPGLEIINDRFARLLRVGIFNFMRRSAEIS 80

Query: 62  YTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQ 121
               +  K+S    +       +   +             NLV  +++NL G       +
Sbjct: 81  VGPVKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFDPNLVFFVVDNLFGGDGRFHTR 140

Query: 122 LYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFV 181
           +  R  +  E+++  + +            + +               +       NE V
Sbjct: 141 VEGRDFTQTEQRIITKLLNLTFEHYTASWKSVRPLQFEYVRSEMHT--QFANVATPNEIV 198

Query: 182 TTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNV 240
                ++   +   +  + +P   +     +  S  Q ++ +     +   +++     V
Sbjct: 199 IVTQFSIEFGSTGGTLHICMPYSMIEPIRDVLSSPIQGEAMDVDRRWVRVLSQQVQAAEV 258

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            +   +     T + ++ ++ G V+P             +G  +  C  G     Y +R+
Sbjct: 259 QLTADLAQVPVTFEQILNMRKGDVLPINIP--EHITAKVDGVPVMECGYGIFNGQYALRV 316

Query: 301 TDRINFDQKS 310
              I+     
Sbjct: 317 QKMISAADTM 326


>gi|220934501|ref|YP_002513400.1| flagellar motor switch protein FliM [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995811|gb|ACL72413.1| flagellar motor switch protein FliM [Thioalkalivibrio sp. HL-EbGR7]
          Length = 326

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 42/306 (13%), Positives = 94/306 (30%), Gaps = 11/306 (3%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           Q+              R+                +   + + +       +    +IS  
Sbjct: 31  QAHDGVARGYDFTSQDRIVRG------RMPTLEMINERFARQMRISLFNLLRRSAEISVG 84

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
             +  KFS  +H+       +   +              LV  L++N  G       ++ 
Sbjct: 85  GIKMTKFSEYVHTLFVPTSLNMVKIKPLRGTALFVVDPKLVFILVDNFFGGDGRYHAKIE 144

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  +  E ++ + T+ Q    L +  +   +     E        +        E V  
Sbjct: 145 GREFTPTELRVIRMTLDQAFTDLKKAWAPVMDLD--FEYINSEVNPQFANIVSPTEVVCV 202

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNI 242
            + ++ ++       + +P   +     +  +  Q+   +  E  I     +     V +
Sbjct: 203 SSFHIELDGGGGDLHVTMPYSMIEPMRELLDAGIQSDRSDVDERWIRALRDEVKAAEVEL 262

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
            + +     +L+DV+ LK G +IP         +L A G  +   + G       I++T+
Sbjct: 263 SSMLTETTLSLEDVMRLKPGDIIPIDLP--EQVLLRAEGIPVLRGKFGVSDGYNAIKVTE 320

Query: 303 RINFDQ 308
           RI    
Sbjct: 321 RIRRAD 326


>gi|167560937|ref|ZP_02353853.1| flagellar motor switch protein FliM [Burkholderia oklahomensis
           EO147]
 gi|167568197|ref|ZP_02361071.1| flagellar motor switch protein FliM [Burkholderia oklahomensis
           C6786]
          Length = 332

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 34/307 (11%), Positives = 89/307 (28%), Gaps = 11/307 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           +      P +     R+                +   + + L       M    +IS + 
Sbjct: 30  AEASGVRPYNIATQERIVRG------RMPGLEIINDRFARLLRIGIFNFMRRTAEISVSQ 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +  K+S    +       +   +             NLV  +++NL G       ++  
Sbjct: 84  VKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFDPNLVFFVVDNLFGGDGRFHTRVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  + +  +    +    + +               +       NE V   
Sbjct: 144 RDFTATEQRIIGKLLNLVFEHYSVAWKSVRPLQFEFVRSEMHT--QFANVATPNEIVIVT 201

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNID 243
             ++       +  + +P   +     +  S  Q ++       +   +++     V + 
Sbjct: 202 QFSIEFGPTGGTLHICMPYSMIEPIRDVLSSPIQGEALEVDRRWVRVLSQQVQSAEVELV 261

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
             +    TT + ++ L+ G V+P             +G  +  C  G     Y +R+   
Sbjct: 262 ADLAEIPTTFEKILNLRAGDVLPLD--IAETLTAKVDGVPVMECGYGIFNGQYALRVQKM 319

Query: 304 INFDQKS 310
           ++     
Sbjct: 320 VSASDTM 326


>gi|124265765|ref|YP_001019769.1| flagellar motor switch protein [Methylibium petroleiphilum PM1]
 gi|124258540|gb|ABM93534.1| flagellar motor switch protein [Methylibium petroleiphilum PM1]
          Length = 333

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 44/307 (14%), Positives = 103/307 (33%), Gaps = 7/307 (2%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEK--ISSSLGYLYKKFLPKIFKEKMDLDV 58
           + G+S    T  +    +        ++    +      +   + + +       +    
Sbjct: 18  ITGESQKLETEEVEQGGVRDYNLASQERIVRGRMPTMEIINERFSRNIRIGLFNFIRRTP 77

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           +++  + +  K+S  +        F+  ++     +  I C   LV  +++ L G + + 
Sbjct: 78  EVAVGTIKVQKYSAFLREIVVPTNFNIMAVRPLRGSGLIVCDPTLVFAVIDALFGGAGKF 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSN 178
             ++  R  S  E ++  R +  ISA   +  +        LE        +  T    +
Sbjct: 138 HTRIEGRDFSPTELRVISRLVEVISAEYKKAWAGVYPVE--LEYQRSEMQPQFATIAAPS 195

Query: 179 EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQ 237
           E V T +  + I + + +    IP  TL        S+ Q  +       +    ++   
Sbjct: 196 EIVVTTSFTVEIGDTSGTIHFCIPYATLEPIRDTLYSTVQGDANEPDRRWVKLLTQQIQA 255

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             V++   +     T++ ++ LK G  I              +G  ++ C  G     Y 
Sbjct: 256 AEVDLVAELAQAPATVEQLLALKPGDFIELDL--DQVVHAKVDGVPVFDCHYGTSNGKYA 313

Query: 298 IRITDRI 304
           I+I   +
Sbjct: 314 IKIDQLL 320


>gi|167834865|ref|ZP_02461748.1| flagellar motor switch protein FliM [Burkholderia thailandensis
           MSMB43]
          Length = 332

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 35/307 (11%), Positives = 89/307 (28%), Gaps = 11/307 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           +      P +     R+                +   + + L       M    +IS + 
Sbjct: 30  AEASGIRPYNIATQERIVRG------RMPGLEIINDRFARLLRIGIFNFMRRTAEISVSQ 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +  K+S    +       +   +             NLV  +++NL G       ++  
Sbjct: 84  VKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFDPNLVFFVVDNLFGGDGRFHTRVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  + +  +         + +  +            +       NE V   
Sbjct: 144 RDFTATEQRIIGKLLNLVFEHYASAWKSVRPLAFEFVRSEMHT--QFANVATPNEIVIVT 201

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNID 243
             ++       +  + +P   +     +  S  Q ++       +   +++     V + 
Sbjct: 202 QFSIEFGPTGGTLHICMPYSMIEPIRDVLSSPIQGEALEVDRRWVRVLSQQVQSAEVELV 261

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
             +    TT + ++ L+ G V+P             +G  +  C  G     Y +R+   
Sbjct: 262 ADLAEVPTTFEKILNLRAGDVLPLD--IAESISAKVDGVPVMECGYGIFNGQYALRVQKM 319

Query: 304 INFDQKS 310
           I+     
Sbjct: 320 ISASDTM 326


>gi|190574232|ref|YP_001972077.1| flagellar motor switch protein FliM [Stenotrophomonas maltophilia
           K279a]
 gi|190012154|emb|CAQ45777.1| putative flagellar motor switch protein FliM [Stenotrophomonas
           maltophilia K279a]
          Length = 334

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 36/302 (11%), Positives = 90/302 (29%), Gaps = 11/302 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
                      R+                +   + +         +    ++S    +  
Sbjct: 32  EARSYDFASQDRIIRG------RMPTLEMVHERFARLWRIGLFNLIRRSAELSVRGIELI 85

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           KF+  +HS       +            I     LV  +++N  G       ++  R  +
Sbjct: 86  KFNDYMHSLYVPTNLNLIRFKPLRGTGLIVFEPTLVFAIVDNFFGGDGRYPTRIEGREFT 145

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E ++    + Q  A L +  +   +     E                 E+V    +++
Sbjct: 146 ATEMRVIHLLLKQTFADLREAWAPVMDVD--FEYINSEINPHFANIVTPREYVVVCRLHV 203

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            ++       + +P   L     +  +  Q+   ++ E        +     V + + + 
Sbjct: 204 ELDGGGGDIHVTLPYSMLEPIRELLDAGIQSDRNDRDESWGKTLREQLNIAEVTLSSVLA 263

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
            K+ TL+D+  LK+G ++P     +    +      +++ E G       ++IT      
Sbjct: 264 SKRMTLRDLTQLKVGDILPIELSPQVP--VCVENIPVFTGEFGIANGMNAVKITATHPPG 321

Query: 308 QK 309
            +
Sbjct: 322 TR 323


>gi|206603652|gb|EDZ40132.1| Flagellar motor switch protein FliM) [Leptospirillum sp. Group II
           '5-way CG']
          Length = 338

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 41/304 (13%), Positives = 92/304 (30%), Gaps = 3/304 (0%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           ++  K      P+    L  +    +        +   + +F        +   V+ S  
Sbjct: 24  ETQAKAADSGEPVKQYNLASQERVIRGRMPTLEIINERFARFFQVTLSATLRKTVEFSPQ 83

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
             +  KF   +         +   L S   N  +     +V  L++++ G S     ++ 
Sbjct: 84  GIEMVKFGDFVKKIPMPSNINILRLESLRRNILLIIDARMVYLLVDHMFGGSGRGHVKIE 143

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  S +E ++++  +        +  +        +         +        E V T
Sbjct: 144 GRDFSPIEARISRNVMDLAIGDFEKAWAPVHPM--PITYIRSEINPQFAAIVAPTEMVVT 201

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISL-SSQNKSENQSEDLIDPFARKTYQLNVNI 242
           +   + I+    +  + IP  T+           Q+         I+    +  +  + I
Sbjct: 202 MAYRLEIDGQGRTIYICIPYSTIEPIKEKLYTGFQSDQYEVDSRWINRLQERVEEAPLEI 261

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
           +  I   + TL+D++  K G V            +   G   +    G    +  IRI  
Sbjct: 262 EAFIGEARFTLRDILGWKTGDVFSLDRYVSEPVEVRVEGIVRFLARPGIFRHHRAIRIER 321

Query: 303 RINF 306
           R+  
Sbjct: 322 RVPP 325


>gi|83720285|ref|YP_440587.1| flagellar motor switch protein FliM [Burkholderia thailandensis
           E264]
 gi|167579274|ref|ZP_02372148.1| flagellar motor switch protein FliM [Burkholderia thailandensis
           TXDOH]
 gi|167617380|ref|ZP_02386011.1| flagellar motor switch protein FliM [Burkholderia thailandensis
           Bt4]
 gi|83654110|gb|ABC38173.1| flagellar motor switch protein FliM [Burkholderia thailandensis
           E264]
          Length = 332

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 35/307 (11%), Positives = 88/307 (28%), Gaps = 11/307 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           +      P +     R+                +   + + L       M    +IS + 
Sbjct: 30  AESSGIRPYNIATQERIVRG------RMPGLEIINDRFARLLRIGIFNFMRRTAEISVSQ 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +  K+S    +       +   +             NLV  +++NL G       ++  
Sbjct: 84  VKVQKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFDPNLVFFVVDNLFGGDGRFHTRVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  + +  +         + +               +       NE V   
Sbjct: 144 RDFTATEQRIIGKLLNLVFEHYAVAWKSVRPLQFEFVRSEMHT--QFANVATPNEIVIVT 201

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNID 243
             ++       +  + +P   +     +  S  Q ++       +   +++     V + 
Sbjct: 202 QFSIEFGPTGGTLHICMPYSMIEPIRDVLSSPIQGEALEVDRRWVRVLSQQVQSAEVELV 261

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
             +    TT + ++ L+ G V+P             +G  +  C  G     Y +R+   
Sbjct: 262 ADLAEVPTTFEKILNLRAGDVLPLD--IADSITAKVDGVPVMECGYGIFNGQYALRVQKM 319

Query: 304 INFDQKS 310
           I+     
Sbjct: 320 ISASDTM 326


>gi|167464156|ref|ZP_02329245.1| flagellar motor switch protein FliM [Paenibacillus larvae subsp.
           larvae BRL-230010]
 gi|322382382|ref|ZP_08056289.1| FliM-like protein [Paenibacillus larvae subsp. larvae B-3650]
 gi|321153735|gb|EFX46110.1| FliM-like protein [Paenibacillus larvae subsp. larvae B-3650]
          Length = 332

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 39/316 (12%), Positives = 106/316 (33%), Gaps = 13/316 (4%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           ++ +   +           R        K   +  + +   + ++L   F  ++   V I
Sbjct: 27  LKKEETQRKIRSYDFKRAVRF------SKDHIRSLTRIHENFARYLTTYFSAQLRTFVQI 80

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           +    +   +   I S  +  + +            +    N+   +L++LLG    +  
Sbjct: 81  NVVQVEQLPYDEFIRSIPKMTILNIFEAEPLEGRMVMEVHPNVAYAMLDHLLGGVGVSPS 140

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++   +L+ +E  + +R  ++    L +   T  +  P LE        +       NE 
Sbjct: 141 KIN--ALTEIETIVMERIFSKAFDSLQEAWKTVVDLQPRLEALET--NPQFMQIVSPNET 196

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQ 237
           +  I+++  I +      L IP   +              ++ ++++ + ++    +  Q
Sbjct: 197 IALISLSTKIGDTTGMINLCIPHVVIEPIMPRLSVHSWFVSQKKSRAPEEVEALQFRLNQ 256

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             +     +     T+ + + L +G VI           +    K  Y+   G V     
Sbjct: 257 AKLPFVAELGSSHITVHEFLNLSVGDVITLQKPVNEPLKIRIGDKYKYTGSPGTVRGKMA 316

Query: 298 IRITDRINFDQKSLKN 313
           ++I + ++  ++    
Sbjct: 317 VQINEPVSEGEEEYDE 332


>gi|226941271|ref|YP_002796345.1| flagellar motor switch protein FliM [Laribacter hongkongensis
           HLHK9]
 gi|226716198|gb|ACO75336.1| FliM [Laribacter hongkongensis HLHK9]
          Length = 329

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 40/311 (12%), Positives = 94/311 (30%), Gaps = 11/311 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +          R+                +   + + L       +  + +IS   
Sbjct: 28  SAASSVKNYDIGRQERIVRG------RMPTLEIINERFARNLRIGLFNFIRRNAEISVGP 81

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +  K+S  I +       +   +        +    +LV  +++NL G+      ++  
Sbjct: 82  VKVQKYSEFIRNLVVPTNLNLCHVKPLRGTALLIFDPDLVFLVVDNLFGSDGRYHVRVEG 141

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++ +R +  + +   +                     +        E V ++
Sbjct: 142 RDFTPTEQRIIRRLLDVVFSEYQKAWEPVYPIEFLYMRSEM--NTQFANIATPTEVVVSM 199

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQ-NKSENQSEDLIDPFARKTYQLNVNID 243
              + +      F + +P   +        S+            +   +R+     V + 
Sbjct: 200 TFRIELGAGGGDFHVCMPYSMVEPIRDQLSSTMAADRTEIDNRWVSLLSRQVQIAEVELV 259

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
             +   + TL D++ LK G VIP    E   A +S  G  +  C  G     Y +R+   
Sbjct: 260 ATLAEAQITLGDILNLKTGDVIPVEIPESIVADVS--GIPVLDCRYGTANGQYALRVERL 317

Query: 304 INFDQKSLKNF 314
           +    +  +  
Sbjct: 318 LAGAHELEQGL 328


>gi|332524239|ref|ZP_08400465.1| flagellar motor switch protein FliM [Rubrivivax benzoatilyticus
           JA2]
 gi|332107574|gb|EGJ08798.1| flagellar motor switch protein FliM [Rubrivivax benzoatilyticus
           JA2]
          Length = 334

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 42/304 (13%), Positives = 93/304 (30%), Gaps = 11/304 (3%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           +               R+                +   + + +       +    ++S  
Sbjct: 29  EQTAGGIRDYDLSSQERIVRG------RMPTMEVINERFARNIRIGLFNLIRKSPEVSIG 82

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
             +  KFS  +        F+  S+     +  I C  N+V  +++ L G + +   ++ 
Sbjct: 83  GIKVQKFSAFLREIVVPTNFNLVSVKPLRGSGLIVCDPNVVFAVIDALFGGAGKFHTRIE 142

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  S  E ++  R +  I A   +           LE        +       +E V +
Sbjct: 143 GRDFSPTELRVILRLVECIIAEYKKAWHGIYPLE--LEYQRSEMQPQFANIATPSEIVVS 200

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNI 242
               + I + + +    IP  TL     +  S+ Q  S       ++    +     V++
Sbjct: 201 TAFTLEIGDTSGAVHFCIPYSTLEPIRDVLYSTIQGDSAEPDRRWVNLLKHQIQAAEVDL 260

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
              +     T++ +++ K G  I              +G  ++ C  G     Y I+I  
Sbjct: 261 VAELGHAPATVEQLLSFKPGDFIELDLDP--MIQAKVDGVPVFDCHYGTTNGRYAIKIDR 318

Query: 303 RINF 306
            +  
Sbjct: 319 LLTS 322


>gi|71278806|ref|YP_268251.1| flagellar motor switch protein FliM [Colwellia psychrerythraea 34H]
 gi|71144546|gb|AAZ25019.1| flagellar motor switch protein FliM [Colwellia psychrerythraea 34H]
          Length = 354

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 42/305 (13%), Positives = 92/305 (30%), Gaps = 11/305 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
                TS        R+                +   + + +       M    ++S   
Sbjct: 31  QSRDGTSDYDFSSQDRIVRG------RMPTLEMVNERFARHMRISLFNMMRRTAEVSING 84

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            Q  KF   IH+       +            I     LV  L++N  G       ++  
Sbjct: 85  IQMIKFGEYIHTLFVPTSLNMVRFRPLKGTALITMEARLVFILVDNFFGGDGRYHAKIEG 144

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++ +  +  +     +  S   +   + E                 E V   
Sbjct: 145 REFTPTERRIIQMLLKLVFEDYKEAWSPVMDV--SFEYLDSEVNPSMANIVSPTEVVVIS 202

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNID 243
           + ++ ++     F + +P   L     +  +  Q+  E+           +   + V I+
Sbjct: 203 SFHIELDGGGGDFHIALPYSMLEPIRELLDAGVQSDKEDTDMRWSKALRDEIMDVPVTIN 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
           T+      +L  V+ L+ G +IP    +     +       +  +LGR   N  ++I  +
Sbjct: 263 TKFIEVDISLSQVMELQAGDIIPIEMPDN--ITVLIEDLPTFRAKLGRSRDNIALKIESK 320

Query: 304 INFDQ 308
           I   +
Sbjct: 321 IRRPE 325


>gi|89075520|ref|ZP_01161931.1| flagellar motor switch protein [Photobacterium sp. SKA34]
 gi|89048792|gb|EAR54363.1| flagellar motor switch protein [Photobacterium sp. SKA34]
          Length = 349

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 36/309 (11%), Positives = 96/309 (31%), Gaps = 11/309 (3%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           +    +  + +        R+                +   + + +       +    ++
Sbjct: 24  LHDNDVANDVATFDFSSQDRIVRG------RMPTLELINERFARHMRISLFNMLRKTAEV 77

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S    Q  KF    ++       +            I     LV  L+EN  G       
Sbjct: 78  SINGVQMIKFGEYQNTLYVPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRFHA 137

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++  R  +  E+++ +  +  +     +  S         E                 E 
Sbjct: 138 KIEGREFTPTERRIVQMLLKLVFEDYREAWSPVMGVE--FEYLDSEVNPTMANIVSPTEV 195

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLN 239
           +   + ++ ++     F +++P   +     +  +  Q+   +           +   + 
Sbjct: 196 IVVSSFHIEVDGGGGDFHVVMPYSMVEPIRELLDAGVQSDKMDTDVRWSKALRDEIMDVP 255

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           VN+  ++     +L+D++ L++G VIP        A +       Y  ++GR G N  ++
Sbjct: 256 VNLRAKLLDVDLSLRDLMELQVGDVIPIDMP--EQATIFVEDLPTYHAKMGRSGDNVALK 313

Query: 300 ITDRINFDQ 308
           I++++    
Sbjct: 314 ISEKLQRPD 322


>gi|187926920|ref|YP_001893265.1| flagellar motor switch protein FliM [Ralstonia pickettii 12J]
 gi|241665249|ref|YP_002983608.1| flagellar motor switch protein FliM [Ralstonia pickettii 12D]
 gi|187728674|gb|ACD29838.1| flagellar motor switch protein FliM [Ralstonia pickettii 12J]
 gi|240867276|gb|ACS64936.1| flagellar motor switch protein FliM [Ralstonia pickettii 12D]
          Length = 335

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 40/310 (12%), Positives = 99/310 (31%), Gaps = 9/310 (2%)

Query: 1   MRGQSIHKNTSPL--HPILLARLTGKLGDKKTIEK--ISSSLGYLYKKFLPKIFKEKMDL 56
           ++G S   +  P+   P  +        ++    +      +   + +         M  
Sbjct: 16  LKGVSDEADEEPVEADPSGIRTYNLGSQERIVRGRMPTLEIINERFARNWRIGLFNFMRR 75

Query: 57  DVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASH 116
           + +IS    +  K+S  I +       +   +             NL+  +++NL G   
Sbjct: 76  NAEISVGPVKVQKYSEFIRNLVVPTSLNLVHVKPLRGTALFVFDPNLIFLVVDNLFGGDG 135

Query: 117 ETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRL 176
               ++  R  + VE+++ +R +  +     +                     +      
Sbjct: 136 RFHMRVEGRDFTDVEQRIIQRMLQLVFEHYARAWQPVYPIDFEFLRMEMHT--EFANVAT 193

Query: 177 SNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKT 235
            NE V T   ++ + N      + +P   +        S+ Q ++    +  +   +++ 
Sbjct: 194 PNEVVVTTTFSLELGNNGGDVHICMPYTMIEPIRDRLTSAIQGEALEVDKRWLRLLSQQV 253

Query: 236 YQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKN 295
               V +   +      + D++ +K+G VIP             +G  +  C  G     
Sbjct: 254 QTAEVELIADLATANVQVSDILNMKVGDVIPLEL--DDVVTAKVDGVPVMECNYGTFNGQ 311

Query: 296 YTIRITDRIN 305
           Y +R+   +N
Sbjct: 312 YALRVNRMLN 321


>gi|187478203|ref|YP_786227.1| flagellar motor switch protein [Bordetella avium 197N]
 gi|115422789|emb|CAJ49317.1| flagellar motor switch protein [Bordetella avium 197N]
          Length = 334

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 35/309 (11%), Positives = 95/309 (30%), Gaps = 12/309 (3%)

Query: 2   RGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDIS 61
              S              R+       +   +    +   + + +  +    M    DI+
Sbjct: 28  SSSSEDNGARAYDLSSPDRVV------RRRMQTLELINERFARNMRHVLLNFMRRSADIT 81

Query: 62  YTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQ 121
             S +  K++    +       +   +             +LV  ++++L G       +
Sbjct: 82  VGSIKIIKYADFERNLPVPSNLNMIQMKPLRGTALFTYDPSLVFLVIDSLFGGDGRYHTR 141

Query: 122 LYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFV 181
           +  R  +T E+++ +R +        +          +          K  +   +NE V
Sbjct: 142 VEGRDFTTTEQRIIRRLLNLTLESYGKSWDPVYPIEFDYVRSEMHT--KFASITGNNEVV 199

Query: 182 TTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKS--ENQSEDLIDPFARKTYQLN 239
              + ++          + +P   +     +       S  E   +      +R+    +
Sbjct: 200 VVSSFHIEFGATGGDLNICLPYSMIEPVRDLLTRPLQDSALEEVDQRWSQQLSRQVRSAD 259

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           +++        ++++ ++ LK+G V+P             +G  +  C  G     Y +R
Sbjct: 260 IDLVAEFARIPSSIRGLMNLKVGDVLPVDVP--ESITAHVDGVPLMECSYGVFNGKYALR 317

Query: 300 ITDRINFDQ 308
           + + +N D 
Sbjct: 318 VQNMLNQDD 326


>gi|89899368|ref|YP_521839.1| flagellar motor switch protein FliM [Rhodoferax ferrireducens T118]
 gi|89344105|gb|ABD68308.1| flagellar motor switch protein FliM [Rhodoferax ferrireducens T118]
          Length = 329

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 41/279 (14%), Positives = 95/279 (34%), Gaps = 5/279 (1%)

Query: 31  IEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSS 90
                  +   + + L       +    +IS       ++S  +        F+  ++  
Sbjct: 50  RMPTMEIVNERFARNLRVGLFNFIRRSPEISVGPVTVQRYSAFLRELAVPTNFNIVAIRP 109

Query: 91  WSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCI 150
              +  I C  +LV  +++ L G   +   ++  R  S  E+++  R +  I+    +  
Sbjct: 110 LRGSGMIVCEPSLVFGVIDTLYGGIGKFQARIEGRDFSATEQRVINRLVDVITEEYKKAW 169

Query: 151 STTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTT 210
                    LE        +       +E V + +  + I  +A S    +P  TL    
Sbjct: 170 KGVYPLE--LEYQRSEMQPQFANIATPSEIVISTSFQLEIGEIAGSIHFCMPYATLEPIR 227

Query: 211 LIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLH 269
            I   S+Q  S    +  ++   ++     + +   +     T++ ++ +K G  I    
Sbjct: 228 DILYSSTQGDSIEVDKRWVNVLTQEIQAAEITLVAELARADATVEQLLAMKTGDFIELDR 287

Query: 270 REKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
              +   ++  G  ++ C+ G     Y IRI   +  + 
Sbjct: 288 P--SRIEVTVEGVPVFECQYGTHNAKYAIRIDKSLRGND 324


>gi|269103169|ref|ZP_06155866.1| flagellar motor switch protein FliM [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268163067|gb|EEZ41563.1| flagellar motor switch protein FliM [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 347

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 36/305 (11%), Positives = 93/305 (30%), Gaps = 11/305 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S              R+                +   + + +       +    ++S   
Sbjct: 28  SSETGVITFDFSSQDRIVRG------RMPTLELINERFARHMRISLFNMLRKTAEVSING 81

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            Q  KF    ++       +            +     L+  L+EN  G       ++  
Sbjct: 82  VQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALVTMEARLIFILVENFFGGDGRFHAKIEG 141

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++ +  +  +     +  S         E                 E +   
Sbjct: 142 REFTPTERRIIQMLLKLVFEDYREAWSPVMGVE--FEYLDSEVNPTMANIVSPTEVIVVS 199

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNID 243
           + ++ ++     F +++P   +     +  +  Q+   +           +   + VNI 
Sbjct: 200 SFHIELDGGGGDFHVVMPYSMVEPIRELLDAGVQSDKMDTDVRWSRALREEIMDIPVNIR 259

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
            ++     TL+D++ L++G +IP        A +       Y  ++GR G N  ++I+++
Sbjct: 260 AKLLDVDLTLRDLMELQVGDIIPVDMP--DTATVFVEDLPTYRAKMGRSGDNVALKISEK 317

Query: 304 INFDQ 308
           +    
Sbjct: 318 LKRPD 322


>gi|21231367|ref|NP_637284.1| flagellar motor switch protein FliM [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|188991610|ref|YP_001903620.1| flagellar motor switch protein FliM [Xanthomonas campestris pv.
           campestris str. B100]
 gi|21113030|gb|AAM41208.1| flagellar protein [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|167733370|emb|CAP51571.1| Flagellar motor switch protein FliM [Xanthomonas campestris pv.
           campestris]
          Length = 337

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 42/302 (13%), Positives = 97/302 (32%), Gaps = 16/302 (5%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           + G++   + S    I+  R+                +   + +         +    D+
Sbjct: 31  LPGEARQYDLSSQDRIIRGRM-----------PTLEMVNERFARLWRIGLFNLIRRSADL 79

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S       KF+  +HS       +            I     LV T+++N  G       
Sbjct: 80  SVRGIDLVKFNEYMHSLYVPTNLNLIRFKPLRGTGLIVFEPTLVFTVVDNFFGGDGRFHT 139

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++  R  +  E ++ +  + Q  A L +  +   +     E                 E+
Sbjct: 140 RIEGREFTATEMRVIQLMLKQTFADLKEAWAPVMDVD--FEYINSEINPHFANIVTPREY 197

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLN 239
           V     ++ +E       + +P   L     +  +  Q+   ++ +        +     
Sbjct: 198 VVVCRFHVELEGGGGEIHITLPYSMLEPIRELLDAGIQSDRNDRDDSWNVMLREQLDTAE 257

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           V + + +  K+ +L+ +  LKIG ++P     +    L      +++ E G    N  ++
Sbjct: 258 VTLSSVLASKRMSLRQLTGLKIGDILPIDLPAQVP--LCVEEIPLFTGEFGVSNGNNAVK 315

Query: 300 IT 301
           IT
Sbjct: 316 IT 317


>gi|194365650|ref|YP_002028260.1| flagellar motor switch protein FliM [Stenotrophomonas maltophilia
           R551-3]
 gi|194348454|gb|ACF51577.1| flagellar motor switch protein FliM [Stenotrophomonas maltophilia
           R551-3]
          Length = 334

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 37/302 (12%), Positives = 90/302 (29%), Gaps = 11/302 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
                      R+                +   + +         +    ++S    +  
Sbjct: 32  EARSYDFASQDRIIRG------RMPTLEMVHERFARLWRIGLFNLIRRSAELSVRGIELI 85

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           KF+  +HS       +            I     LV  +++N  G       ++  R  +
Sbjct: 86  KFNDYMHSLYVPTNLNLIRFKPLRGTGLIVFEPTLVFAIVDNFFGGDGRYPTRIEGREFT 145

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E ++    + Q  A L +  +   +     E                 E+V    +++
Sbjct: 146 ATEMRVIHLLLKQTFADLREAWAPVMDVD--FEYINSEINPHFANIVTPREYVVVCRLHV 203

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            ++       + +P   L     +  +  Q+   ++ E        +     V + + + 
Sbjct: 204 ELDGGGGDIHVTLPYSMLEPIRELLDAGIQSDRNDRDESWGQTLREQLNIAEVTLSSVLA 263

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
            K+ TL+D+  LK+G ++P     +    L      +++ E G       ++IT      
Sbjct: 264 SKRMTLRDLTQLKVGDILPIELSPQVP--LCVENIPVFTGEFGIANGMNAVKITATHPPG 321

Query: 308 QK 309
            +
Sbjct: 322 TR 323


>gi|90579934|ref|ZP_01235742.1| flagellar motor switch protein [Vibrio angustum S14]
 gi|90438819|gb|EAS64002.1| flagellar motor switch protein [Vibrio angustum S14]
          Length = 349

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 36/304 (11%), Positives = 95/304 (31%), Gaps = 11/304 (3%)

Query: 6   IHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSC 65
           +  + +        R+                +   + + +       +    ++S    
Sbjct: 29  VANDVATFDFSSQDRIVRG------RMPTLELINERFARHMRISLFNMLRKTAEVSINGV 82

Query: 66  QSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNR 125
           Q  KF    ++       +            I     LV  L+EN  G       ++  R
Sbjct: 83  QMIKFGEYQNTLYVPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRFHAKIEGR 142

Query: 126 SLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTIN 185
             +  E+++ +  +  +     +  S         E                 E +   +
Sbjct: 143 EFTPTERRIVQMLLKLVFEDYREAWSPVMGVE--FEYLDSEVNPTMANIVSPTEVIVVSS 200

Query: 186 MNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDT 244
            ++ ++     F +++P   +     +  +  Q+   +           +   + VN+  
Sbjct: 201 FHIEVDGGGGDFHVVMPYSMVEPIRELLDAGVQSDKMDTDVRWSKALRDEIMDVPVNLRA 260

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
           ++     +L+D++ L++G VIP        A +       Y  ++GR G N  ++I++++
Sbjct: 261 KLLDVDLSLRDLMELQVGDVIPIDMP--EQATIFVEDLPTYHAKMGRSGDNVALKISEKL 318

Query: 305 NFDQ 308
               
Sbjct: 319 QRPD 322


>gi|42766718|gb|AAS45442.1| putative flagellar biosynthesis protein [Burkholderia pseudomallei]
          Length = 332

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 36/307 (11%), Positives = 89/307 (28%), Gaps = 11/307 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           +      P +     R+                +   + + L       M    +IS + 
Sbjct: 30  AEASGIRPYNIATQERIVRG------RMPGLEIINDRFARLLRIGIFNFMRRTAEISVSQ 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +  K+S    +       +   + S           NLV  +++NL G       ++  
Sbjct: 84  VKVQKYSEFTRNLPIPTNLNLVHVKSLRGTSLFVFDPNLVFFVVDNLFGGDGRFHTRVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  + +  +         + +               +       NE V   
Sbjct: 144 RDFTATEQRIIGKLLNLVFEHYASAWKSVRPLQFEFVRSEMHT--QFANVATPNEIVIVT 201

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNID 243
             ++       +  + +P   +     +  S  Q ++       +   +++     V + 
Sbjct: 202 QFSIEFGPTGGTLHICMPYSMIEPIRDVLSSPIQGEALEVDRRWVRVLSQQVQSAEVELV 261

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
             +    TT + ++ L+ G V+P             +G  +  C  G     Y +R+   
Sbjct: 262 ADLAEVPTTFEKILNLRTGDVLPLDIT--DSITAKVDGVPVMECGYGIFNGQYALRVQRM 319

Query: 304 INFDQKS 310
           I+     
Sbjct: 320 ISASDTM 326


>gi|307824486|ref|ZP_07654711.1| flagellar motor switch protein FliM [Methylobacter tundripaludum
           SV96]
 gi|307734470|gb|EFO05322.1| flagellar motor switch protein FliM [Methylobacter tundripaludum
           SV96]
          Length = 331

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 49/297 (16%), Positives = 96/297 (32%), Gaps = 10/297 (3%)

Query: 10  TSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGK 69
                     R+                +   + +F+       +    +I  +  Q  K
Sbjct: 45  VREYDFASQERIVRG------RMPTLEMVNERFARFIRISLFNFLRRSAEIFISGIQVQK 98

Query: 70  FSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLST 129
           FS  I         +    +       I     LV T+++N  G + +   Q   R  + 
Sbjct: 99  FSEYIQGLLVPTNLTIVRFNPLRGKALIVIDPRLVFTVVDNFFGGAGQFYNQTEGREFTP 158

Query: 130 VEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMT 189
            E ++ +  I  I   L +      E     E        +        E +    +++ 
Sbjct: 159 TEMRVVRIIIDMIFKDLKEAWKPVMELD--FEYVGAEINPRFANIIGPGEIIVISTIHVE 216

Query: 190 IENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLK 249
           +E       + +P   L     +  +  + S             +  +  V+I++ +  K
Sbjct: 217 LEGGGGDVNIAMPYAMLEPIRELLDAISSDSGEVDGGWQAALRGEVLRAEVSINSLLVEK 276

Query: 250 KTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
             T++DV+ LK G VIP         IL A G  ++  ++G    NY I+I D++  
Sbjct: 277 NMTIRDVMRLKKGDVIPIDMP--DTVILKAEGIPVFEGKVGISDGNYAIQIIDKVKS 331


>gi|59712452|ref|YP_205228.1| flagellar motor switch protein FliM [Vibrio fischeri ES114]
 gi|197335836|ref|YP_002156671.1| flagellar motor switch protein FliM [Vibrio fischeri MJ11]
 gi|59480553|gb|AAW86340.1| flagellar motor switch protein FliM [Vibrio fischeri ES114]
 gi|197317326|gb|ACH66773.1| flagellar motor switch protein FliM [Vibrio fischeri MJ11]
          Length = 344

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 33/297 (11%), Positives = 86/297 (28%), Gaps = 11/297 (3%)

Query: 13  LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSH 72
                  R+                +   + + +       +    ++S       KF  
Sbjct: 37  FDFSSQDRIVRG------RMPTLELINERFARHMRISLFNMLRKTAEVSINGVSMVKFGE 90

Query: 73  IIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEK 132
             ++       +            +     LV  L+EN  G       ++  R  +  E+
Sbjct: 91  YQNTLYVPTSLNMVRFRPLKGTALVTMEARLVFILVENFFGGDGRFHAKIEGREFTPTER 150

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
           ++ +  +  I     +  S         E                 E +   + ++ ++ 
Sbjct: 151 RIIQLLLKVIFEDYKEAWSPVMGVE--FEYLDSEVNPTMANIVSPTEVIVVSSFHIEVDG 208

Query: 193 VASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
               F ++ P   +     +  +  Q+   +           +   + V +   +   + 
Sbjct: 209 GGGDFHVVFPYSMVEPIRELLDAGVQSDKMDTDVRWSKALRDEIMDVPVEMKVNLLESQI 268

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
           +L+D++ L+ G +IP        A +       Y  ++G+      I+IT++I    
Sbjct: 269 SLRDLMELEAGDIIPVEMP--EAATVFVEDLPTYRGKVGQSNDKLAIQITEKIKRPD 323


>gi|288942630|ref|YP_003444870.1| flagellar motor switch protein FliM [Allochromatium vinosum DSM
           180]
 gi|288898002|gb|ADC63838.1| flagellar motor switch protein FliM [Allochromatium vinosum DSM
           180]
          Length = 325

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 35/302 (11%), Positives = 87/302 (28%), Gaps = 11/302 (3%)

Query: 6   IHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSC 65
                 P       R+                +   + ++L       +    +IS    
Sbjct: 34  TDGQARPYDFATQDRIVRG------RMPTLDMINERFARYLRVHLFNLLRRSSEISVIGA 87

Query: 66  QSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNR 125
           +  KFS  +HS       +   +              LV  L++N  G       ++  R
Sbjct: 88  RVTKFSEYLHSLYVPTSLNLVRVYPLHGTALFVFDPKLVFGLVDNFFGGDGRYYSRIEGR 147

Query: 126 SLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTIN 185
             + +E ++ K  +    + + +             +       +        E V   +
Sbjct: 148 DFTPMEMRVIKNLLDASFSDMQKAWEPVMHLDFEFINAEV--NPQFANIVSPTEIVVIND 205

Query: 186 MNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDT 244
            ++ +E    +  +  P   +     +  +  Q+      +        +     V I +
Sbjct: 206 FHIELEGGGGNMHVTFPYSMIEPIREVLDTGLQSDRSGVDQRWQRALEEEIPLAKVEISS 265

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
            +     T++ ++ +K G +IP         +L+     ++  + G       I+I + I
Sbjct: 266 VLTEVTLTVEQLLEVKPGDIIPVDLP--ETIVLNVEDIPLFRGKFGVSNGINAIKIMEHI 323

Query: 305 NF 306
             
Sbjct: 324 KH 325


>gi|253573530|ref|ZP_04850873.1| flagellar motor switch protein FliM [Paenibacillus sp. oral taxon
           786 str. D14]
 gi|251847058|gb|EES75063.1| flagellar motor switch protein FliM [Paenibacillus sp. oral taxon
           786 str. D14]
          Length = 333

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 39/316 (12%), Positives = 108/316 (34%), Gaps = 13/316 (4%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           ++ +   K           R        K   +  + +   + ++L   F  ++   V I
Sbjct: 27  LKKEETQKKIRSYDFKRAVRF------SKDHIRSLTRIHENFARYLTTYFSAQLRTFVQI 80

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           +    +   +   I S  +  + +            +    N+   +L+ LLG       
Sbjct: 81  NVVQVEQLPYDEFIRSIPKMTILNIFEAEPLEGRMVLEVHPNVAFAMLDRLLGGLGTAPS 140

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++    L+ +E  + +R  ++    L +   T  + +P +E        +       NE 
Sbjct: 141 KVGT--LTEIETIIMERIFSRAFESLQEAWKTVVDINPRMEALET--NPQFMQIVSPNET 196

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQ 237
           +  I+++  I + +    L IP   +              ++ +++  + ++    +  +
Sbjct: 197 IALISLSTKIGDTSGMINLCIPHVVIEPIMPKLSVHHWFVSQKKSRVPEEVEALRNRVNK 256

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             + I   +   + T+++ ++L +G VI      +    +    +  Y    G V     
Sbjct: 257 AKLPIIAELGESQITVREFLSLSVGDVISLNKPVQEGLQIRVGDRLKYIGSPGTVKDRLA 316

Query: 298 IRITDRINFDQKSLKN 313
           ++I + ++   + L  
Sbjct: 317 VQIDEIVSEGAEELDE 332


>gi|171057710|ref|YP_001790059.1| flagellar motor switch protein FliM [Leptothrix cholodnii SP-6]
 gi|170775155|gb|ACB33294.1| flagellar motor switch protein FliM [Leptothrix cholodnii SP-6]
          Length = 334

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 41/306 (13%), Positives = 94/306 (30%), Gaps = 12/306 (3%)

Query: 1   MRGQSIHKN-TSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVD 59
           +  +   K            R+                +   + + +       +    +
Sbjct: 25  LEQEDTPKGGIRDYDLASQERIVRG------RMPTLEIINERFSRNIRIGLFNFIRKTPE 78

Query: 60  ISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETI 119
           +S    +  K+S  +        F+  S+     +  I C   LV ++++ L G S +  
Sbjct: 79  VSVGGIKVQKYSAFLRETVVPTNFNIVSVRPLRGSGMIVCDPTLVFSVIDALFGGSGKFH 138

Query: 120 PQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNE 179
            ++  R  S  E+++  R +  I+    +           LE        +        E
Sbjct: 139 TRIEGRDFSPTEQRVISRIVEVIATEYKKAWQGIYPLE--LEYQRSEMQPQFANIAAPGE 196

Query: 180 FVTTINMNMTIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQL 238
            V T +  + I +   +    IP  TL     +   S+Q  S       +     +    
Sbjct: 197 IVVTTSFTLEIGDATGTIHFCIPYATLEPIRDVLYSSTQGDSAEPDRRWVKLMTHQIQAA 256

Query: 239 NVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTI 298
            V +   +     T++ ++ LK G  I     +     +  +G  +   + G     Y +
Sbjct: 257 QVQLVAELAHAPATVEQLLALKAGDFIELDLIKS--IEVKVDGVPVMEAQYGTSNGKYAL 314

Query: 299 RITDRI 304
           ++   +
Sbjct: 315 KVDRML 320


>gi|311992317|gb|ADQ26732.1| flagellar motor switch protein [Aeromonas hydrophila]
          Length = 356

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 37/307 (12%), Positives = 95/307 (30%), Gaps = 11/307 (3%)

Query: 3   GQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISY 62
           G +     +        R+                +   + + +       M    ++S 
Sbjct: 26  GAAGDPGVAQFDFSSQDRIVRG------RMPTLELVNERFARHMRISLFNMMRRTAEVSI 79

Query: 63  TSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQL 122
              Q  KF   +H+       +            I     LV  L+EN  G       ++
Sbjct: 80  NGVQMLKFGEYVHTLFVPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRYHAKI 139

Query: 123 YNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVT 182
             R  +  E+++ +  +  +        +   +     E                 E + 
Sbjct: 140 EGREFTPTERRIIQMLLKLVFEDYKDAWAPVMDV--GFEYLDSEVNPAMANIVSPTEVIV 197

Query: 183 TINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVN 241
             + ++ ++     F + +P   L     +  +  Q+   +           +   + V 
Sbjct: 198 VSSFHIELDGGGGDFHVAMPYSMLEPIRELLDAGVQSDKGDTDVRWSKALRDEIMDVKVE 257

Query: 242 IDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
           +  ++   + TL++++ L+ G +IP    E    ++       +  ++GR   N  ++IT
Sbjct: 258 LRAKLLETELTLRELMELQPGDIIPVEMPEN--LLVFVEDLPTFHAKMGRTKDNVALKIT 315

Query: 302 DRINFDQ 308
           D++   +
Sbjct: 316 DKLKRPE 322


>gi|117619656|ref|YP_855911.1| flagellar motor switch protein FliM [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117561063|gb|ABK38011.1| flagellar motor switch protein FliM [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 356

 Score =  249 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 37/307 (12%), Positives = 95/307 (30%), Gaps = 11/307 (3%)

Query: 3   GQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISY 62
           G +     +        R+                +   + + +       M    ++S 
Sbjct: 26  GAAGDPGVAQFDFSSQDRIVRG------RMPTLELVNERFARHMRISLFNMMRRTAEVSI 79

Query: 63  TSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQL 122
              Q  KF   +H+       +            I     LV  L+EN  G       ++
Sbjct: 80  NGVQMLKFGEYVHTLFVPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRYHAKI 139

Query: 123 YNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVT 182
             R  +  E+++ +  +  +        +   +     E                 E + 
Sbjct: 140 EGREFTPTERRIIQMLLKLVFEDYKDAWAPVMDV--GFEYLDSEVNPAMANIVSPTEVIV 197

Query: 183 TINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVN 241
             + ++ ++     F + +P   L     +  +  Q+   +           +   + V 
Sbjct: 198 VSSFHIELDGGGGDFHVAMPYSMLEPIRELLDAGVQSDKGDTDVRWSKALRDEIMDVKVE 257

Query: 242 IDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
           +  ++   + TL++++ L+ G +IP    E    ++       +  ++GR   N  ++IT
Sbjct: 258 LRAKLLETELTLRELMELQPGDIIPVEMPEN--LLVFVEDLPTFHAKMGRTKDNVALKIT 315

Query: 302 DRINFDQ 308
           D++   +
Sbjct: 316 DKLKRPE 322


>gi|254523832|ref|ZP_05135887.1| flagellar motor switch protein FliM [Stenotrophomonas sp. SKA14]
 gi|219721423|gb|EED39948.1| flagellar motor switch protein FliM [Stenotrophomonas sp. SKA14]
          Length = 334

 Score =  249 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 38/302 (12%), Positives = 90/302 (29%), Gaps = 11/302 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
                      R+                +   + +         +    ++S    +  
Sbjct: 32  EARSYDFASQDRIIRG------RMPTLEMVHERFARLWRIGLFNLIRRSAELSVRGIELI 85

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           KF+  +HS       +            I     LV  +++N  G       ++  R  +
Sbjct: 86  KFNDYMHSLYVPTNLNLIRFKPLRGTGLIVFEPTLVFAIVDNFFGGDGRYPTRIEGREFT 145

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E ++    + Q  A L +  +   +     E                 E+V    +++
Sbjct: 146 ATEMRVIHLLLKQTFADLREAWAPVMDVD--FEYINSEINPHFANIVTPREYVVVCRLHV 203

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            ++       + +P   L     +  +  Q+   ++ E        +     V + + + 
Sbjct: 204 ELDGGGGDIHVTLPYSMLEPIRELLDAGIQSDRNDRDESWGQTLREQLNIAEVTLSSVLA 263

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
            K+ TL+D+  LK+G V+P     +    L      +++ E G       ++IT      
Sbjct: 264 SKRMTLRDLTRLKVGDVLPIELNPQVP--LCVENIPVFTGEFGIANGMNAVKITATHPPG 321

Query: 308 QK 309
            +
Sbjct: 322 TR 323


>gi|330445373|ref|ZP_08309025.1| flagellar motor switch protein FliM [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328489564|dbj|GAA03522.1| flagellar motor switch protein FliM [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 349

 Score =  249 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 36/309 (11%), Positives = 95/309 (30%), Gaps = 11/309 (3%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           +       + +        R+                +   + + +       +    ++
Sbjct: 24  LHDDEASSDVATFDFSSQDRIVRG------RMPTLELINERFARHMRISLFNMLRKTAEV 77

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S    Q  KF    ++       +            I     LV  L+EN  G       
Sbjct: 78  SINGVQMIKFGEYQNTLYVPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRFHA 137

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++  R  +  E+++ +  +  +     +  S         E                 E 
Sbjct: 138 KIEGREFTPTERRIVQMLLKLVFEDYREAWSPVMGVE--FEYLDSEVNPTMANIVSPTEV 195

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLN 239
           +   + ++ ++     F +++P   +     +  +  Q+   +           +   + 
Sbjct: 196 IVVSSFHIEVDGGGGDFHVVMPYSMVEPIRELLDAGVQSDKMDTDVRWSKALRDEIMDVP 255

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           VN+  ++     +L+D++ L++G VIP        A +       Y  ++GR G N  ++
Sbjct: 256 VNLRAKLLDVDLSLRDLMELQVGDVIPIDMP--EQATIFIEDLPTYHAKMGRSGDNVALK 313

Query: 300 ITDRINFDQ 308
           I++++    
Sbjct: 314 ISEKLKRPD 322


>gi|58582231|ref|YP_201247.1| flagellar motor switch protein FliM [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84624124|ref|YP_451496.1| flagellar motor switch protein FliM [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|188576791|ref|YP_001913720.1| flagellar motor switch protein FliM [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188576983|ref|YP_001913912.1| flagellar motor switch protein FliM [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|58426825|gb|AAW75862.1| flagellar protein [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84368064|dbj|BAE69222.1| flagellar protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188521243|gb|ACD59188.1| flagellar motor switch protein FliM [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188521435|gb|ACD59380.1| flagellar motor switch protein FliM [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 337

 Score =  249 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 42/302 (13%), Positives = 98/302 (32%), Gaps = 16/302 (5%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           + G++   + S    I+  R+                +   + +         +    D+
Sbjct: 31  LPGEARQYDLSSQDRIIRGRM-----------PTMEMVNERFARLWRIGLFNLIRRSADL 79

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S       KF+  +HS       +            I     LV T+++N  G       
Sbjct: 80  SVRGIDLVKFNEYMHSLYVPTNLNLIRFKPLRGTGLIVFEPTLVFTVVDNFFGGDGRYHT 139

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++  R  +  E ++ +  + Q  A L +  +   +    LE                 E+
Sbjct: 140 RIEGREFTATEMRVVQLMLKQTFADLKEAWAPVMDVD--LEYINSEINPHFANIVTPREY 197

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLN 239
           V     ++ +E       + +P   L     +  +  Q+   ++ +        +     
Sbjct: 198 VVVCRFHVELEGGGGEIHITLPYSMLEPIRELLDAGIQSDRNDRDDSWNVMLREQLDTAE 257

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           V + + +  K+ +L+ +  LK+G ++P     +    L      +++ E G    N  ++
Sbjct: 258 VTLSSVLASKRMSLRQLTGLKVGDILPIDLPAQVP--LCVEEIPLFTGEFGVSNGNNAVK 315

Query: 300 IT 301
           IT
Sbjct: 316 IT 317


>gi|74055041|gb|AAZ95846.1| FliM [Aeromonas hydrophila]
          Length = 356

 Score =  249 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 37/307 (12%), Positives = 95/307 (30%), Gaps = 11/307 (3%)

Query: 3   GQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISY 62
           G +     +        R+                +   + + +       M    ++S 
Sbjct: 26  GAAGDPGVAQFDFSSQDRIVRG------RMPTLELVNERFARHMRISLFNMMRRTAEVSI 79

Query: 63  TSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQL 122
              Q  KF   +H+       +            I     LV  L+EN  G       ++
Sbjct: 80  NGVQMLKFGEYVHTLFVPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRYHAKI 139

Query: 123 YNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVT 182
             R  +  E+++ +  +  +        +   +     E                 E + 
Sbjct: 140 EGREFTPTERRIIQMLLKLVFEDYKDAWAPVMDV--GFEYLDSEVNPAMANIVSPTEVIV 197

Query: 183 TINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVN 241
             + ++ ++     F + +P   L     +  +  Q+   +           +   + V 
Sbjct: 198 VSSFHIELDGGGGDFHVAMPYSMLEPIRELLDAGVQSDKGDTDVRWSKALRDEIMDVKVE 257

Query: 242 IDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
           +  ++     TL++++ L+ G +IP    E    ++       +  ++GR  +N  ++IT
Sbjct: 258 LRAKLLETDLTLRELMELRPGDIIPVEMPEN--LLVYVEDLPTFHAKMGRTKENVALKIT 315

Query: 302 DRINFDQ 308
           D++   +
Sbjct: 316 DKLKRPE 322


>gi|239817144|ref|YP_002946054.1| flagellar motor switch protein FliM [Variovorax paradoxus S110]
 gi|239803721|gb|ACS20788.1| flagellar motor switch protein FliM [Variovorax paradoxus S110]
          Length = 333

 Score =  249 bits (636), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 35/280 (12%), Positives = 83/280 (29%), Gaps = 4/280 (1%)

Query: 29  KTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASL 88
           ++       +   + + L       M    DIS       ++   +         +   +
Sbjct: 50  RSRMHTLEVINERFARHLRSSLLNFMRRSPDISVGPVHIQQYGEFVRHLPVPANINMLHM 109

Query: 89  SSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQ 148
                         LV  +++NL G+      ++  R  +  E+++ KR +         
Sbjct: 110 KPLRGTALFVFDPKLVFLVVDNLFGSDGRYHVRVEGRDFTRTEQRIIKRLLNLTLQCYAD 169

Query: 149 CISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLK 208
                   S +          K       NE V    + +    V     + IP   +  
Sbjct: 170 AWQPVFPLSFDYVRAEMHG--KLANIVAPNEVVINTTLQIEFGPVGGFLHVCIPYSMIEP 227

Query: 209 TTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFL 268
              +  +         +  +   +++    +V +        +T+ +V+ L++G V+P  
Sbjct: 228 IRDLLSNPVQDEIEVDKRWVRQMSQQMQSADVELSAEFITLPSTIGEVLKLQVGDVLPIE 287

Query: 269 HREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
                      +G  +  C  G   + Y +R+   I+   
Sbjct: 288 LPTS--ITARVDGIPVMECGYGVSNERYALRVLQMISHQD 325


>gi|85711035|ref|ZP_01042095.1| flagellar motor switch protein [Idiomarina baltica OS145]
 gi|85694948|gb|EAQ32886.1| flagellar motor switch protein [Idiomarina baltica OS145]
          Length = 354

 Score =  249 bits (636), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 36/302 (11%), Positives = 91/302 (30%), Gaps = 11/302 (3%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
                       R+                +   + + +       M    ++S    Q 
Sbjct: 32  SEALDYDFSSQDRIVRG------RMPTLEIVNERFARHMRVSLFNMMRRTAEVSINGVQM 85

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSL 127
            KF   +H+       +            I     LV  L++N  G       ++  R  
Sbjct: 86  LKFGEYVHTLFVPTSLNMVRFRPLKGTALITMEARLVFILVDNFFGGDGRYHAKIEGREF 145

Query: 128 STVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMN 187
           +  E+++ +  +  I     +  +   +     E                 E +   + +
Sbjct: 146 TPTERRIIQMLLKLIFEDYKEAWAPVMDV--GFEYLDSEVNPAMANIVSPTEVIVISSFH 203

Query: 188 MTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRI 246
           + ++     F + +P   L     +  +  Q+  E+           +   + V +  ++
Sbjct: 204 IELDGGGGDFHIALPYSMLEPIRELLDAGVQSDKEDTDMRWSKALRDEIMDVPVEMVAKL 263

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                TL++V+  + G +IP    +     +       +  ++GR   N  ++I+D+I  
Sbjct: 264 ADVDVTLREVMDFEEGDIIPLEVPDN--LTVFIEDLPTFHAKMGRSRDNIALKISDKIRR 321

Query: 307 DQ 308
            +
Sbjct: 322 PE 323


>gi|46579323|ref|YP_010131.1| flagellar motor switch protein FliM [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120603117|ref|YP_967517.1| flagellar motor switch protein FliM [Desulfovibrio vulgaris DP4]
 gi|46448737|gb|AAS95390.1| flagellar motor switch protein FliM [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120563346|gb|ABM29090.1| flagellar motor switch protein FliM [Desulfovibrio vulgaris DP4]
 gi|311233150|gb|ADP86004.1| flagellar motor switch protein FliM [Desulfovibrio vulgaris RCH1]
          Length = 326

 Score =  249 bits (636), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 42/300 (14%), Positives = 89/300 (29%), Gaps = 10/300 (3%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           Q       P       R+            +   +   + +         +   V+++  
Sbjct: 29  QHDDSGIVPFDLANQDRIIRG------RMPVLEIVNDRFARLCTNALSNAVRKRVELNPI 82

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
           S    KF   + S       +   +     N  I   + LV  L+EN  G S     ++ 
Sbjct: 83  SIDMTKFGDFMRSLPVPTSINIFKMEPLRGNAIIVVDSRLVFALVENFFGGSGSQP-KIE 141

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  + +E+ +  R I      + +      +    L         +       ++ V  
Sbjct: 142 GREFTRIEQAIVDRVIHIALDNMEESWRPVHDVHLELVR--SEINPQFAAIVPPSDVVVV 199

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNI 242
           I   + +++   S V+ +P  T+         S Q +        +     +  +  V +
Sbjct: 200 ITFEVELDSAIGSMVICLPYATIEPIRSKLHASFQTERLEVDHAWVARLKERLMETPVEL 259

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
             R    K T   ++ L++G V+           ++  G   +    G V  N   +I  
Sbjct: 260 KVRFGETKITGNQLLRLQVGDVLLLDTDTDDMLEVTIAGVTKFWGLGGTVKANKAFQIVK 319


>gi|221069291|ref|ZP_03545396.1| flagellar motor switch protein FliM [Comamonas testosteroni KF-1]
 gi|220714314|gb|EED69682.1| flagellar motor switch protein FliM [Comamonas testosteroni KF-1]
          Length = 334

 Score =  249 bits (635), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 39/311 (12%), Positives = 99/311 (31%), Gaps = 7/311 (2%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEK--ISSSLGYLYKKFLPKIFKEKMDLDV 58
           + G+S       +    +        ++    +      +   + +         +    
Sbjct: 18  VTGESQRSEVVEVDLGQVRSYDISSQERIVRGRMPTMEIVNERFARNFRIGLFNFIRRSP 77

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S  +    ++S  +        F+  ++     N  I C  +LV  +++ L G +   
Sbjct: 78  EVSVGTVTVQRYSAFLRELAVPTNFNIMAIRPLRGNGLIVCDPSLVFGVIDTLYGGTGRL 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSN 178
             ++  R  ST E+++  R +  I     +            +        +       +
Sbjct: 138 QTRIEGRDFSTTEQRVINRMVNVICEEYKKAWHGIYPLELAYQRSEM--QPQFANIATPS 195

Query: 179 EFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQ 237
           E V +    + I +++ S  + +P  TL     +   S+Q  +       +    R+   
Sbjct: 196 EIVVSTAFQLEIGDISGSIHICMPYATLEPIRDVLYSSTQGDAIEVDRRWVKVLTREIQA 255

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             V +   +     T++ ++ ++ G  I            S  G  ++ C+ G     Y 
Sbjct: 256 AEVTLVAELARADATVEQLLAMRPGDFIELDREP--LIRASIGGVPVFECQYGTHNDKYA 313

Query: 298 IRITDRINFDQ 308
           IR+   +    
Sbjct: 314 IRVERSLRGGD 324


>gi|237731993|ref|ZP_04562474.1| flagellar motor switch protein fliM [Citrobacter sp. 30_2]
 gi|226907532|gb|EEH93450.1| flagellar motor switch protein fliM [Citrobacter sp. 30_2]
          Length = 349

 Score =  249 bits (635), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 40/307 (13%), Positives = 96/307 (31%), Gaps = 10/307 (3%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           + G +   +  P  P    R+       +   +    +   + +         +    DI
Sbjct: 41  ISGIAKESDIRPYDPNTQRRVV------RERLQALEIINERFARQFRMGLFNLLRRSPDI 94

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           +  + +   +     +       +   L        +  S +LV   ++NL G       
Sbjct: 95  TVGAIRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPT 154

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++  R  +  E+++  R +       +                  +     N     N+ 
Sbjct: 155 KVEGREFTHTEQRVINRMLKLALESYSDAWKAINPLEVEYVRSE-MQVKFTNITTSPNDI 213

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLN 239
           V     ++ I N+   F + +P   +     + ++   + S N+ ++  +   R+     
Sbjct: 214 VVNTPFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRNNLVRQVQHSE 273

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           + +          L  ++ LK G V+P         I   +G  + + + G V   Y +R
Sbjct: 274 LELVANFADIPLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTVNGQYALR 331

Query: 300 ITDRINF 306
           +   IN 
Sbjct: 332 VEHLINP 338


>gi|251772382|gb|EES52949.1| flagellar motor switch protein FliM [Leptospirillum
           ferrodiazotrophum]
          Length = 341

 Score =  249 bits (635), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 41/301 (13%), Positives = 88/301 (29%), Gaps = 9/301 (2%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
           K T   +     R+                +   + +F        +   V+ S  S + 
Sbjct: 36  KKTREYNLASQERVIRG------RMPTLEIVNERFARFFQITLSSTLRKAVEFSPVSTEM 89

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSL 127
            KF   I         +   L     NF +     +V  L+++L G       ++  R  
Sbjct: 90  IKFGEFIKKIPLPSNINILRLEPMKRNFLLIIDARMVYLLVDHLFGGVGRGHVKVEGRDF 149

Query: 128 STVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMN 187
           S +E ++ +  + Q      +  +        +         + +      E V  +   
Sbjct: 150 SPIENRITRNILNQAIGDFEKAWAPVHHI--GVSYIRSEINPQFSAIVSPTEMVIALTYR 207

Query: 188 MTIENVASSFVLIIPQETLLKTTLISL-SSQNKSENQSEDLIDPFARKTYQLNVNIDTRI 246
           + I+       + IP  T+           Q+         I    ++   + + I   +
Sbjct: 208 LDIDGQGRPVYICIPYSTIEPIKEKLYTGFQSDQYEVDHRWILRLRQQIDSVPIKIVAEL 267

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
              K  L +V+  K G +I           ++      +    G    +  +RI +R+  
Sbjct: 268 GTTKARLSEVLAWKPGDMITLDQYVDDPIKITVEKALRFKARPGVYRSSRAVRIEERVFP 327

Query: 307 D 307
           D
Sbjct: 328 D 328


>gi|327441044|dbj|BAK17409.1| flagellar motor switch protein [Solibacillus silvestris StLB046]
          Length = 331

 Score =  249 bits (635), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 45/285 (15%), Positives = 97/285 (34%), Gaps = 7/285 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +  + +   + + L   F  ++   V I+  S     F   + S     + +   
Sbjct: 49  SKDQIRSLTRIHENFARLLTTFFSAQLRSYVQITVASVDQIPFEEFVRSIPNMTLINVFE 108

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +     N  +  + N+  ++L+ L+G +  +   + N  L+ +E K+      +    L 
Sbjct: 109 VPPLDGNILMEINPNIAYSMLDRLMGGAGGSHSNVDN--LTEIETKIMTNLFERSFDNLR 166

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +      E  P L         +       NE V  I+ N  I        + IP   L 
Sbjct: 167 EAWENVAEIDPMLV--ELEVNPQFLQMISPNETVVVISFNTIIGETTGMINICIPHVVLE 224

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                       Q  ++  S +       +  Q  + I   +     T++D +T+ +G V
Sbjct: 225 PIVPNLSVRYWMQTNTKEISPEQSKMLESRVKQAKLPIIAELGSSDITIEDFLTMAVGDV 284

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
           IP   + +    L       ++ + G++     ++I D +    +
Sbjct: 285 IPLKQKIENPLTLKVGSLPKFTVQPGKLNNKMAVQIIDPLKGGDE 329


>gi|330814983|ref|YP_004358688.1| Flagellar motor switch protein FliM [Burkholderia gladioli BSR3]
 gi|327367376|gb|AEA58732.1| Flagellar motor switch protein FliM [Burkholderia gladioli BSR3]
          Length = 332

 Score =  249 bits (635), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 36/302 (11%), Positives = 88/302 (29%), Gaps = 11/302 (3%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
               P +     R+                +   + + L       M    +IS +  + 
Sbjct: 33  SGVRPYNLATQERIVRG------RMPGMEIINDRFARLLRVGIFNFMRRTAEISVSQVKV 86

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSL 127
            K+S    +       +   +             NLV  +++NL G       ++  R  
Sbjct: 87  QKYSEFTRNLPIPTNLNLVHVKPLRGTSLFVFDPNLVFFVVDNLFGGDGRFHTRVEGRDF 146

Query: 128 STVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMN 187
           +  E ++  + +  +         + +      E      + +       NE V     +
Sbjct: 147 TQTEMRIISKLLHMVFEHYTVAWKSVRPLQ--FEHVRSEMHTQFANVATPNEIVIVTQFS 204

Query: 188 MTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRI 246
           +       +  + +P   +     +  S  Q ++       +   +++     V +   +
Sbjct: 205 IEFGPTGGTLHICMPYSMIEPIRDVLSSPIQGEALEVDRRWVRVLSQQVQAAEVELTADL 264

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
               TT + ++ L++G V+P             +G  +  C  G     Y +R+   I  
Sbjct: 265 AEVPTTFERILNLRVGDVLPLD--IGDAVTAKVDGVPVMECGYGIFNGQYALRVNRMIGA 322

Query: 307 DQ 308
             
Sbjct: 323 SD 324


>gi|120613024|ref|YP_972702.1| flagellar motor switch protein FliM [Acidovorax citrulli AAC00-1]
 gi|120591488|gb|ABM34928.1| flagellar motor switch protein FliM [Acidovorax citrulli AAC00-1]
          Length = 334

 Score =  249 bits (635), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 43/297 (14%), Positives = 94/297 (31%), Gaps = 11/297 (3%)

Query: 13  LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSH 72
                  R+                +   + +         +    +IS  +    ++S 
Sbjct: 38  YDISSQERIVRG------RMPTMEIVNERFARNFRIGLFNFIRRSPEISVGTVSVQRYSA 91

Query: 73  IIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEK 132
            +        F+  ++     +  I C  +LV  +++ L G   +   ++  R  S  E+
Sbjct: 92  FLRELAVPTNFNIVAIRPLRGSGLIVCEPSLVFGIIDTLYGGVGKFQTRIEGRDFSPTEQ 151

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
           ++  R +  I A   +           LE        +       +E V +    + I +
Sbjct: 152 RVINRLVDVICAEYKKAWHGIYPLE--LEYQRSEMQPQFANIATPSEIVVSTAFQLEIGD 209

Query: 193 VASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
           ++ +  + +P  TL     +   S+Q  S       +    R+     V +   +     
Sbjct: 210 LSGAIHICMPYATLEPIRDVLYSSTQGDSIEVDRRWVRVLTREIQAAEVTLVAELARADA 269

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
           T++ ++ +K G  I            S  G  I+ C+ G     Y IRI + +    
Sbjct: 270 TVEQLLAMKPGDFIELDREP--RIQASIGGVPIFECQYGTHNSKYAIRIEECLRNPD 324


>gi|326319064|ref|YP_004236736.1| flagellar motor switch protein FliM [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|323375900|gb|ADX48169.1| flagellar motor switch protein FliM [Acidovorax avenae subsp.
           avenae ATCC 19860]
          Length = 334

 Score =  248 bits (634), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 43/297 (14%), Positives = 94/297 (31%), Gaps = 11/297 (3%)

Query: 13  LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSH 72
                  R+                +   + +         +    +IS  +    ++S 
Sbjct: 38  YDISSQERIVRG------RMPTMEIVNERFARNFRIGLFNFIRRSPEISVGTVSVQRYSA 91

Query: 73  IIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEK 132
            +        F+  ++     +  I C  +LV  +++ L G   +   ++  R  S  E+
Sbjct: 92  FLRELAVPTNFNIVAIRPLRGSGLIVCEPSLVFGIIDTLYGGVGKFQTRIEGRDFSPTEQ 151

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
           ++  R +  I A   +           LE        +       +E V +    + I +
Sbjct: 152 RVINRLVDVICAEYKKAWHGIYPLE--LEYQRSEMQPQFANIATPSEIVVSTAFQLEIGD 209

Query: 193 VASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
           ++ +  + +P  TL     +   S+Q  S       +    R+     V +   +     
Sbjct: 210 LSGAIHICMPYATLEPIRDVLYSSTQGDSIEVDRRWVRVLTREIQAAEVTLVAELARADA 269

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
           T++ ++ +K G  I            S  G  I+ C+ G     Y IRI + +    
Sbjct: 270 TVEQLLAMKPGDFIELDREP--RIQASIGGVPIFECQYGTHNSKYAIRIEECLRNPD 324


>gi|50120652|ref|YP_049819.1| flagellar motor switch protein FliM [Pectobacterium atrosepticum
           SCRI1043]
 gi|49611178|emb|CAG74624.1| flagellar motor switch protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 337

 Score =  248 bits (634), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 41/309 (13%), Positives = 95/309 (30%), Gaps = 10/309 (3%)

Query: 6   IHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSC 65
                 P  P    R+       +   +    +   + +         +    DI+    
Sbjct: 32  TDGGVKPYDPNTQRRVI------RERLQALEIINERFARQFRMSLFNLLRRSPDITVGGI 85

Query: 66  QSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNR 125
           +   +     +       +   L           S +LV   ++NL G       ++  R
Sbjct: 86  KIQPYHEFARNLPVPTNLNLIHLKPLRGTALFVFSPSLVFIAVDNLFGGDGRFPTKVEGR 145

Query: 126 SLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTIN 185
             +  E+++ KR +        +  +   +          +     N     N+ V T  
Sbjct: 146 EFTHTEQRVVKRMLRLALEAYGEAWNAIYKLDIEYVRSE-MQVKFTNITTSPNDIVVTTP 204

Query: 186 MNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNIDT 244
            ++ I ++   F + IP   +     +  +   + S  + +   D  A++     + +  
Sbjct: 205 FHVEIGSLTGEFNICIPFSMIEPLRELLANPPLENSRQEDQSWRDTLAKQVQHSELELVA 264

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
                   L  ++ L+ G V+P         +   +G  + + + G +   Y +R+   I
Sbjct: 265 SFVDIPLRLSKILKLQPGDVLPIDKP--DKIVAHVDGVPVLTSQYGTLNGQYALRVEHLI 322

Query: 305 NFDQKSLKN 313
           N    SL N
Sbjct: 323 NPILNSLDN 331


>gi|264676601|ref|YP_003276507.1| flagellar motor switch protein FliM [Comamonas testosteroni CNB-2]
 gi|299531254|ref|ZP_07044664.1| flagellar motor switch protein FliM [Comamonas testosteroni S44]
 gi|262207113|gb|ACY31211.1| flagellar motor switch protein FliM [Comamonas testosteroni CNB-2]
 gi|298720661|gb|EFI61608.1| flagellar motor switch protein FliM [Comamonas testosteroni S44]
          Length = 334

 Score =  248 bits (634), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 39/311 (12%), Positives = 100/311 (32%), Gaps = 7/311 (2%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEK--ISSSLGYLYKKFLPKIFKEKMDLDV 58
           + G+S       +    +        ++    +      +   + +         +    
Sbjct: 18  VTGESQRSEVVEVDLGQVRSYDISSQERIVRGRMPTMEIVNERFARNFRIGLFNFIRRSP 77

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           ++S  +    ++S  +        F+  ++     N  I C  +LV  +++ L G +   
Sbjct: 78  EVSVGTVTVQRYSAFLRELAVPTNFNIMAIRPLRGNGLIVCDPSLVFGVIDTLYGGTGRL 137

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSN 178
             ++  R  ST E+++  R +  I     +            +        +       +
Sbjct: 138 QTRIEGRDFSTTEQRVINRMVNVICEEYKKAWHGIYPLELAYQRSEM--QPQFANIATPS 195

Query: 179 EFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQ 237
           E V +    + I +++ S  + +P  TL     +   S+Q  +       +    R+   
Sbjct: 196 EIVVSTAFQLEIGDISGSIHICMPYATLEPIRDVLYSSTQGDAIEVDRRWVKVLTREIQA 255

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             V +   +     T++ ++ ++ G  I            S  G  ++ C+ G     Y 
Sbjct: 256 AEVTLVAELARADATVEQLLAMRPGDFIELDREP--LIRASIGGVPVFECQYGTHNDKYA 313

Query: 298 IRITDRINFDQ 308
           IR+   +   +
Sbjct: 314 IRVERSLRGGE 324


>gi|114320135|ref|YP_741818.1| flagellar motor switch protein FliM [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114226529|gb|ABI56328.1| flagellar motor switch protein FliM [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 395

 Score =  248 bits (634), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 36/290 (12%), Positives = 90/290 (31%), Gaps = 5/290 (1%)

Query: 21  LTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKEN 80
            T +    +        +   + +         +    ++S    +  KF   +H+    
Sbjct: 39  FTAEERIVRGRMPTLEMINERFARLFRIGLFNMLRRTPEVSVVGVEMMKFGEYVHTLFVP 98

Query: 81  FVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIA 140
              +   +              LV  +++N  G       ++  R  +  E ++ +  I 
Sbjct: 99  TSLNLMRVHPLRGTGLFIIDPKLVFIVVDNFFGGDGRFFVKIEGREFTPTELRVIRMLID 158

Query: 141 QISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLI 200
           Q    L +  +     +   E  +     +       +E V     ++ ++       + 
Sbjct: 159 QAFENLEEAWNPV--MNAEFEYMHSEVNPQFANIVSPSEVVVVSKFHVELDGGGGDIHVT 216

Query: 201 IPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTL 259
           +P   +     +  +  Q+      E        +     V + + +   + +L+DV+ +
Sbjct: 217 LPYTMIEPIRELLDAGVQSDRNEVDERWTRSLREEMKFAEVELSSVLTEVEVSLRDVMNM 276

Query: 260 KIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
           K G +IP          + A    ++    G    N  I+IT+RI    +
Sbjct: 277 KPGDIIPVELP--EAVKVYAEDMPVFRGRYGVRHGNTAIKITERIQPRAE 324


>gi|241763648|ref|ZP_04761698.1| flagellar motor switch protein FliM [Acidovorax delafieldii 2AN]
 gi|241367123|gb|EER61489.1| flagellar motor switch protein FliM [Acidovorax delafieldii 2AN]
          Length = 334

 Score =  248 bits (634), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 43/305 (14%), Positives = 95/305 (31%), Gaps = 11/305 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           +              R+                +   + +         +    +IS  +
Sbjct: 30  AEAGAVRNYDISSQERIVRG------RMPTMEIVNERFARNFRIGLFNFIRRSPEISVGT 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
               ++S  +        F+  ++     +  I C  +LV  +++ L G   +   ++  
Sbjct: 84  VSVQRYSAFLRELAVPTNFNIVAIRPLRGSGLIVCEPSLVFGIIDTLYGGVGKFQTRIEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  S  E+++  R +  I A   +           LE        +       +E V + 
Sbjct: 144 RDFSPTEQRVINRLVDVICAEYKKAWHGIYPLE--LEYQRSEMQPQFANIATPSEIVVST 201

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNID 243
              + I +++ +  + +P  TL     +   S+Q  S       +    R+     V + 
Sbjct: 202 AFQLEIGDLSGAIHICMPYATLEPIRDVLYSSTQGDSIEVDRRWVRVLTREIQAAEVTLV 261

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
             +     T++ ++ +K G  I            S  G  I+ C+ G     Y IRI + 
Sbjct: 262 AELAQADATVEQLLAMKPGDFIELDREP--RIRASIGGVPIFECQYGTHNSKYAIRIEEC 319

Query: 304 INFDQ 308
           +    
Sbjct: 320 LRNAD 324


>gi|261340410|ref|ZP_05968268.1| flagellar motor switch protein FliM [Enterobacter cancerogenus ATCC
           35316]
 gi|288317502|gb|EFC56440.1| flagellar motor switch protein FliM [Enterobacter cancerogenus ATCC
           35316]
          Length = 334

 Score =  248 bits (633), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 38/305 (12%), Positives = 95/305 (31%), Gaps = 10/305 (3%)

Query: 3   GQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISY 62
           G +   N  P  P    R+       +   +    +   + +         +    DI+ 
Sbjct: 28  GLAGDDNIRPYDPNTQRRVV------RERLQALEIINERFARQFRMGLFNLLRRSPDITV 81

Query: 63  TSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQL 122
            + +   +     +       +   L        +  S +LV   ++NL G       ++
Sbjct: 82  GAIRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKV 141

Query: 123 YNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVT 182
             R  +  E+++  R +       +                  +     N     N+ V 
Sbjct: 142 EGREFTHTEQRVINRMLKLALESYSDAWKAINPLEVEYVRSE-MQVKFTNITTSPNDIVV 200

Query: 183 TINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVN 241
               ++ I N+   F + +P   +     + ++   + S ++ ++  +   R+     + 
Sbjct: 201 NTPFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRHEDQNWRENLVRQVQHSQLE 260

Query: 242 IDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
           +          L  ++ L+ G V+P         I   +G  + + + G +   Y +R+ 
Sbjct: 261 LVANFADVSMRLSQILKLQPGDVLPIDKP--DRIIAHVDGVPVLTSQYGTINGQYALRVE 318

Query: 302 DRINF 306
             IN 
Sbjct: 319 HLINP 323


>gi|238025700|ref|YP_002909931.1| flagellar motor switch protein FliM [Burkholderia glumae BGR1]
 gi|237874894|gb|ACR27227.1| Flagellar motor switch protein FliM [Burkholderia glumae BGR1]
          Length = 332

 Score =  248 bits (633), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 38/306 (12%), Positives = 93/306 (30%), Gaps = 11/306 (3%)

Query: 6   IHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSC 65
             K   P +     R+                +   + + L       M    +IS +  
Sbjct: 31  EQKGVRPYNLATQERIVRG------RMPGLEIINDRFARLLRVGIFNFMRRTAEISVSQV 84

Query: 66  QSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNR 125
           +  K+S    +       +   +             NLV  +++NL G       ++  R
Sbjct: 85  KVQKYSEFTRNLPIPTNLNLVHIKPLRGTSLFVFDPNLVFFVVDNLFGGDGRFHTRVEGR 144

Query: 126 SLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTIN 185
             +  E ++  R +  +    +    + +      E      + +       NE V    
Sbjct: 145 DFTQTEMRIISRLLHLVFEHYSVAWKSVRPLQ--FEHVRSEMHTQFANVATPNEIVIVTQ 202

Query: 186 MNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDT 244
            ++       +  + +P   +     +  S  Q ++       +   +++     V +  
Sbjct: 203 FSIEFGPTGGTLHICMPYSMIEPIRDVLSSPIQGEALEVDRRWVRVLSQQVQSAEVELTA 262

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
            +    +T + ++ L++G V+P     +   I   +G  +  C  G     Y +R+   I
Sbjct: 263 NLTEMPSTFEKILNLRVGDVLPID--VEESIIAKVDGVPVMECGYGIFNGQYALRVNRMI 320

Query: 305 NFDQKS 310
           +     
Sbjct: 321 SASDTM 326


>gi|261821166|ref|YP_003259272.1| flagellar motor switch protein FliM [Pectobacterium wasabiae
           WPP163]
 gi|261605179|gb|ACX87665.1| flagellar motor switch protein FliM [Pectobacterium wasabiae
           WPP163]
          Length = 337

 Score =  248 bits (633), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 41/309 (13%), Positives = 96/309 (31%), Gaps = 10/309 (3%)

Query: 6   IHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSC 65
              +  P  P    R+       +   +    +   + +         +    DI+    
Sbjct: 32  TDGDVKPYDPNTQRRVI------RERLQALEIINERFARQFRMALFNLLRRSPDITVGGI 85

Query: 66  QSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNR 125
           +   +     +       +   L           S +LV   ++NL G       ++  R
Sbjct: 86  KIQPYHEFARNLPVPTNLNLIHLKPLRGTALFVFSPSLVFIAVDNLFGGDGRFPTKVEGR 145

Query: 126 SLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTIN 185
             +  E+++ KR +        +  +   +          +     N     N+ V T  
Sbjct: 146 EFTHTEQRVVKRMLRLALEAYGEAWNAIYKLDIEYVRSE-MQVKFTNITTSPNDIVVTTP 204

Query: 186 MNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNIDT 244
            ++ I ++   F + IP   +     +  +   + S  + +   D  A++     + +  
Sbjct: 205 FHVEIGSLTGEFNICIPFSMIEPLRELLANPPLENSRQEDQSWRDTLAKQVQHSELELVA 264

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
                   L  ++ L+ G V+P         +   +G  + + + G +   Y +R+   I
Sbjct: 265 NFVDIPLRLSKILKLQPGDVLPIDKP--EKIVAHVDGVPVLTSQYGTLNGQYALRVEHLI 322

Query: 305 NFDQKSLKN 313
           N    SL N
Sbjct: 323 NPILNSLDN 331


>gi|121533750|ref|ZP_01665577.1| flagellar motor switch protein FliM [Thermosinus carboxydivorans
           Nor1]
 gi|121307741|gb|EAX48656.1| flagellar motor switch protein FliM [Thermosinus carboxydivorans
           Nor1]
          Length = 334

 Score =  248 bits (633), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 43/313 (13%), Positives = 105/313 (33%), Gaps = 14/313 (4%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           ++ +   +           +        K   +    L   + + +       +   V I
Sbjct: 29  IKSEQKERKIKVYDFKRPDKF------SKDQIRTLYMLHENFARLINTYLSAHLRTLVHI 82

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           +  S     +   I S     V S   +     N  +  + N+V  +++ L G +     
Sbjct: 83  NVASVDQLTYEEFIRSLPNPSVISIFQMPPLKGNVILELNPNIVFAVIDRLFGGTGVAPV 142

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           +   R L+ +E+ + +R +A++     +         P +         +       ++ 
Sbjct: 143 KP--RPLTDIEEAIIRRVLAKMLEGFQEAWKQVVAVEPRIGAIET--NPQFAQIVPPSDM 198

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS----QNKSENQSEDLIDPFARKTY 236
           V  I +   I        + IP   L        ++       ++  +++ I    RK  
Sbjct: 199 VVIITLQAKIGQAEGLINVCIPYLVLEPIMSKLTTTFWVALGTTKQVTQENITTLQRKLQ 258

Query: 237 QLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNY 296
           + +V +   +     T++D++ L +G V+    R      +    +E + C+ G VG   
Sbjct: 259 RTSVPVIVELGRATVTVQDLLDLAVGDVLQLESRFDGELSVIIGQREKFKCKPGLVGGKV 318

Query: 297 TIRITDRINFDQK 309
            ++IT+ +    +
Sbjct: 319 AVQITEVMLKGDE 331


>gi|262276388|ref|ZP_06054197.1| flagellar motor switch protein FliM [Grimontia hollisae CIP 101886]
 gi|262220196|gb|EEY71512.1| flagellar motor switch protein FliM [Grimontia hollisae CIP 101886]
          Length = 353

 Score =  248 bits (633), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 36/308 (11%), Positives = 92/308 (29%), Gaps = 11/308 (3%)

Query: 2   RGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDIS 61
            G       S        R+                +   + + +       +    ++S
Sbjct: 27  SGSEDVGAASNFDFSSQDRIVRG------RMPTLELINERFARHMRISLFNMIRKTAEVS 80

Query: 62  YTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQ 121
               Q  KF    ++       +            I     LV  L+EN  G       +
Sbjct: 81  INGVQMVKFGEYQNTLFVPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRFHAR 140

Query: 122 LYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFV 181
           +  R  +  E+++ +  +  I        +         E                 E +
Sbjct: 141 IEGREFTPTERRVIQMLLKLIFEDYKDAWAPVMRVE--FEYLDSEVNPAMANIVSPTEVI 198

Query: 182 TTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNV 240
              + ++ ++     F +++P   +     +  +  Q+   +  +        +   + V
Sbjct: 199 VVSSFHIELDGGGGDFHVVMPYSMVEPIRELLDAGIQSDKMDTDKRWSKALQDEVMDVEV 258

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
           ++  ++     +L+D++ ++ G VIP          +       +  +LG+   N  I+I
Sbjct: 259 SLTAKLLETTLSLRDLMEMEAGDVIPVKMP--DACTVYIEDLPTFRGKLGQSNDNLAIKI 316

Query: 301 TDRINFDQ 308
           TD++   +
Sbjct: 317 TDKLKRPE 324


>gi|251789181|ref|YP_003003902.1| flagellar motor switch protein FliM [Dickeya zeae Ech1591]
 gi|247537802|gb|ACT06423.1| flagellar motor switch protein FliM [Dickeya zeae Ech1591]
          Length = 338

 Score =  248 bits (633), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 40/316 (12%), Positives = 98/316 (31%), Gaps = 16/316 (5%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
                  P  P    R+       +   +    +   + +         +    DI+  +
Sbjct: 32  QKDGGVKPYDPNTQRRVI------RERLQALEIINERFARQFRMGLFNLLRRSPDITVGA 85

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L           S +LV   ++NL G       ++  
Sbjct: 86  IKIQPYHEFARNLPVPTNLNLIHLKPLRGTALFVFSPSLVFIAVDNLFGGDGRFPTKVEG 145

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++ +R +       +   +   +          +     N     N+ V T 
Sbjct: 146 REFTHTEQRVVRRMLKLALDAYSDAWNAIYKLDVEYVRSE-MQVKFTNITTSPNDIVVTT 204

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNID 243
             ++ I  +   F + IP   +     +  +   + S+ + +   +  A++     + + 
Sbjct: 205 PFHLEIGTLTGEFSICIPFSMIEPLRELLANPPLENSQQEDQHWRETLAKQVQHSELELV 264

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  V+ LK G ++P         +   +G  + +C+ G +   Y +R+   
Sbjct: 265 ANFVDIPVRLSKVLKLKPGDILPIDKP--ERLVAHVDGVPVLTCQYGTLDGQYALRVEHL 322

Query: 304 INF------DQKSLKN 313
           IN       D++ L  
Sbjct: 323 INPILNSLNDEEPLNE 338


>gi|126653737|ref|ZP_01725655.1| flagellar motor switch protein M [Bacillus sp. B14905]
 gi|126589701|gb|EAZ83837.1| flagellar motor switch protein M [Bacillus sp. B14905]
          Length = 331

 Score =  248 bits (633), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 48/285 (16%), Positives = 101/285 (35%), Gaps = 7/285 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +  + +   + + L   F  ++   V I+  S     F   + S     + +   
Sbjct: 49  SKDQIRSLTRIHENFARLLTTFFSAQLRSYVQITVASVDQIPFEEFVRSIPNMTLINVFE 108

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +     N  +  + N+  ++L+ L+G S  +   + N  L+ +E K+      +    L 
Sbjct: 109 VPPLDGNILMEINPNIAYSMLDRLMGGSGASHSNVDN--LTEIETKIMTNLFERSFDNLR 166

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +      E  P L         +       NE V  I++N  I   +    + IP   L 
Sbjct: 167 EAWENVAEIDPILV--ELEVNPQFLQMISPNETVVVISLNTIIGETSGMINICIPHVVLE 224

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                       Q  ++  S +       +  Q  + +   + L   T++D +T+++G V
Sbjct: 225 PIVPNLSVRYWMQTNTKEMSPEQTKMLETRVKQAKLPLSVELGLTDITIEDFLTMQVGDV 284

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
           I    +     +L       ++ + G+ GK   I+I D +    +
Sbjct: 285 IQLEQKINDPLLLKVGTLPKFTVQPGKQGKKLAIQIIDPLKGGDE 329


>gi|253688959|ref|YP_003018149.1| flagellar motor switch protein FliM [Pectobacterium carotovorum
           subsp. carotovorum PC1]
 gi|251755537|gb|ACT13613.1| flagellar motor switch protein FliM [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 337

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 42/309 (13%), Positives = 96/309 (31%), Gaps = 10/309 (3%)

Query: 6   IHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSC 65
           +     P  P    R+       +   +    +   + +         +    DI+    
Sbjct: 32  VDGGVKPYDPNTQRRVI------RERLQALEIINERFARQFRMGLFNLLRRSPDITVGGI 85

Query: 66  QSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNR 125
           +   +     +       +   L           S +LV   ++NL G       ++  R
Sbjct: 86  KIQPYHEFARNLPVPTNLNLIHLKPLRGTALFVFSPSLVFIAVDNLFGGDGRFPTKVEGR 145

Query: 126 SLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTIN 185
             +  E+++ KR +        +  +   +          +     N     N+ V T  
Sbjct: 146 EFTHTEQRVVKRMLRLALEAYGEAWNAIYKLDIEYVRSE-MQVKFTNITTSPNDIVVTTP 204

Query: 186 MNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNIDT 244
            ++ I ++   F + IP   +     +  +   + S  + +   D  A++     + +  
Sbjct: 205 FHVEIGSLTGEFNICIPFSMIEPLRELLANPPLENSRQEDQSWRDTLAKQVQHSELELVA 264

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
                   L  ++ L+ G V+P         I   +G  + + + G +   Y +R+   I
Sbjct: 265 SFVDIPLRLSKILKLQPGDVLPIDKP--DKIIAHVDGVPVMTSQYGTLNGQYALRVEHLI 322

Query: 305 NFDQKSLKN 313
           N    SL N
Sbjct: 323 NPILNSLDN 331


>gi|33592495|ref|NP_880139.1| flagellar motor switch protein FliM [Bordetella pertussis Tohama I]
 gi|33601558|ref|NP_889118.1| flagellar motor switch protein FliM [Bordetella bronchiseptica
           RB50]
 gi|33572141|emb|CAE41684.1| flagellar motor switch protein FliM [Bordetella pertussis Tohama I]
 gi|33575994|emb|CAE33074.1| flagellar motor switch protein FliM [Bordetella bronchiseptica
           RB50]
 gi|332381913|gb|AEE66760.1| flagellar motor switch protein FliM [Bordetella pertussis CS]
          Length = 336

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 34/310 (10%), Positives = 94/310 (30%), Gaps = 9/310 (2%)

Query: 4   QSIHKNTSPLHPILLAR---LTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
               +           R   L+      +   +    +   + + +  +    M  + DI
Sbjct: 21  GESDEKQPAGDEAGAPRAYDLSSPERVVRRRMQTLELINERFARHMRNVLLNFMRRNADI 80

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           +  + +  K++    +       +   +             NLV  ++++L G       
Sbjct: 81  TVGAIKILKYADFERNLPVPSNLNMIQMKPLRGTALFTYDPNLVFLVIDSLFGGDGRYHT 140

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++  R  +T E+++ +R +        +                     K  +   +NE 
Sbjct: 141 RVEGRDFTTTEQRIIRRLLNLTLESYGKSWDPVYPIEFEYVRSEMHT--KFASITGNNEV 198

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKS--ENQSEDLIDPFARKTYQL 238
           V     ++          + +P   +     +       +  E   +       R+    
Sbjct: 199 VVVSPFHIEFGATGGDLNICLPYSMIEPVRDLLTRPLQDTALEEVDQRWAQQLQRQVRSA 258

Query: 239 NVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTI 298
           ++++        +++ +++ +K G V+P             +G  +  C  G     Y +
Sbjct: 259 DIDLVAEFGHIPSSIGELMRMKTGDVLPIAVP--ETVTAHVDGVPLMECGYGVFNGRYAL 316

Query: 299 RITDRINFDQ 308
           R+ + IN+D 
Sbjct: 317 RVQNLINYDD 326


>gi|300693352|ref|YP_003749325.1| flagellar motor switching and energizing component [Ralstonia
           solanacearum PSI07]
 gi|299075389|emb|CBJ34684.1| flagellar motor switching and energizing component [Ralstonia
           solanacearum PSI07]
          Length = 335

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 34/276 (12%), Positives = 91/276 (32%), Gaps = 5/276 (1%)

Query: 31  IEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSS 90
                  +   + +         +  + +IS    +  K+S  I +       +   +  
Sbjct: 50  RMPTLEIINERFARNWRMGLFNFLRRNAEISVGPVKVQKYSEFIRNLVVPAAINLVHVKP 109

Query: 91  WSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCI 150
                      NL+  ++++L G       ++  R  + VE+++ +R +  +     +  
Sbjct: 110 LRGTALFVFDPNLIFIVVDHLFGGDGRFHMRVEGRDFTQVEQRIIQRMLQLMFDHYGKAW 169

Query: 151 STTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTT 210
                     E      + +       NE V + + +M + +      + +P   +    
Sbjct: 170 QPIYPIE--FEALRMEMHTEFANVATPNEVVVSTSFSMELGSNGGDVHVCMPYTMIEPIR 227

Query: 211 LISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLH 269
            +  S+ Q ++    +  +   +++     V +   +      + D++ +K+G VIP   
Sbjct: 228 DLLTSAIQGEALEVDKRWVRLLSQQVQTAEVELVAHLANANVQVSDILNMKVGDVIPLEL 287

Query: 270 REKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
                     +G  +  C  G     Y +R+   +N
Sbjct: 288 --DDSVTAKVDGVPVMECAYGTFNGQYALRVNRMLN 321


>gi|332305666|ref|YP_004433517.1| flagellar motor switch protein FliM [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332172995|gb|AEE22249.1| flagellar motor switch protein FliM [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 352

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 40/301 (13%), Positives = 91/301 (30%), Gaps = 11/301 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
             +          R+                +   + + +       M    ++S    Q
Sbjct: 31  DGSALEYDFSSQDRIVRG------RMPTLEIVNERFARHMRVSLFNMMRRSAEVSINGIQ 84

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
             KF   IH+       +            I     LV  L++N  G       ++  R 
Sbjct: 85  MIKFGEYIHTLFVPTSLNMVRFRPLKGTGLITMEARLVFILVDNFFGGDGRYHAKIEGRE 144

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E+++ +  +  I     +  +   +   + E                 E V   + 
Sbjct: 145 FTPTERRIIQMLLKLIFEDYKEAWAPVMDV--SFEYLDSEVNPAMANIVSPTEVVVISSF 202

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTR 245
           ++ ++     F + +P   L     +  +  Q+  E+           +   + V + T 
Sbjct: 203 HIELDGGGGDFHVSLPYSMLEPIRELLDAGVQSDKEDTDLRWSKALRDEIMDVKVELSTH 262

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           +     +L+ ++ +K G +IP          +       +  +LGR   N  ++ITD+I 
Sbjct: 263 MMDLTLSLQKIMDMKAGDIIPIDMP--EHITVMIEELPTFRAKLGRSRDNLALKITDKIP 320

Query: 306 F 306
            
Sbjct: 321 R 321


>gi|295098287|emb|CBK87377.1| flagellar motor switch protein FliM [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 334

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 38/305 (12%), Positives = 95/305 (31%), Gaps = 10/305 (3%)

Query: 3   GQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISY 62
           G +   N  P  P    R+       +   +    +   + +         +    DI+ 
Sbjct: 28  GLTGDDNIRPYDPNTQRRVV------RERLQALEIINERFARQFRMGLFNLLRRSPDITV 81

Query: 63  TSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQL 122
            + +   +     +       +   L        +  S +LV   ++NL G       ++
Sbjct: 82  GAIRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKV 141

Query: 123 YNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVT 182
             R  +  E+++  R +       +                  +     N     N+ V 
Sbjct: 142 EGREFTHTEQRVINRMLKLALESYSDAWKAINPLEVEYVRSE-MQVKFTNITTSPNDIVV 200

Query: 183 TINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVN 241
               ++ I N+   F + +P   +     + ++   + S ++ ++  +   R+     + 
Sbjct: 201 NTPFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRHEDQNWRENLVRQVQHSQLE 260

Query: 242 IDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
           +          L  ++ L+ G V+P         I   +G  + + + G +   Y +R+ 
Sbjct: 261 LVANFADISMRLSQILKLQPGDVLPIDKP--DRIIAHVDGVPVLTSQYGTINGQYALRVE 318

Query: 302 DRINF 306
             IN 
Sbjct: 319 HLINP 323


>gi|311068153|ref|YP_003973076.1| flagellar motor switch protein FliM [Bacillus atrophaeus 1942]
 gi|310868670|gb|ADP32145.1| flagellar motor switch protein FliM [Bacillus atrophaeus 1942]
          Length = 332

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 38/313 (12%), Positives = 101/313 (32%), Gaps = 14/313 (4%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           ++ +   K           R        K   +  + +   + + L   F  ++   + I
Sbjct: 28  LKKEDSEKKVKVYDFKRALRF------SKDQIRSLTRIHDNFARLLTTHFSAQLRTYIHI 81

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S +S     +   I S     + +   +        +  +  +   +++ ++G    +  
Sbjct: 82  SVSSVDQVPYEEFIRSIPNMTILNLFDVHPMEGRIMMEVNPTVAYAMMDRVMGGIGISHN 141

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++ +  L+ +E K+             +   +  +  P  E        +       NE 
Sbjct: 142 KVDS--LTEIETKIISNLFENALGNYKEAWQSIADIEP--EMTEFEVNPQFVQMVSPNET 197

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQ 237
           V  I++N  I  ++    L IP   L             Q++      +      ++   
Sbjct: 198 VVVISLNTQIGEISGVINLCIPHVVLEPIIPKLSVHYWMQSERNEPKPEETKSLEKRIMT 257

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             + +   +   + T+++ ++L++G  I           +    K  +  + GRV +   
Sbjct: 258 AQIPVVAELGTSELTIEEFLSLEVGDCITLDKSVTDPLTVLVGDKPKFLGQAGRVNRKQA 317

Query: 298 IRITDR-INFDQK 309
           ++I D  I  ++ 
Sbjct: 318 VQILDHDIRGEKD 330


>gi|163801852|ref|ZP_02195749.1| flagellar motor switch protein M [Vibrio sp. AND4]
 gi|159174360|gb|EDP59164.1| flagellar motor switch protein M [Vibrio sp. AND4]
          Length = 348

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 38/301 (12%), Positives = 90/301 (29%), Gaps = 11/301 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
            +NT+        R+                +   + + +       +    ++S    Q
Sbjct: 31  DENTTNFDFSSQDRIVRG------RMPTLELINERFARHMRISLFNMLRKTAEVSINGVQ 84

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
             KF    ++       +            I     LV  L+EN  G       ++  R 
Sbjct: 85  MMKFGEYQNTLYVPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRFHAKIEGRE 144

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E+++ +  +  +     +  S         E                 E +   + 
Sbjct: 145 FTPTERRIIQLLLKIVFEDYKEAWSPVMGVE--FEYLDSEVNPSMANIVSPTEVIVVSSF 202

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTR 245
           ++ ++     F +++P   +     +  +  Q+               +     VN    
Sbjct: 203 HIEVDGGGGDFHVVMPYSMVEPIRELLDAGVQSDKMETDVRWSSALREEIMDCPVNFRVN 262

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           +  K  +L+D++ L+ G VIP    E   A +       Y  ++GR      +++++ I 
Sbjct: 263 LLEKDISLRDLMELQPGDVIPIDMPEN--ATMFIEDLPTYRVKMGRSEDKLAVQVSEEIE 320

Query: 306 F 306
            
Sbjct: 321 R 321


>gi|317406219|gb|EFV86466.1| flagellar motor switch protein [Achromobacter xylosoxidans C54]
          Length = 335

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 34/307 (11%), Positives = 100/307 (32%), Gaps = 6/307 (1%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S  ++  P        L+      +   +    +   + + +  +    M    DI+  S
Sbjct: 25  SKKESAGPNDGARAYDLSSPDRVVRRRMQTLELINERFARQMRSVLLNFMRRSADITVGS 84

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +  K++    +       +   +             NLV  ++++L G       ++  
Sbjct: 85  IKIQKYADFERNLPVPSNLNMVQMKPLRGTALFTYDPNLVFLVIDSLFGGDGRYHTRVEG 144

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +T E+++ +R +        +          +          K  +   +NE V   
Sbjct: 145 RDFTTTEQRIIRRLLNLTLESYGKSWDPVYPIEFDYVRSEMHT--KFASITGNNEVVVVT 202

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKS--ENQSEDLIDPFARKTYQLNVNI 242
           + ++          + +P   +     +      ++  E   +      +R+    ++++
Sbjct: 203 SFHIEFGATGGDLNICLPYSMIEPVRDLLTRPLQETTLEEVDQRWSQQLSRQVRSADIDV 262

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
                   +++++++ +K+G ++P         I   +G  +  C  G     Y +R+ +
Sbjct: 263 VAEFARIPSSIRELMRMKVGDILPVDVP--QTVIAHVDGVPLMECGYGVFNGQYALRVQN 320

Query: 303 RINFDQK 309
               D +
Sbjct: 321 MFTHDTE 327


>gi|109899345|ref|YP_662600.1| flagellar motor switch protein FliM [Pseudoalteromonas atlantica
           T6c]
 gi|109701626|gb|ABG41546.1| flagellar motor switch protein FliM [Pseudoalteromonas atlantica
           T6c]
          Length = 352

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 40/296 (13%), Positives = 90/296 (30%), Gaps = 11/296 (3%)

Query: 12  PLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFS 71
                   R+                +   + + +       M    ++S    Q  KF 
Sbjct: 36  EYDFSSQDRIVRG------RMPTLEIVNERFARHMRVSLFNMMRRSAEVSINGIQMIKFG 89

Query: 72  HIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVE 131
             IH+       +            I     LV  L++N  G       ++  R  +  E
Sbjct: 90  EYIHTLFVPTSLNMVRFRPLKGTGLITMEARLVFILVDNFFGGDGRYHAKIEGREFTPTE 149

Query: 132 KKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIE 191
           +++ +  +  I     +  +   +   + E                 E V   + ++ ++
Sbjct: 150 RRIIQMLLKLIFEDYKEAWAPVMDV--SFEYLDSEVNPAMANIVSPTEVVVISSFHIELD 207

Query: 192 NVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKK 250
                F + +P   L     +  +  Q+  E+           +   + V + T +    
Sbjct: 208 GGGGDFHVSLPYSMLEPIRELLDAGVQSDKEDTDLRWSKALRDEIMDVKVELSTHMMDLT 267

Query: 251 TTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
            +L+ ++ +K G +IP          +       +  +LGR   N  ++ITD+I  
Sbjct: 268 LSLQKIMDMKAGDIIPIDMP--EHITVMIEELPTFRAKLGRSRDNLALKITDKIPR 321


>gi|149182515|ref|ZP_01860988.1| flagellar motor switch protein M [Bacillus sp. SG-1]
 gi|148849775|gb|EDL63952.1| flagellar motor switch protein M [Bacillus sp. SG-1]
          Length = 332

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 48/285 (16%), Positives = 99/285 (34%), Gaps = 7/285 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +  + +   + + L   F  ++   V I+  S     F   + S  +  + +   
Sbjct: 49  SKDQIRSLTRIHENFARILTTYFSAQLRTYVQITVVSADQVPFEEFVRSVPKMTILNIFD 108

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +     +  +  + N+   +++ ++G     I ++ N  L+ +E K+      +    L 
Sbjct: 109 VPPLDGHILMEVNPNIGYAMMDRVMGGKGTGINKIEN--LTEIETKIMSNLFERAFDNLR 166

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
              S   E  P L         +       NE V  I+MN TI   +    +IIP   L 
Sbjct: 167 DAWSNIAEIDPMLS--EFEVNPQFLQMVSPNETVVVISMNTTIGETSGMINIIIPHVVLE 224

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                       Q K+++      +   ++     V I   +     T+ D + L IG V
Sbjct: 225 PIIPKLSVSYWMQTKNKDIDPQETEMLEKRIKTAQVPIVAELGDSDITIDDFLMLDIGDV 284

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
           I    R      +       ++ + G + K   ++I D +   ++
Sbjct: 285 IQLNKRIDAPLTIKVGEIPKFTAQPGELNKRLAVQILDSLKGGEE 329


>gi|156933435|ref|YP_001437351.1| flagellar motor switch protein FliM [Cronobacter sakazakii ATCC
           BAA-894]
 gi|156531689|gb|ABU76515.1| hypothetical protein ESA_01253 [Cronobacter sakazakii ATCC BAA-894]
          Length = 334

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 38/301 (12%), Positives = 92/301 (30%), Gaps = 10/301 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
             +  P  P    R+       +   +    +   + +         +    DI+  + +
Sbjct: 31  DGDIRPYDPNTQRRVV------RERLQALEIINERFARQFRMGLFNLLRRSPDITVGAIR 84

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
              +     +       +   L           S +LV   ++NL G       ++  R 
Sbjct: 85  IQPYHEFARNLPVPTNLNLIHLKPLRGTGLFVFSPSLVFIAVDNLFGGDGRFPTKVEGRE 144

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E+++  R +       +                  +     N     N+ V     
Sbjct: 145 FTHTEQRVINRMLKLALEAYSDAWKAINPLDVEYVRSE-MQVKFTNITTSPNDIVVNTPF 203

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNIDTR 245
           ++ I N+   F + +P   +     + ++   + S  + ++  D   R+     + +   
Sbjct: 204 HVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRQEDQNWRDTLVRQVQHSELELIAN 263

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
                  L  ++ LK G V+P         ++  +G  + + + G V   Y +R+   IN
Sbjct: 264 FAEIPLRLSKILKLKPGDVLPIDKP--DRILVHVDGVPVLTSQYGTVNGQYALRVEHLIN 321

Query: 306 F 306
            
Sbjct: 322 P 322


>gi|207728361|ref|YP_002256755.1| flagellar motor switch protein flim [Ralstonia solanacearum MolK2]
 gi|206591607|emb|CAQ57219.1| flagellar motor switch protein flim [Ralstonia solanacearum MolK2]
          Length = 335

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 37/303 (12%), Positives = 96/303 (31%), Gaps = 11/303 (3%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           Q+        +     R+                +   + +         +  + +IS  
Sbjct: 29  QAEAAGVRTYNLGSQERIVRG------RMPTLEIINERFARNWRMGLFNFLRRNAEISVG 82

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
             +  K+S  I +       +   +             NL+  ++++L G       ++ 
Sbjct: 83  PVKVQKYSEFIRNLVVPAAINLVHVKPLRGTALFVFDPNLIFIVVDHLFGGDGRFHMRVE 142

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  + VE+++ +R +A +     +            E      + +       NE V +
Sbjct: 143 GRDFTQVEQRIIQRMLALMFEHYGKAWQPIYPIE--FEPLRMEMHTEFANVATPNEVVVS 200

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNI 242
              +M + +      + +P   +     +  S+ Q ++    +  +   +++     V +
Sbjct: 201 TRFSMELGSNGGDVHVCMPYTMIEPIRDLLTSAIQGEALEVDKRWVRLLSQQVQTAEVEV 260

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
              +      + D++ +K+G VIP             +G  +  C  G     Y +R+  
Sbjct: 261 VAHLANANVHVSDILNMKVGDVIPLEL--DDSVTARVDGVPVMECAYGTFNGQYALRVNR 318

Query: 303 RIN 305
            +N
Sbjct: 319 MLN 321


>gi|307131596|ref|YP_003883612.1| flagellar motor switch protein fliM [Dickeya dadantii 3937]
 gi|306529125|gb|ADM99055.1| Flagellar motor switch protein fliM [Dickeya dadantii 3937]
          Length = 338

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 40/316 (12%), Positives = 99/316 (31%), Gaps = 16/316 (5%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
               +  P  P    R+       +   +    +   + +         +    DI+  +
Sbjct: 32  QKDGDVKPYDPNTQRRVI------RERLQALEIINERFARQFRMGLFNLLRRSPDITVGA 85

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L           S +LV   ++NL G       ++  
Sbjct: 86  IKIQPYHEFARNLPVPTNLNLIHLKPLRGTALFVFSPSLVFIAVDNLFGGDGRFPTKVEG 145

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++ +R +       +   +   +          +     N     N+ V T 
Sbjct: 146 REFTHTEQRVVRRMLKLALESYSDAWNAIYKLDVEYVRSE-MQVKFTNITTSPNDIVVTT 204

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNID 243
             ++ I  +   F + IP   +     +  +   + S+ + +   +  A++     + + 
Sbjct: 205 PFHLEIGTLTGEFSICIPFSMIEPLRELLANPPLENSQQEDQHWRETLAKQVQHSELELV 264

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  V+ LK G ++P         +   +G  + +C+ G +   Y +R+   
Sbjct: 265 ANFVDIPVRLSKVLKLKPGDILPIDKP--ERLVAHVDGVPVLTCQYGTLDGQYALRVEHL 322

Query: 304 INF------DQKSLKN 313
           IN       D++ L  
Sbjct: 323 INPILNSLNDEEPLNE 338


>gi|299534775|ref|ZP_07048105.1| flagellar motor switch protein FliM [Lysinibacillus fusiformis ZC1]
 gi|298729863|gb|EFI70408.1| flagellar motor switch protein FliM [Lysinibacillus fusiformis ZC1]
          Length = 331

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 48/285 (16%), Positives = 102/285 (35%), Gaps = 7/285 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +  + +   + + L   F  ++   V I+  S     F   + S     + +   
Sbjct: 49  SKDQIRSLTRIHENFARLLTTFFSAQLRSYVQITVASVDQIPFEEFVRSIPNMTLINVFE 108

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +     N  +  + N+  ++L+ L+G S  +   + N  L+ +E K+      +    L 
Sbjct: 109 VPPLDGNILMEINPNIAYSMLDRLMGGSGASHSNVDN--LTEIETKIMTNLFERSFDNLR 166

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +      E  P L         +       NE V  I++N  I   +    + IP   L 
Sbjct: 167 EAWENVAEIDPILV--ELEVNPQFLQMISPNETVVVISLNTIIGETSGMINICIPHVVLE 224

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                       Q  ++  S +       +  Q  + +   + L   T++D +T+++G V
Sbjct: 225 PIVPNLSVRYWMQTNTKEMSPEQTKMLETRVKQAQLPLSVELGLTDITIEDFLTMQVGDV 284

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
           I    + +   +L       ++ + G+ GK   I+I D +    +
Sbjct: 285 IQLDQKIEAPLLLKVGTLPKFTVQPGKKGKKLAIQIIDPLKGGDE 329


>gi|312876509|ref|ZP_07736492.1| flagellar motor switch protein FliM [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311796720|gb|EFR13066.1| flagellar motor switch protein FliM [Caldicellulosiruptor
           lactoaceticus 6A]
          Length = 329

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 39/305 (12%), Positives = 97/305 (31%), Gaps = 13/305 (4%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
            KN         ++        K   +    +   Y + +       +   V +   S +
Sbjct: 33  EKNIRVYDFKRPSKF------AKDHLRTLQMIFENYARIVTTFLSGYLRTVVQMDVLSVE 86

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
              +    +S     V    + S    +     +  L   +++ +LG   + I ++  R+
Sbjct: 87  QLTYYEFSNSLSNPVVMGVVNFSPLKGSIVFEMAPELAFAMIDRVLGGFGKGIDKV--RT 144

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            + +E  L +R + Q+     +         P +E        +       NE V  + +
Sbjct: 145 FTEIELALIERLLQQLINYFQEAWENIIHIRPRIEKIET--NPQFTQIVSPNETVALVTI 202

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNID 243
            M +        + +P   +                ++  SE+  +   +K  +  V + 
Sbjct: 203 TMKVGEAEGMANICLPHMVIEPIMPRLSTKFWFSTSAKETSEETKEYLQKKIERTRVTVK 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
             +   + T+++ + L++G V+    R+     +    K  +    GR      ++IT  
Sbjct: 263 AVLGRTQITVREFLELQVGDVLRLDRRKNQEIEVFVGNKLKFYGVPGRKEGRIAVKITRV 322

Query: 304 INFDQ 308
              + 
Sbjct: 323 EEGED 327


>gi|292669771|ref|ZP_06603197.1| flagellar motor switch protein FliM [Selenomonas noxia ATCC 43541]
 gi|292648568|gb|EFF66540.1| flagellar motor switch protein FliM [Selenomonas noxia ATCC 43541]
          Length = 333

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 43/286 (15%), Positives = 94/286 (32%), Gaps = 8/286 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +    L   + + L       +   +DI   S +   +   + S     V    +
Sbjct: 49  SKDQIRTLFMLHESFSRLLNTYLSASLRAMIDIEVMSVEQMTYQEFVQSMGNPSVIGIIA 108

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           L     N  I    ++    ++ + G   +   +  +R+L+ +E  + +R I  +     
Sbjct: 109 LPPLKGNIIIEVGTDIAFAYIDRIFGGEGKPGVK--SRALTDIEAAVMRRFIDTVINYFR 166

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  S   E  PN E        +       ++ V  I +++ + +V     + IP   L 
Sbjct: 167 EAWSNVIEFRPNFETMET--NPQFAQIVPPSDMVVLITIHVKMGDVEGMMNVCIPYLVLE 224

Query: 208 KTTLISLSS----QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQ 263
                  +S     +  +  + + +    RK  +  V     +     T+ + +TL  G 
Sbjct: 225 PVMSKLTTSFWVASSVDKESTPEQVAELQRKIERTWVPFSVELGSVDITINEFLTLGFGD 284

Query: 264 VIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
           V+      +   +        +    G  GK   ++I+  I  D  
Sbjct: 285 VLQLDTLAQDELVCYVGTNPKFRAHPGTAGKRMAVQISGIIEGDDD 330


>gi|227112534|ref|ZP_03826190.1| flagellar motor switch protein FliM [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 337

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 41/310 (13%), Positives = 97/310 (31%), Gaps = 10/310 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
            +     P  P    R+       +   +    +   + +         +    DI+  +
Sbjct: 31  QVDGGVKPYDPNTQRRVI------RERLQALEIINERFARQFRMGLFNLLRRSPDITVGA 84

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L           S +LV   ++NL G       ++  
Sbjct: 85  IKIQPYHEFARNLPVPTNLNLIHLKPLRGTALFVFSPSLVFIAVDNLFGGDGRFPTKVEG 144

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++ KR +        +  +   +          +     N     N+ V T 
Sbjct: 145 REFTHTEQRVVKRMLRLALEAYGEAWNAIYKLDIEYVRSE-MQVKFTNITTSPNDIVVTT 203

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNID 243
             ++ I ++   F + IP   +     +  +   + S  + +   D  A++     + + 
Sbjct: 204 PFHVEIGSLTGEFNICIPFSMIEPLRELLANPPLENSRQEDQSWRDTLAKQVQHSELELV 263

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ L+ G V+P         +   +G  + + + G +   Y +R+   
Sbjct: 264 ASFVDIPLRLSKILKLQPGDVLPIDKP--DKIVAHVDGVPVLTSQYGTLNGQYALRVEHL 321

Query: 304 INFDQKSLKN 313
           IN    SL N
Sbjct: 322 INPILNSLDN 331


>gi|26248214|ref|NP_754254.1| flagellar motor switch protein FliM [Escherichia coli CFT073]
 gi|91211163|ref|YP_541149.1| flagellar motor switch protein FliM [Escherichia coli UTI89]
 gi|110642051|ref|YP_669781.1| flagellar motor switch protein FliM [Escherichia coli 536]
 gi|117624085|ref|YP_852998.1| flagellar motor switch protein FliM [Escherichia coli APEC O1]
 gi|237705904|ref|ZP_04536385.1| flagellar motor switch protein FliM [Escherichia sp. 3_2_53FAA]
 gi|331642566|ref|ZP_08343701.1| flagellar motor switch protein FliM [Escherichia coli H736]
 gi|331647539|ref|ZP_08348631.1| flagellar motor switch protein FliM [Escherichia coli M605]
 gi|331653357|ref|ZP_08354362.1| flagellar motor switch protein FliM [Escherichia coli M718]
 gi|331673458|ref|ZP_08374226.1| flagellar motor switch protein FliM [Escherichia coli TA280]
 gi|331677827|ref|ZP_08378502.1| flagellar motor switch protein FliM [Escherichia coli H591]
 gi|332278888|ref|ZP_08391301.1| flagellar motor switch protein FliM [Shigella sp. D9]
 gi|26108618|gb|AAN80821.1|AE016762_74 Flagellar motor switch protein fliM [Escherichia coli CFT073]
 gi|91072737|gb|ABE07618.1| flagellar motor switch protein FliM [Escherichia coli UTI89]
 gi|110343643|gb|ABG69880.1| flagellar motor switch protein FliM [Escherichia coli 536]
 gi|115513209|gb|ABJ01284.1| Flagellar motor switch protein [Escherichia coli APEC O1]
 gi|226900661|gb|EEH86920.1| flagellar motor switch protein FliM [Escherichia sp. 3_2_53FAA]
 gi|331039364|gb|EGI11584.1| flagellar motor switch protein FliM [Escherichia coli H736]
 gi|331043263|gb|EGI15401.1| flagellar motor switch protein FliM [Escherichia coli M605]
 gi|331049455|gb|EGI21527.1| flagellar motor switch protein FliM [Escherichia coli M718]
 gi|331069656|gb|EGI41043.1| flagellar motor switch protein FliM [Escherichia coli TA280]
 gi|331074287|gb|EGI45607.1| flagellar motor switch protein FliM [Escherichia coli H591]
 gi|332101240|gb|EGJ04586.1| flagellar motor switch protein FliM [Shigella sp. D9]
          Length = 349

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 41/303 (13%), Positives = 94/303 (31%), Gaps = 10/303 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+       +   +    +   + +         +    DI+  +
Sbjct: 45  SGESDIRPYDPNTQRRVV------RERLQALEIINERFARHFRMGLFNLLRRSPDITVGA 98

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G       ++  
Sbjct: 99  IRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEG 158

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +                  +     N     N+ V   
Sbjct: 159 REFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVRSE-MQVKFTNITTSPNDIVVNT 217

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     + ++   + S N+ ++  D   R+     + + 
Sbjct: 218 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELV 277

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK G V+P         I   +G  + + + G +   Y +RI   
Sbjct: 278 ANFADISLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRIEHL 335

Query: 304 INF 306
           IN 
Sbjct: 336 INP 338


>gi|302389672|ref|YP_003825493.1| flagellar motor switch protein FliM [Thermosediminibacter oceani
           DSM 16646]
 gi|302200300|gb|ADL07870.1| flagellar motor switch protein FliM [Thermosediminibacter oceani
           DSM 16646]
          Length = 331

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 49/312 (15%), Positives = 100/312 (32%), Gaps = 13/312 (4%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           ++ ++  K           +        K        +   + + L   F  ++   V I
Sbjct: 27  IKKEANEKKIKVYDFKKPNKF------SKEQLNTLHLIHENFSRQLITFFSTQLRTLVQI 80

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           + +S     +S  I S     +              I  + ++  ++++ LLG S E   
Sbjct: 81  NASSVDQMPYSEFISSIPNPSIIGIVDFQPLRGAIIIAMNVSMAFSIIDRLLGGSGEYKD 140

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           +   R  + +E  +  R  +++  ++ +      E  P  +        +       NE 
Sbjct: 141 KP--REPTEIEANILHRVYSKLVKLMQEAWQDILEIHPVFDKLET--NPQFVQLVSPNEA 196

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQ 237
           V  I +N  I        + IP   +              N  +   E  I    RK   
Sbjct: 197 VALITINTRIGKTDGLINICIPYIVIEPVMSRLSTKIWLSNSKKESPESFIKTITRKLEN 256

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
           +N  I   I   K T+++ + L +G VI       +   +    K  Y   +G+    + 
Sbjct: 257 VNAEIRAEIGKAKITVREFLDLDVGDVIQLDKHINSEVDVYVYDKLKYKGIMGKRNGRFA 316

Query: 298 IRITDRINFDQK 309
           +RI   I+   +
Sbjct: 317 VRINKVISERDE 328


>gi|90411030|ref|ZP_01219044.1| flagellar motor switch protein [Photobacterium profundum 3TCK]
 gi|90328243|gb|EAS44554.1| flagellar motor switch protein [Photobacterium profundum 3TCK]
          Length = 348

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 36/304 (11%), Positives = 92/304 (30%), Gaps = 11/304 (3%)

Query: 6   IHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSC 65
                S        R+                +   + + +       +    ++S    
Sbjct: 29  SETGISSFDFSSQDRIVRG------RMPTLELINERFARHMRISLFNMLRKTAEVSINGV 82

Query: 66  QSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNR 125
           Q  KF    ++       +            I     LV  L+EN  G       ++  R
Sbjct: 83  QMIKFGEYQNTLYVPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRFHAKIEGR 142

Query: 126 SLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTIN 185
             +  E+++ +  +  +     +  S         E                 E +   +
Sbjct: 143 EFTPTERRIVQMLLKLVFEDYREAWSPVMGVE--FEYLDSEVNPTMANIVSPTEVIVVSS 200

Query: 186 MNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDT 244
            ++ ++     F +++P   +     +  +  Q+   ++          +   + VN+  
Sbjct: 201 FHIEVDGGGGDFHVVMPYSMVEPIRELLDAGVQSDKMDKDVRWSMALREEIMDVPVNLRA 260

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
           ++     +L+D++ L+ G +IP        A +       Y  ++G+ G N  ++IT ++
Sbjct: 261 KLLDVDLSLRDLMELQAGDIIPIDVP--ESATVFVEDLPTYRAKMGKSGDNIALKITQKL 318

Query: 305 NFDQ 308
               
Sbjct: 319 KRPD 322


>gi|300696948|ref|YP_003747609.1| flagellar motor switching and energizing component [Ralstonia
           solanacearum CFBP2957]
 gi|299073672|emb|CBJ53192.1| flagellar motor switching and energizing component [Ralstonia
           solanacearum CFBP2957]
          Length = 335

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 37/303 (12%), Positives = 96/303 (31%), Gaps = 11/303 (3%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           Q+        +     R+                +   + +         +  + +IS  
Sbjct: 29  QAEAAGVRTYNLGSQERIVRG------RMPTLEIINERFARNWRMGLFNFLRRNAEISVG 82

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
             +  K+S  I +       +   +             NL+  ++++L G       ++ 
Sbjct: 83  PVKVQKYSEFIRNLVVPAAINLVHVKPLRGTALFVFDPNLIFIVVDHLFGGDGRFHMRVE 142

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  + VE+++ +R +A +     +            E      + +       NE V +
Sbjct: 143 GRDFTQVEQRIIQRMLALMFEHYGKAWQPIYPIE--FEPLRMEMHTEFANVATPNEVVVS 200

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNI 242
              +M + +      + +P   +     +  S+ Q ++    +  +   +++     V +
Sbjct: 201 TRFSMELGSNGGDVHVCMPYTMIEPIRDLLTSAIQGEALEVDKRWVRLLSQQVQTAEVEV 260

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
              +      + D++ +K+G VIP             +G  +  C  G     Y +R+  
Sbjct: 261 VAHLANANVHVSDILNMKVGDVIPLEL--DDFVTARVDGVPVMECAYGTFNGQYALRVNR 318

Query: 303 RIN 305
            +N
Sbjct: 319 MLN 321


>gi|110805914|ref|YP_689434.1| flagellar motor switch protein FliM [Shigella flexneri 5 str. 8401]
 gi|110615462|gb|ABF04129.1| flagellar motor switch protein FliM [Shigella flexneri 5 str. 8401]
          Length = 349

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 42/303 (13%), Positives = 94/303 (31%), Gaps = 10/303 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+       +   +    +   + +         +    DI+  +
Sbjct: 45  SGESDIRPYDPNTQRRVV------RERLQALEIINERFARHFRMGLFNLLRRSPDITVGA 98

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G       ++  
Sbjct: 99  IRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEG 158

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +                  +     N     N+ V   
Sbjct: 159 REFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVRSE-MQVEFTNITTSPNDIVVNT 217

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     + ++   + S N+ ++  D   R+     + + 
Sbjct: 218 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELV 277

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK G V+P         I   NG  + + + G +   Y +RI   
Sbjct: 278 ANFADISLHLSQILKLKPGDVLPIEKP--DRIIAHVNGVPVLTSQYGTLNGQYALRIEHL 335

Query: 304 INF 306
           IN 
Sbjct: 336 INP 338


>gi|312621580|ref|YP_004023193.1| flagellar motor switch protein flim [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312202047|gb|ADQ45374.1| flagellar motor switch protein FliM [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 329

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 40/305 (13%), Positives = 98/305 (32%), Gaps = 13/305 (4%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
            KN         ++        K   +    +   Y + +       +   V +   S +
Sbjct: 33  EKNVRVYDFKRPSKF------AKDHLRTLQMIFENYARIVTTFLSGYLRTVVQMDVLSVE 86

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
              +    +S     V    + S    +     +  +   +++ +LG   + I ++  R+
Sbjct: 87  QLTYYEFSNSLSNPVVMGIVNFSPLKGSIVFEMAPEIAFAMIDRVLGGFGKGIDKV--RT 144

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            + +E  L +R + Q+     +      +  P LE        +       NE V  + +
Sbjct: 145 FTEIELALIERLLQQLINYFQEAWENIVDLRPRLEKIET--NPQFTQIVSPNETVALVTI 202

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNID 243
            M +        + IP   +                ++  SE+  +   +K  +  V + 
Sbjct: 203 AMKVGEAEGMANICIPHMVIEPIMPRLSTKFWFSTSAKESSEETKEYLQKKIERTRVTVK 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
             +   + T+++ + L++G V+    R+     +    K  +    GR      ++IT  
Sbjct: 263 AVLGRTQITVREFLELQVGDVLRLDRRKNQEIEVFVGNKLKFYGVPGRKEGRIAVKITRV 322

Query: 304 INFDQ 308
              + 
Sbjct: 323 EEGED 327


>gi|283832660|ref|ZP_06352401.1| flagellar motor switch protein FliM [Citrobacter youngae ATCC
           29220]
 gi|291072334|gb|EFE10443.1| flagellar motor switch protein FliM [Citrobacter youngae ATCC
           29220]
          Length = 334

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 40/307 (13%), Positives = 96/307 (31%), Gaps = 10/307 (3%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           + G +   +  P  P    R+       +   +    +   + +         +    DI
Sbjct: 26  ISGIAKESDIRPYDPNTQRRVV------RERLQALEIINERFARQFRMGLFNLLRRSPDI 79

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           +  + +   +     +       +   L        +  S +LV   ++NL G       
Sbjct: 80  TVGAIRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPT 139

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++  R  +  E+++  R +       +                  +     N     N+ 
Sbjct: 140 KVEGREFTHTEQRVINRMLKLALESYSDAWKAINPLEVEYVRSE-MQVKFTNITTSPNDI 198

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLN 239
           V     ++ I N+   F + +P   +     + ++   + S N+ ++  +   R+     
Sbjct: 199 VVNTPFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRNNLVRQVQHSE 258

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           + +          L  ++ LK G V+P         I   +G  + + + G V   Y +R
Sbjct: 259 LELVANFADIPLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTVNGQYALR 316

Query: 300 ITDRINF 306
           +   IN 
Sbjct: 317 VEHLINP 323


>gi|285018173|ref|YP_003375884.1| flagellar motor switch protein [Xanthomonas albilineans GPE PC73]
 gi|283473391|emb|CBA15896.1| probable flagellar motor switch protein [Xanthomonas albilineans]
          Length = 335

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 40/299 (13%), Positives = 91/299 (30%), Gaps = 11/299 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
                      R+                +   + +         +    D+S       
Sbjct: 33  EARQYDFSSQDRIIRG------RMPTLEMVNERFARLCRIGLFNLIRRSADLSVRGIDLV 86

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           KF+  +HS       +            I     LV T+++N  G       ++  R  +
Sbjct: 87  KFNDYMHSLYVPSNLNLIKFKPLRGTGLIVFEPTLVFTVVDNFFGGDGRYPTRIEGREFT 146

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E ++ +  + Q  A L++  +         E                 E+V     ++
Sbjct: 147 PTEMRVIQLMLKQTFADLHEAWAPVMNVE--FEYLNSEVNPHFANIVTPREYVVVSRFHV 204

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            +E       + +P   L     +  +  Q+   ++ E        + Y   V I + + 
Sbjct: 205 ELEGGGGEIHVTLPYSMLEPIRELLDAGIQSDRVDRDESWNIMLREQLYGSEVTISSVLA 264

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
            K+ +L+++  L+IG ++P    ++    L      +++ E G       ++IT     
Sbjct: 265 QKEMSLRELTRLRIGDILPIDLPKQVP--LCVENIPVFTGEFGVSQGQNAVKITATHPP 321


>gi|238755314|ref|ZP_04616657.1| Flagellar motor switch protein fliM [Yersinia ruckeri ATCC 29473]
 gi|238706450|gb|EEP98824.1| Flagellar motor switch protein fliM [Yersinia ruckeri ATCC 29473]
          Length = 334

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 37/301 (12%), Positives = 87/301 (28%), Gaps = 10/301 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
             +  P  P    R+       +        +   + +         +    DI+    +
Sbjct: 31  DSDVKPYDPTTQRRVV------RERLHALEIINERFARHFRMGLFNLLRRSPDITVGPIK 84

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
              +     +       +   L             +LV   ++NL G       ++  R 
Sbjct: 85  IQPYHEFARNLPVPTNLNLVHLKPLRGTALFVFEPSLVFIAVDNLFGGDGRFPTKVEGRE 144

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E+++  R +               +          I     N     N+ V T   
Sbjct: 145 FTHTEQRVITRMLRLALDAYRDAWGAIYKIDVEYVRSE-IQVKFTNITTSPNDIVVTTPF 203

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNIDTR 245
           ++ I  ++  F + IP   +     +  +   + S  +  +  +   ++     + +   
Sbjct: 204 HVEIGALSGEFNICIPFAMIEPLRELLTNPPLENSRQEDSNWRETLVKQVQHSELELVAN 263

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
                  L  ++ LK G V+P         I   +G  + + + G +   Y +R+   IN
Sbjct: 264 FAEIPLRLSQILKLKPGDVLPIDKP--DRLIAHVDGVPVLTSQYGTLNGQYALRVEHLIN 321

Query: 306 F 306
            
Sbjct: 322 P 322


>gi|86146129|ref|ZP_01064455.1| flagellar motor switch protein [Vibrio sp. MED222]
 gi|218708830|ref|YP_002416451.1| flagellar motor switch protein FliM [Vibrio splendidus LGP32]
 gi|85836076|gb|EAQ54208.1| flagellar motor switch protein [Vibrio sp. MED222]
 gi|218321849|emb|CAV17824.1| Flagellar motor switch protein fliM [Vibrio splendidus LGP32]
          Length = 347

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 38/304 (12%), Positives = 93/304 (30%), Gaps = 11/304 (3%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           ++   NT         R+                +   + + +       +    ++S  
Sbjct: 28  ETESDNTVNFDFSSQDRIVRG------RMPTLELINERFARHMRISLFNMLRKTAEVSIN 81

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
             Q  KF    ++       +            I     LV  L+EN  G       ++ 
Sbjct: 82  GVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRFHAKIE 141

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  +  E+++ +  +  +     +  S         E                 E +  
Sbjct: 142 GREFTPTERRIIQLLLKIVFEDYKEAWSPVMGVE--FEYLDSEVNPSMANIVSPTEVIVV 199

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNI 242
            + ++ ++     F +++P   +     +  +  Q+               +   + VN 
Sbjct: 200 SSFHIEVDGGGGDFHVVMPYSMVEPIRELLDAGVQSDKMETDVRWSSALRDEIMDVPVNF 259

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
              +  +  +L+D++ L+ G VIP        A +       Y  ++GR G+   ++I++
Sbjct: 260 RVNLLEQDISLRDLMELRPGDVIPMNMP--EHATMFVEELPTYRVKMGRSGEKLAVQISE 317

Query: 303 RINF 306
           +I  
Sbjct: 318 KIER 321


>gi|218549270|ref|YP_002383061.1| flagellar motor switch protein FliM [Escherichia fergusonii ATCC
           35469]
 gi|218356811|emb|CAQ89439.1| flagellar motor switching and energizing component [Escherichia
           fergusonii ATCC 35469]
 gi|324114212|gb|EGC08185.1| flagellar motor switch protein FliM [Escherichia fergusonii B253]
 gi|325497687|gb|EGC95546.1| flagellar motor switch protein FliM [Escherichia fergusonii ECD227]
          Length = 334

 Score =  246 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 39/307 (12%), Positives = 94/307 (30%), Gaps = 10/307 (3%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           + G +   +  P  P    R+       +   +    +   + +         +    DI
Sbjct: 26  ISGITNESDIRPYDPNTQRRVV------RERLQALEIINERFARHFRMGLFNLLRRSPDI 79

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           +  + +   +     +       +   L        +  S  LV   ++NL G       
Sbjct: 80  TVGAIRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPALVFIAVDNLFGGDGRFPT 139

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++  R  +  E+++  R +                          +     N     N+ 
Sbjct: 140 KVEGREFTHTEQRVINRMLKLALEGYRDAWKAINPLEVEYVRSE-MQVKFTNITTSPNDI 198

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLN 239
           V     ++ I N+   F + +P   +     + ++   + S ++ ++  +   R+     
Sbjct: 199 VVNTPFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRHEDQNWRNNLVRQVQHSQ 258

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           + +          L  ++ LK G V+P         I   +G  + + + G +   Y +R
Sbjct: 259 LELVANFAEISLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALR 316

Query: 300 ITDRINF 306
           I   IN 
Sbjct: 317 IEHLINP 323


>gi|293607830|ref|ZP_06690150.1| flagellar motor switch protein FliM [Achromobacter piechaudii ATCC
           43553]
 gi|292813773|gb|EFF72934.1| flagellar motor switch protein FliM [Achromobacter piechaudii ATCC
           43553]
          Length = 335

 Score =  246 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 34/304 (11%), Positives = 96/304 (31%), Gaps = 12/304 (3%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
                       R+       +   +    +   + + +  +    M    DI+  S + 
Sbjct: 34  DGARAYDLSSPERVV------RRRMQTLELINERFARHMRNVLLNFMRRSADITVGSIKI 87

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSL 127
            K++    +       +   +             NLV  ++++L G       ++  R  
Sbjct: 88  QKYADFERNLPVPSNLNMIQMKPLRGTALFTYDPNLVFLVIDSLFGGDGRYHTRVEGRDF 147

Query: 128 STVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMN 187
           +T E+++ +R +        +                     K  +   +NE V   + +
Sbjct: 148 TTTEQRIIRRLLNLTLESYGKSWDPVYPIEFEYVRSEMHT--KFASITGNNEVVVVTSFH 205

Query: 188 MTIENVASSFVLIIPQETLLKTTLISLSSQNKS--ENQSEDLIDPFARKTYQLNVNIDTR 245
           +          + +P   +     +      ++  E   +      +R+    ++++   
Sbjct: 206 IEFGATGGDLNICLPYSMIEPVRDLLTRPLQETTLEEVDQRWSQQLSRQVRSADIDVVAE 265

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
                +++++++ LK+G V+P         I + +G  +  C  G     Y +R+ +   
Sbjct: 266 FARIPSSIRELMHLKVGDVLPVDVP--ETIIANVDGVPLMECGYGVFNGQYALRVQNMFT 323

Query: 306 FDQK 309
           +D  
Sbjct: 324 YDTD 327


>gi|312792659|ref|YP_004025582.1| flagellar motor switch protein flim [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312179799|gb|ADQ39969.1| flagellar motor switch protein FliM [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 329

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 39/305 (12%), Positives = 97/305 (31%), Gaps = 13/305 (4%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
            KN         ++        K   +    +   Y + +       +   V +   S +
Sbjct: 33  EKNIRVYDFKRPSKF------AKDHLRTLQMIFENYARIVTTFLSGYLRTVVQMDVLSVE 86

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
              +    +S     V    + S    +     +  L   +++ +LG   + I ++  R+
Sbjct: 87  QLTYYEFSNSLSNPVVMGVVNFSPLKGSIVFEMAPELAFAMIDRVLGGFGKGIDKV--RT 144

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            + +E  L +R + Q+     +         P +E        +       NE V  + +
Sbjct: 145 FTEIELALIERLLQQLINYFQEAWENIIHIRPRIEKIET--NPQFTQIVSPNETVALVTI 202

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNID 243
            M +        + +P   +                ++  SE+  +   +K  +  V + 
Sbjct: 203 AMKVGEAEGMANICLPHMVIEPIMPRLSTKFWFSTSAKETSEETKEYLQKKIERTRVTVK 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
             +   + T+++ + L++G V+    R+     +    K  +    GR      ++IT  
Sbjct: 263 AVLGRTQITVREFLELQVGDVLRLDRRKNQEIEVFVGNKLKFYGVPGRKEGRIAVKITRV 322

Query: 304 INFDQ 308
              + 
Sbjct: 323 EEGED 327


>gi|308068664|ref|YP_003870269.1| flagellar motor switch protein fliM [Paenibacillus polymyxa E681]
 gi|305857943|gb|ADM69731.1| Flagellar motor switch protein fliM [Paenibacillus polymyxa E681]
          Length = 331

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 43/316 (13%), Positives = 106/316 (33%), Gaps = 13/316 (4%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           ++ +   K           R        K   +  + +   + ++L   F  ++   V I
Sbjct: 26  LKKEDTQKKVRAYDFKRALRF------SKDHIRSLTRIHENFARYLTTYFSAQLRTFVQI 79

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           +    +   +   I S  +  + +            +    N+   +L+ LLG +     
Sbjct: 80  NVVQVEQLPYDEFIRSIPKMTILNIFEAEPLEGRMVLEVHPNVAYAMLDRLLGGTGSAPS 139

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++   +L+ +E  + +R  ++    L +   T  +  P LE        +       NE 
Sbjct: 140 KVA--ALTEIETTIMERIFSRTFDSLQEAWKTVLDIEPRLEAMET--NPQFMQIVSPNET 195

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQ 237
           +  I+++  I +      L IP   L              ++ ++++ + ID    +  +
Sbjct: 196 IALISLSTKIGDTTGMINLCIPHVVLEPIMARLSTHQWFTSEKKSRAPEEIDALRLRVTK 255

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             + I   +   +  + + + L +G VI      K    +    K  +    G V     
Sbjct: 256 AELPIIAELGESRINVAEFLGLSVGDVISLNKPVKEGLSIRVGEKLKFMGSPGMVRDRVA 315

Query: 298 IRITDRINFDQKSLKN 313
           ++I + +N   + +  
Sbjct: 316 VQIDEIVNEGVEEIDE 331


>gi|114562367|ref|YP_749880.1| flagellar motor switch protein FliM [Shewanella frigidimarina NCIMB
           400]
 gi|114333660|gb|ABI71042.1| flagellar motor switch protein FliM [Shewanella frigidimarina NCIMB
           400]
          Length = 342

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 41/301 (13%), Positives = 95/301 (31%), Gaps = 11/301 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +          R+                +   + + L       M    ++S    Q  
Sbjct: 31  DARSYDFSSQDRIVRG------RMPTLEIVNERFARHLRISMFNMMRRAAEVSINGVQML 84

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           KF   +H+       +    S       I     LV  L++N  G       ++  R  +
Sbjct: 85  KFGEYVHTLFVPTSLNMVRFSPLKGTALITMEARLVFILVDNFFGGDGRFHAKIEGREFT 144

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++ +  +  I     +  +   +     E                 E V   + ++
Sbjct: 145 PTERRIVQLLLKIIFEDYKEAWAPVMDVE--FEYLDSEVNPAMANIVSPTEVVVINSFHI 202

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            ++     F + +P   +     +  +  Q+  ++           +   + V  D  + 
Sbjct: 203 EVDGGGGDFHITMPYSMIEPIRELLDAGVQSDKQDTDMRWSQALRDEIMDVQVGFDVNVV 262

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
             + TL+DV+  K G +IP         ++   G   Y C++G+   N  ++I+++I   
Sbjct: 263 EHEVTLRDVMGFKAGDIIPIDLP--EHIMMRIEGLPTYRCKMGKSRDNLALKISEKIPRP 320

Query: 308 Q 308
           +
Sbjct: 321 E 321


>gi|271500079|ref|YP_003333104.1| flagellar motor switch protein FliM [Dickeya dadantii Ech586]
 gi|270343634|gb|ACZ76399.1| flagellar motor switch protein FliM [Dickeya dadantii Ech586]
          Length = 338

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 40/316 (12%), Positives = 99/316 (31%), Gaps = 16/316 (5%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
               +  P  P    R+       +   +    +   + +         +    DI+  +
Sbjct: 32  QKDGDVKPYDPNTQRRVI------RERLQALEIINERFARQFRMGLFNLLRRSPDITVGA 85

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L           S +LV   ++NL G       ++  
Sbjct: 86  IKIQPYHEFARNLPVPTNLNLIHLKPLRGTALFVFSPSLVFIAVDNLFGGDGRFPTKVEG 145

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++ +R +       +   +   +          +     N     N+ V T 
Sbjct: 146 REFTHTEQRVVRRMLKLALESYSDAWNAIYKLDVEYVRSE-MQVKFTNITTSPNDIVVTT 204

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNID 243
             ++ I  +   F + IP   +     +  +   + S+ + +   +  A++     + + 
Sbjct: 205 PFHLEIGTLTGEFSICIPFSMIEPLRELLANPPLENSQQEDQHWRETLAKQVQHSELELV 264

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  V+ LK G ++P         +   +G  + +C+ G +   Y +R+   
Sbjct: 265 ANFVDIPVRLSKVLKLKPGDILPIDKP--ERLVAHVDGVPVLTCQYGTLDGQYALRVEHL 322

Query: 304 INF------DQKSLKN 313
           IN       D++ L  
Sbjct: 323 INPILNSLNDEEPLNE 338


>gi|169827132|ref|YP_001697290.1| flagellar motor switch protein FliM [Lysinibacillus sphaericus
           C3-41]
 gi|168991620|gb|ACA39160.1| Flagellar motor switch protein [Lysinibacillus sphaericus C3-41]
          Length = 331

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 48/285 (16%), Positives = 101/285 (35%), Gaps = 7/285 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +  + +   + + L   F  ++   V I+  S     F   + S     + +   
Sbjct: 49  SKDQIRSLTRIHENFARLLTTFFSAQLRSYVQITVASVDQIPFEEFVRSIPNMTLINVFE 108

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +     N  +  + N+  ++L+ ++G S  +   + N  L+ +E K+      +    L 
Sbjct: 109 VPPLDGNILMEINPNIAYSMLDRIMGGSGASHSNVDN--LTEIETKIMTNLFERSFDNLR 166

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +      E  P L         +       NE V  I++N  I   +    + IP   L 
Sbjct: 167 EAWENVAEIDPILV--ELEVNPQFLQMISPNETVVVISLNTIIGETSGMINICIPHVVLE 224

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                       Q  ++  S +       +  Q  + +   + L   T++D +T++IG V
Sbjct: 225 PIVPNLSVRYWMQTNTKEMSPEQTKMLETRVKQAKLPLSVELGLTDITIEDFLTMQIGDV 284

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
           I    +     +L       ++ + G+ GK   I+I D +    +
Sbjct: 285 IQLEQKINDPLLLKVGTLPKFTVQPGKQGKKLAIQIIDPLKGGDE 329


>gi|222530127|ref|YP_002574009.1| flagellar motor switch protein FliM [Caldicellulosiruptor bescii
           DSM 6725]
 gi|222456974|gb|ACM61236.1| flagellar motor switch protein FliM [Caldicellulosiruptor bescii
           DSM 6725]
          Length = 329

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 39/305 (12%), Positives = 98/305 (32%), Gaps = 13/305 (4%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
            KN         ++        K   +    +   Y + +       +   V +   S +
Sbjct: 33  EKNVRVYDFKRPSKF------AKDHLRTLQMIFENYARIVTTFLSGYLRTVVQMDILSVE 86

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
              +    +S     V    + S    +     +  +   +++ +LG   + I ++  R+
Sbjct: 87  QLTYYEFSNSLSNPVVMGIVNFSPLKGSIVFEMAPEIAFAMIDRVLGGFGKGIDKV--RT 144

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            + +E  L +R + Q+     +      +  P LE        +       NE V  + +
Sbjct: 145 FTEIELALIERLLQQLINYFQEAWENIVDLRPRLEKIET--NPQFTQIVSPNETVALVTI 202

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNID 243
            M +        + +P   +                ++  SE+  +   +K  +  V + 
Sbjct: 203 AMKVGEAEGMANICLPHMVIEPIMPRLSTKFWFSTSAKESSEETKEYLQKKIERTRVTVK 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
             +   + T+++ + L++G V+    R+     +    K  +    GR      ++IT  
Sbjct: 263 AVLGRTQITVREFLELQVGDVLRLDRRKNQEIEVFVGNKLKFYGVPGRKEGRIAVKITRV 322

Query: 304 INFDQ 308
              + 
Sbjct: 323 EEGED 327


>gi|54308123|ref|YP_129143.1| flagellar motor switch protein FliM [Photobacterium profundum SS9]
 gi|46912549|emb|CAG19341.1| Putative flagellar motor switch protein FliM [Photobacterium
           profundum SS9]
          Length = 348

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 35/303 (11%), Positives = 92/303 (30%), Gaps = 11/303 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
               +        R+                +   + + +       +    ++S    Q
Sbjct: 30  ETGITSFDFSSQDRIVRG------RMPTLELINERFARHMRISLFNMLRKTAEVSINGVQ 83

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
             KF    ++       +            I     LV  L+EN  G       ++  R 
Sbjct: 84  MIKFGEYQNTLYVPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRFHAKIEGRE 143

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E+++ +  +  +     +  S         E                 E +   + 
Sbjct: 144 FTPTERRIVQMLLKLVFEDYREAWSPVMGVE--FEYLDSEVNPTMANIVSPTEVIVVSSF 201

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTR 245
           ++ ++     F +++P   +     +  +  Q+   ++          +   + VN+  +
Sbjct: 202 HIELDGGGGDFHVVMPYSMVEPIRELLDAGVQSDKMDKDVRWSMALREEIMDVPVNLRAK 261

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           +     +L+D++ L+ G +IP        A +       Y  ++G+ G N  ++IT ++ 
Sbjct: 262 LLDVDLSLRDLMELQAGDIIPIDVP--ESATVFVEDLPTYRAKMGKSGDNIALKITQKLK 319

Query: 306 FDQ 308
              
Sbjct: 320 RPD 322


>gi|146296292|ref|YP_001180063.1| flagellar motor switch protein FliM [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145409868|gb|ABP66872.1| flagellar motor switch protein FliM [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 329

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 43/293 (14%), Positives = 99/293 (33%), Gaps = 8/293 (2%)

Query: 20  RLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKE 79
                    K   +    +   Y + +       +   V +   S +   +    +S   
Sbjct: 40  DFKRPSKFAKDHLRTLQIIFENYSRIVTTFLSGYLRTVVQMDVISVEQLTYYEFSNSLSN 99

Query: 80  NFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTI 139
             V    + +    +     S  +   +++ +LG   + I ++  R+ + +E  L +R +
Sbjct: 100 PVVMGIVNFAPLKGSIVFEMSPEIAFAMIDRVLGGFGKGIDKI--RTFTEIELALIERLL 157

Query: 140 AQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVL 199
            Q+     +      +  P LE        +       NE V  + ++M +  V     +
Sbjct: 158 QQLINYFQEAWENIVDLHPKLEKIET--NPQFTQIVSPNETVALVTIDMKVGEVEGMVNI 215

Query: 200 IIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDV 256
            +P   +                ++  SE+  +   RK  +  V I   +   K T+++ 
Sbjct: 216 CLPHMVIEPIMPRLSTKYWFSTSAKETSEETKEYLQRKIEKTKVTIRAILGRTKITVREF 275

Query: 257 VTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
           + L++G VI    R+     +    K  +    GR      I++T R+  + +
Sbjct: 276 LELQVGDVIRLDRRKNQEIEVFVGDKLKFYGVPGRKEGRVAIKVT-RVEKEDE 327


>gi|281601385|gb|ADA74369.1| Flagellar motor switch protein FliM [Shigella flexneri 2002017]
          Length = 349

 Score =  246 bits (628), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 41/303 (13%), Positives = 94/303 (31%), Gaps = 10/303 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+       +   +    +   + +         +    DI+  +
Sbjct: 45  SGESDIRPYDPNTQRRVV------RERLQALEIINERFARHFRMGLFNLLRRSPDITVGA 98

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G       ++  
Sbjct: 99  IRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEG 158

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +                  +     N     N+ V   
Sbjct: 159 REFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVRSE-MQVEFTNITTSPNDIVVNT 217

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     + ++   + S N+ ++  D   R+     + + 
Sbjct: 218 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELV 277

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK G V+P         I   +G  + + + G +   Y +RI   
Sbjct: 278 ANFADISLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRIEHL 335

Query: 304 INF 306
           IN 
Sbjct: 336 INP 338


>gi|227328351|ref|ZP_03832375.1| flagellar motor switch protein FliM [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 337

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 41/308 (13%), Positives = 96/308 (31%), Gaps = 10/308 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
                P  P    R+       +   +    +   + +         +    DI+  + +
Sbjct: 33  DGGVKPYDPNTQRRVI------RERLQALEIINERFARQFRMGLFNLLRRSPDITVGAIK 86

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
              +     +       +   L           S +LV   ++NL G       ++  R 
Sbjct: 87  IQPYHEFARNLPVPTNLNLIHLKPLRGTALFVFSPSLVFIAVDNLFGGDGRFPTKVEGRE 146

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E+++ KR +        +  +   +          +     N     N+ V T   
Sbjct: 147 FTHTEQRVVKRMLRLALEAYGEAWNAIYKLDIEYVRSE-MQVKFTNITTSPNDIVVTTPF 205

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNIDTR 245
           ++ I ++   F + IP   +     +  +   + S  + +   D  A++     + +   
Sbjct: 206 HVEIGSLTGEFNICIPFSMIEPLRELLANPPLENSRQEDQSWRDTLAKQVQHSELELVAS 265

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
                  L  ++ L+ G V+P         +   +G  + + + G +   Y +R+   IN
Sbjct: 266 FVDIPLRLSKILKLQPGDVLPIDKP--DKIVAHVDGVPVLTSQYGTLNGQYALRVEHLIN 323

Query: 306 FDQKSLKN 313
               SL N
Sbjct: 324 PILNSLDN 331


>gi|304404256|ref|ZP_07385918.1| flagellar motor switch protein FliM [Paenibacillus curdlanolyticus
           YK9]
 gi|304347234|gb|EFM13066.1| flagellar motor switch protein FliM [Paenibacillus curdlanolyticus
           YK9]
          Length = 333

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 39/312 (12%), Positives = 103/312 (33%), Gaps = 13/312 (4%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           ++ +   K           R        K   +  + +   + ++L   F  ++   V I
Sbjct: 27  LKKEDTQKKVRAYDFKRAVRF------SKDHIRSLTRIHENFARYLTTYFSAQLRTFVQI 80

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S    +   +   I S  +  + +            +    N+   +L+ LLG       
Sbjct: 81  SVVDVEQLPYDEFIRSIPKMTILNIFEAEPLEGRMVMEVHPNVAYAMLDRLLGGQGTAPS 140

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++   +L+ +E  + +R  ++    L +   T  + SP LE        +       NE 
Sbjct: 141 KMN--ALTEIEMTVLERIFSRAFESLQEAWKTVIDISPKLEALET--NPQFMQIVSPNET 196

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQ 237
           +  I+++  I +      L IP   +              ++ +++S + ++   ++  +
Sbjct: 197 IALISLSTKIGDTTGMINLCIPHVVIEPIMPKLSVHHWFVSQKKSRSPEEVEVLEQRVNR 256

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             + I   +      + + + L  G VI           +    K  +    G +     
Sbjct: 257 AQLPIAVELGESVINVHEFLNLMQGDVITLNKPVGEGLNIKVGNKIKFIGSPGSIKDRVA 316

Query: 298 IRITDRINFDQK 309
           +++ + ++   +
Sbjct: 317 VQVDEIVSEGVE 328


>gi|160876170|ref|YP_001555486.1| flagellar motor switch protein FliM [Shewanella baltica OS195]
 gi|160861692|gb|ABX50226.1| flagellar motor switch protein FliM [Shewanella baltica OS195]
 gi|315268366|gb|ADT95219.1| flagellar motor switch protein FliM [Shewanella baltica OS678]
          Length = 342

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 42/305 (13%), Positives = 95/305 (31%), Gaps = 11/305 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           ++ ++          R+                +   + + L       M    ++S   
Sbjct: 27  AVGEDARSYDFSSQDRIVRG------RMPTLEIVNERFARHLRISMFNMMRRAAEVSING 80

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            Q  KF   +H+       +    S       I     LV  L++N  G       ++  
Sbjct: 81  VQMLKFGEYVHTLFVPTSLNMVRFSPLKGTALITMEARLVFILVDNFFGGDGRFHAKIEG 140

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++ +  +  I        +   +     +                 E V   
Sbjct: 141 REFTPTERRIVQLLLKIIFEDYKDAWAPVMDVE--FDYLDSEVNPAMANIVSPTEVVVIN 198

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNID 243
           + ++ ++     F + +P   +     +  +  Q+  ++           +   + V  D
Sbjct: 199 SFHIEVDGGGGDFHITMPYSMIEPIRELLDAGVQSDKQDTDMRWSQALHDEIMDVKVGFD 258

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
             I   + TLKDV+  K G +IP         ++       Y C++GR   N  ++I ++
Sbjct: 259 ANIVEHELTLKDVMNFKAGDIIPIELP--EYIMMKIEDLPTYRCKMGRSRDNLALKIHEK 316

Query: 304 INFDQ 308
           I   +
Sbjct: 317 IPRPE 321


>gi|157145261|ref|YP_001452580.1| flagellar motor switch protein FliM [Citrobacter koseri ATCC
           BAA-895]
 gi|157082466|gb|ABV12144.1| hypothetical protein CKO_00998 [Citrobacter koseri ATCC BAA-895]
          Length = 334

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 40/305 (13%), Positives = 94/305 (30%), Gaps = 10/305 (3%)

Query: 3   GQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISY 62
           G     +  P  P    R+       +   +    +   + +         +    DI+ 
Sbjct: 28  GGVGDNDIRPYDPNTQRRVV------RERLQALEIINERFARQFRMGLFNLLRRSPDITV 81

Query: 63  TSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQL 122
            + +   +     +       +   L        +  S +LV   ++NL G       ++
Sbjct: 82  GAIRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKV 141

Query: 123 YNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVT 182
             R  +  E+++  R +       +                  +     N     N+ V 
Sbjct: 142 EGREFTHTEQRVINRMLKLALESYSDAWKAINPLEVEYVRSE-MQVKFTNITTSPNDIVV 200

Query: 183 TINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVN 241
               ++ I N+   F + +P   +     + ++   + S ++ ++  D   R+     + 
Sbjct: 201 NTPFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRHEDQNWRDNLVRQVQHSELE 260

Query: 242 IDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
           +          L  ++ LK G V+P         I   +G  + + + G V   Y +R+ 
Sbjct: 261 LVANFADIPLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTVNGQYALRVE 318

Query: 302 DRINF 306
             IN 
Sbjct: 319 HLINP 323


>gi|16078694|ref|NP_389513.1| flagellar motor switch protein FliM [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221309509|ref|ZP_03591356.1| flagellar motor switch protein FliM [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221313833|ref|ZP_03595638.1| flagellar motor switch protein FliM [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221318756|ref|ZP_03600050.1| flagellar motor switch protein FliM [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221323028|ref|ZP_03604322.1| flagellar motor switch protein FliM [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|296330846|ref|ZP_06873321.1| flagellar motor switch protein FliM [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305674364|ref|YP_003866036.1| flagellar motor switching and energizing protein [Bacillus subtilis
           subsp. spizizenii str. W23]
 gi|321315398|ref|YP_004207685.1| flagellar motor switch protein FliM [Bacillus subtilis BSn5]
 gi|120344|sp|P23453|FLIM_BACSU RecName: Full=Flagellar motor switch protein FliM
 gi|142922|gb|AAA22446.1| flagellar switch protein [Bacillus subtilis]
 gi|2634003|emb|CAB13504.1| flagellar motor switching and energizing component [Bacillus
           subtilis subsp. subtilis str. 168]
 gi|291484184|dbj|BAI85259.1| flagellar motor switch protein FliM [Bacillus subtilis subsp. natto
           BEST195]
 gi|296151851|gb|EFG92725.1| flagellar motor switch protein FliM [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305412608|gb|ADM37727.1| flagellar motor switching and energizing component [Bacillus
           subtilis subsp. spizizenii str. W23]
 gi|320021672|gb|ADV96658.1| flagellar motor switch protein FliM [Bacillus subtilis BSn5]
          Length = 332

 Score =  246 bits (627), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 38/286 (13%), Positives = 96/286 (33%), Gaps = 8/286 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +  + +   + + L   F  ++   + IS +S     +   I S     + +   
Sbjct: 49  SKDQIRSLTRIHDNFARLLTTHFSAQLRTYIHISVSSVDQVPYEEFIRSIPNMTILNLFD 108

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +        +  +  +  T+++ ++G    +  ++ +  L+ +E K+             
Sbjct: 109 VHPMEGRIMMEVNPTIAYTMMDRVMGGIGISHNKVDS--LTEIETKIISNLFENALGNYK 166

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +   +  +  P  E        +       NE V  I++N  I  ++    L IP   L 
Sbjct: 167 EAWQSIADIEP--EMTEFEVNPQFVQMVSPNETVVVISLNTQIGEISGVINLCIPHIVLE 224

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                       Q+       +      ++     + +   +   + T+++ ++L++G  
Sbjct: 225 PLIPKLSVHYWMQSDRNEPKPEETKSLEKRIMTAQIPVVAELGTSELTIEEFLSLEVGDC 284

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR-INFDQK 309
           I           +    K  +  + GRV +   ++I D  I  +Q 
Sbjct: 285 ITLDKSVTDPLTVLVGDKPKFLGQAGRVNRKQAVQILDHDIRGEQD 330


>gi|17548599|ref|NP_521939.1| flagellar motor switch protein FliM [Ralstonia solanacearum
           GMI1000]
 gi|17430847|emb|CAD17529.1| probable flagellar motor switch protein flim [Ralstonia
           solanacearum GMI1000]
          Length = 335

 Score =  246 bits (627), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 33/276 (11%), Positives = 90/276 (32%), Gaps = 5/276 (1%)

Query: 31  IEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSS 90
                  +   + +         +  + +IS    +  K+S  I +       +   +  
Sbjct: 50  RMPTLEIINERFARNWRMGLFNFLRRNAEISVGPVKVQKYSEFIRNLVVPAAINLVHVKP 109

Query: 91  WSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCI 150
                      NL+  ++++L G       ++  R  + VE+++ +R +  +     +  
Sbjct: 110 LRGTALFVFDPNLIFIVVDHLFGGDGRFHMRVEGRDFTQVEQRIIQRMLQLMFEHYGKAW 169

Query: 151 STTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTT 210
                     E      + +       NE V +   +M + +      + +P   +    
Sbjct: 170 QPIYPIE--FEPLRMEMHTEFANVATPNEVVVSTRFSMELGSNGGDVHVCMPYTMIEPIR 227

Query: 211 LISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLH 269
            +  S+ Q ++    +  +   +++     V +   +      + D++ +K+G V+P   
Sbjct: 228 DLLTSAIQGEALEVDKRWVRLLSQQVQTAEVEVVAHLANANVHVSDILNMKVGDVVPIEL 287

Query: 270 REKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
                     +G  +  C  G     Y +R+   +N
Sbjct: 288 --DDSVTARVDGVPVMECAYGTFNGQYALRVNRMLN 321


>gi|260776477|ref|ZP_05885372.1| flagellar motor switch protein FliM [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260607700|gb|EEX33965.1| flagellar motor switch protein FliM [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 351

 Score =  246 bits (627), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 35/307 (11%), Positives = 93/307 (30%), Gaps = 11/307 (3%)

Query: 3   GQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISY 62
           G +   +          R+                +   + + +       +    ++S 
Sbjct: 29  GAAADPSAVDFDFSSQDRIVRG------RMPTLELINERFARHMRISLFNMLRKTAEVSI 82

Query: 63  TSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQL 122
              Q  KF    ++       +            I     LV  L+EN  G       ++
Sbjct: 83  NGVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRFHARI 142

Query: 123 YNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVT 182
             R  +  E+++ +  +  +     +  S         E                 E + 
Sbjct: 143 EGREFTPTERRIVQLLLKIVFEDYKEAWSPVMGVE--FEYLDSEVNPSMANIVSPTEVIV 200

Query: 183 TINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVN 241
             + ++ ++     F +++P   +     +  +  Q+               +   + VN
Sbjct: 201 VSSFHIEVDGGGGDFHVVMPYSMVEPIRELLDAGVQSDKMETDVRWSTALREEIMDVPVN 260

Query: 242 IDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
               +  +  +L+D++ L+ G +IP    E   A +       +  ++GR G+   ++++
Sbjct: 261 FRVNLLEQDISLRDLMELQPGDIIPITMPEN--ATMFVEELPTFRVKMGRSGEQLAVQVS 318

Query: 302 DRINFDQ 308
           ++I    
Sbjct: 319 EKIKRPD 325


>gi|311279113|ref|YP_003941344.1| flagellar motor switch protein FliM [Enterobacter cloacae SCF1]
 gi|308748308|gb|ADO48060.1| flagellar motor switch protein FliM [Enterobacter cloacae SCF1]
          Length = 334

 Score =  246 bits (627), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 37/305 (12%), Positives = 93/305 (30%), Gaps = 10/305 (3%)

Query: 3   GQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISY 62
           G     +  P  P    R+       +   +    +   + +         +    DI+ 
Sbjct: 28  GAGGETDIRPYDPNTQRRVV------RERLQALEIINERFARQFRMGLFNLLRRSPDITV 81

Query: 63  TSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQL 122
            + +   +     +       +   L           S +LV   ++NL G       ++
Sbjct: 82  GAIRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLFVFSPSLVFIAVDNLFGGDGRFPTKV 141

Query: 123 YNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVT 182
             R  +  E+++  R +       +                  +     N     N+ V 
Sbjct: 142 EGREFTHTEQRVINRMLKLALEAYSDAWKAINPLEVEYVRSE-MQVKFTNITTSPNDIVV 200

Query: 183 TINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVN 241
               ++ I N+   F + +P   +     + ++   + S ++ ++  +   R+     + 
Sbjct: 201 NTPFHVEIGNLTGEFNICLPFSMIEPLREVLVNPPLENSRSEDQNWRENLVRQVQHSELE 260

Query: 242 IDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
           +          L  ++ L+ G V+P         I   +G  + + + G +   Y +R+ 
Sbjct: 261 LVANFADISLRLSQILKLQPGDVLPIDKP--DRIIAHVDGVPVLTSQYGTLNGQYALRVE 318

Query: 302 DRINF 306
             IN 
Sbjct: 319 HLINP 323


>gi|238927453|ref|ZP_04659213.1| flagellar motor switch protein FliM [Selenomonas flueggei ATCC
           43531]
 gi|238884735|gb|EEQ48373.1| flagellar motor switch protein FliM [Selenomonas flueggei ATCC
           43531]
          Length = 333

 Score =  245 bits (626), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 44/286 (15%), Positives = 94/286 (32%), Gaps = 8/286 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +    L   + + L       +   +DI  +S +   +   + S     V    +
Sbjct: 49  SKDQIRTLFMLHESFSRLLNTYLSASLRTMIDIDVSSVEQVTYQEFVQSMANPSVIGILA 108

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           L        I  +  +    ++ + G       +   R L+ +E  + +R I   +    
Sbjct: 109 LPPLKGKIIIEINPGIAFAYIDRIFGGEGRPAVKT--RVLTDIEMAVMRRFIELATNYFR 166

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  S   E  PN E        +       N+ V  I +++ + +V     + IP   L 
Sbjct: 167 EAWSNVVEFRPNFETMET--NSQFAQIVPPNDMVVLITIHIKMGDVDGMMNICIPYLVLE 224

Query: 208 KTTLISLSS----QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQ 263
                  +S     +     S + ++   RK  + +V    ++   + T+ + +TL  G 
Sbjct: 225 PVMSKLTTSFWVAASMDRESSPEQVEELQRKIERTSVPFTVQLGEIEMTINEFLTLGFGD 284

Query: 264 VIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
           V+      K   +        +    G  GK   ++I+  I  +  
Sbjct: 285 VLQLDTLTKDELVCYVGSNPKFLARPGTAGKRMAVQISGVIEGEDN 330


>gi|310641555|ref|YP_003946313.1| heat shock protein hslvu, atpase subunit hslu [Paenibacillus
           polymyxa SC2]
 gi|309246505|gb|ADO56072.1| Heat shock protein HslVU, ATPase subunit HslU [Paenibacillus
           polymyxa SC2]
          Length = 332

 Score =  245 bits (626), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 43/316 (13%), Positives = 106/316 (33%), Gaps = 13/316 (4%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           ++ +   K           R        K   +  + +   + ++L   F  ++   V I
Sbjct: 27  LKKEETQKKVRAYDFKRALRF------SKDHIRSLTRIHENFARYLTTYFSAQLRTFVQI 80

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           +    +   +   I S  +  + +            +    N+   +L+ LLG +     
Sbjct: 81  NVVQVEQLPYDEFIRSIPKMTILNIFEAEPLEGRMVLEVHPNVAYAMLDRLLGGTGSAPT 140

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++   +L+ +E  + +R  ++    L +   T  +  P LE        +       NE 
Sbjct: 141 KVT--ALTEIETTIMERIFSRTFDSLQEAWKTVLDIEPRLEAMET--NPQFMQIVSPNET 196

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQ 237
           +  I+++  I +      L IP   L              ++ ++++ + ID    +  +
Sbjct: 197 IALISLSTKIGDTTGMINLCIPHVVLEPIMARLSTHQWFTSEKKSRAPEEIDALRLRVTK 256

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             + I   +   +  + + + L +G VI      K    +    K  +    G V     
Sbjct: 257 AELPIIAELGESRINVAEFLGLSVGDVISLNKPVKEGLSIRVGEKLKFMGSPGMVRDRVA 316

Query: 298 IRITDRINFDQKSLKN 313
           ++I + +N   + +  
Sbjct: 317 VQIDEIVNEGVEEIDE 332


>gi|163750543|ref|ZP_02157781.1| flagellar motor switch protein [Shewanella benthica KT99]
 gi|161329698|gb|EDQ00687.1| flagellar motor switch protein [Shewanella benthica KT99]
          Length = 348

 Score =  245 bits (626), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 44/302 (14%), Positives = 95/302 (31%), Gaps = 11/302 (3%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
                       R+                +   + + L       M    ++S    Q 
Sbjct: 36  SEARSYDFSSQDRIVRG------RMPTLEIVNERFARHLRISMFNMMRRAAEVSINGVQM 89

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSL 127
            KF   +H+       +    S       I     LV  L++N  G       ++  R  
Sbjct: 90  IKFGEYVHTLFVPTSLNMVKFSPLKGTGLITMEARLVFILVDNFFGGDGRFHAKIEGREF 149

Query: 128 STVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMN 187
           +  E+++ +  +  I     +  +   +     E                 E V   + +
Sbjct: 150 TPTERRIVQLLLKIIFEDYKEAWAPVMDVE--FEYLDSEVNPAMANIVSPTEVVVVSSFH 207

Query: 188 MTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRI 246
           + ++     F + +P   +     +  +  Q+ +++  +        +   + V ID  I
Sbjct: 208 IEVDGGGGDFHITMPYSMIEPIRELLDAGVQSDTQDTDKRWSMALKDEIMDIKVGIDATI 267

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
             ++  LKDV+  + G +IP         +L       Y C+LG+   N  +RI ++I  
Sbjct: 268 VDQEIALKDVMKFRAGDIIPVDLP--EHIVLRVEDLPTYRCKLGKSRDNLALRIIEKIPR 325

Query: 307 DQ 308
            +
Sbjct: 326 PK 327


>gi|83747640|ref|ZP_00944676.1| FliM [Ralstonia solanacearum UW551]
 gi|207739721|ref|YP_002258114.1| flagellar motor switch protein flim [Ralstonia solanacearum
           IPO1609]
 gi|9438185|gb|AAF87587.1|AF283286_1 flagellar motor switch [Ralstonia solanacearum]
 gi|83725692|gb|EAP72834.1| FliM [Ralstonia solanacearum UW551]
 gi|206593103|emb|CAQ60009.1| flagellar motor switch protein flim [Ralstonia solanacearum
           IPO1609]
          Length = 335

 Score =  245 bits (626), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 36/303 (11%), Positives = 96/303 (31%), Gaps = 11/303 (3%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           Q+        +     R+                +   + +         +  + +IS  
Sbjct: 29  QAEAAGVRTYNLGSQERIVRG------RMPTLEIINERFARNWRMGLFNFLRRNAEISVG 82

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
             +  K+S  I +       +   +             NL+  ++++L G       ++ 
Sbjct: 83  PVKVQKYSEFIRNLVVPAAINLVHVKPLRGTALFVFDPNLIFIVVDHLFGGDGRFHMRVE 142

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  + VE+++ +R +A +     +            E      + +       NE V +
Sbjct: 143 GRDFTQVEQRIIQRMLALMFEHYGKAWQPIYPIE--FEPLRMEMHTEFANVATPNEVVVS 200

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNI 242
              +M + +      + +P   +     +  S+ Q ++    +  +   +++     V +
Sbjct: 201 TRFSMELGSNGGDVHVCMPYTMIEPIRDLLTSAIQGEALEVDKRWVRLLSQQVQTAEVEV 260

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
              +      + D++ +K+G V+P             +G  +  C  G     Y +R+  
Sbjct: 261 VAHLANANVHVSDILNMKVGDVVPLEL--DDFVTARVDGVPVMECAYGTFNGQYALRVNR 318

Query: 303 RIN 305
            +N
Sbjct: 319 MLN 321


>gi|226313058|ref|YP_002772952.1| flagellar motor switch protein FliM [Brevibacillus brevis NBRC
           100599]
 gi|226096006|dbj|BAH44448.1| flagellar motor switch protein FliM [Brevibacillus brevis NBRC
           100599]
          Length = 331

 Score =  245 bits (626), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 41/312 (13%), Positives = 94/312 (30%), Gaps = 13/312 (4%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           ++ +   +           R        K   +  + +   Y + L   F  ++   V I
Sbjct: 27  LKKEETERKVKVYDFKRALRF------SKDQIRGLTRIHENYARLLTTYFSAQLRTFVQI 80

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           +  S     +   I S  +  + +            +  + N+  T+L+ LLG       
Sbjct: 81  TVASVDQLPYDEFIRSIPKMTILNIFEAPPLEGRMVLEVNPNIAYTMLDRLLGGQGAIPE 140

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++   +L+ +E  + +R   +     ++      E  P  E        +       NE 
Sbjct: 141 KMG--ALTEIETTVMERVFGKALDTFHEAWKQIIELDPYQEGLEM--NPQFMQIVSPNEI 196

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQ 237
           V  I+ +  I +      L +P   L               + + + E+       +   
Sbjct: 197 VVVISFSTKIGDTTGMINLCLPHVVLEPIMTKLSGQYWFSKQKKTRDEEERLRVEERVKV 256

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             + I   +     T+ D + L+ G VI           +       +  + G       
Sbjct: 257 AKLPIVAEMGTATITVGDFLQLQKGDVIQLDQSIDNKLKIKVGNHLKFLGQPGTHKGRVA 316

Query: 298 IRITDRINFDQK 309
           ++I + I   ++
Sbjct: 317 VQIDEVIEEGEE 328


>gi|312126831|ref|YP_003991705.1| flagellar motor switch protein flim [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311776850|gb|ADQ06336.1| flagellar motor switch protein FliM [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 329

 Score =  245 bits (625), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 40/305 (13%), Positives = 99/305 (32%), Gaps = 13/305 (4%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
            KN         ++        K   +    +   Y + +       +   V +   S +
Sbjct: 33  EKNIRVYDFKRPSKF------AKDHLRTLQMIFENYARIVTTFLSGYLRTVVQMDVLSVE 86

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
              +    +S     V    + S    +     +  +   +++ +LG   + I ++  R+
Sbjct: 87  QLTYYEFSNSLSNPVVMGIVNFSPLKGSIVFEMAPEIAFAMIDRVLGGFGKGIDKV--RT 144

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            + +E  L +R + Q+     +      +  P LE        +       NE V  + +
Sbjct: 145 FTEIELVLIERLLQQLINYFQEAWENIVDLRPRLEKIET--NPQFTQIVSPNETVALVTI 202

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNID 243
            M +  V     + +P   +                ++  SE+  +   +K  +  V + 
Sbjct: 203 AMKVGEVEGMANICLPHMVIEPIMPRLSTKFWFSTSAKETSEETKEYLQKKIERTRVTVK 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
             +   + T+++ + L++G V+    R+     +    K  +    GR      ++IT  
Sbjct: 263 AVLGRTQITVREFLELQVGDVLRLDRRKNQEIEVFVGNKLKFYGVPGRKEGRIAVKITRV 322

Query: 304 INFDQ 308
              + 
Sbjct: 323 EEGED 327


>gi|217972623|ref|YP_002357374.1| flagellar motor switch protein FliM [Shewanella baltica OS223]
 gi|217497758|gb|ACK45951.1| flagellar motor switch protein FliM [Shewanella baltica OS223]
          Length = 342

 Score =  245 bits (625), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 42/305 (13%), Positives = 95/305 (31%), Gaps = 11/305 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           ++ ++          R+                +   + + L       M    ++S   
Sbjct: 27  AVGEDARSYDFSSQDRIVRG------RMPTLEIVNERFARHLRISMFNMMRRAAEVSING 80

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            Q  KF   +H+       +    S       I     LV  L++N  G       ++  
Sbjct: 81  VQMLKFGEYVHTLFVPTSLNMVRFSPLKGTALITMEARLVFILVDNFFGGDGRFHAKIEG 140

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++ +  +  I        +   +     +                 E V   
Sbjct: 141 REFTPTERRIVQLLLKIIFEDYKDAWAPVMDVE--FDYLDSEVNPAMANIVSPTEVVVIN 198

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNID 243
           + ++ ++     F + +P   +     +  +  Q+  ++           +   + V  D
Sbjct: 199 SFHIEVDGGGGDFHITMPYSMIEPIRELLDAGVQSDKQDTDMRWSQALHDEIMDVKVGFD 258

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
             I   + TLKDV+  K G +IP         ++       Y C++GR   N  ++I ++
Sbjct: 259 ANIVEHELTLKDVMNFKAGDIIPIELP--EYIMMKIEDLPTYRCKMGRSRDNLALKIHEK 316

Query: 304 INFDQ 308
           I   +
Sbjct: 317 IPRPE 321


>gi|163856451|ref|YP_001630749.1| flagellar motor switch protein FliM [Bordetella petrii DSM 12804]
 gi|163260179|emb|CAP42481.1| flagellar motor switch protein FliM [Bordetella petrii]
          Length = 335

 Score =  245 bits (625), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 36/310 (11%), Positives = 101/310 (32%), Gaps = 12/310 (3%)

Query: 2   RGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDIS 61
           R ++  +           R+       +   +    +   + + L  +    M  + DI+
Sbjct: 28  RDEADARGARAYDLSSPDRVV------RRRMQTLELINERFARQLRHLLLNFMRRNADIT 81

Query: 62  YTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQ 121
             S +  K++    +       +   +             +LV  ++++L G       +
Sbjct: 82  VGSIKILKYADFERNLPVPSNLNMIQMKPLRGTALFTYDPSLVFLVIDSLFGGDGRYHTR 141

Query: 122 LYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFV 181
           +  R  +T E+++ +R +        +                     K  +   +NE V
Sbjct: 142 VEGRDFTTTEQRIIRRLLNLTLESYGKSWEAVYPIEFEYVRSEMHT--KFASITGNNEVV 199

Query: 182 TTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKS--ENQSEDLIDPFARKTYQLN 239
              + ++          + +P   +     +      ++  E   +      +R+    +
Sbjct: 200 VVSSFHIEFGATGGDLNICLPYSMIEPVRDLLTRPLQETTLEEVDQRWTHQLSRQVRSAD 259

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           V++        +++++++ LK+G V+P         I + NG  +  C  G     Y +R
Sbjct: 260 VDLTAEFASIPSSIRELLRLKVGDVLPIEVP--ETVIANVNGVPLMECSYGVFNGQYALR 317

Query: 300 ITDRINFDQK 309
           + +   ++  
Sbjct: 318 VQNLFTYESD 327


>gi|332531130|ref|ZP_08407044.1| flagellar motor switch protein FliM [Hylemonella gracilis ATCC
           19624]
 gi|332039415|gb|EGI75827.1| flagellar motor switch protein FliM [Hylemonella gracilis ATCC
           19624]
          Length = 331

 Score =  245 bits (625), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 46/279 (16%), Positives = 101/279 (36%), Gaps = 5/279 (1%)

Query: 31  IEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSS 90
                  +   + + L       +    +IS    Q  ++S  +        F+  ++  
Sbjct: 50  RMPTMEVVNERFARNLRISLFNFIRRSPEISVGPVQVQRYSAFLRELAVPTSFNIMAVRP 109

Query: 91  WSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCI 150
              N  I C  +L+  +++ L G   +   ++  R  S  E+++  R +  IS    +  
Sbjct: 110 LRGNGMIVCEPSLIFGVIDTLYGGIGKFQSRIEGRDFSATEQRIINRLVDVISDEYKKAW 169

Query: 151 STTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTT 210
                    LE        +       +E V + +  + I  ++ +    IP  TL    
Sbjct: 170 RGIYPLE--LEYQRSEMQPQFANIATPSEIVVSSSFQLEIGEMSGTIHFCIPYATLEPIR 227

Query: 211 LIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLH 269
            +   S+Q  S       ++   R+    +V +   +    TT+++++ +K+G  I    
Sbjct: 228 DVLYSSTQGDSMEVDRRWVNVLTREIQAADVTLVAELARANTTVEELLAMKVGDFIELER 287

Query: 270 REKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
           + +  A +S  G  ++ C+ G     Y IRI   +  + 
Sbjct: 288 QPRIEATIS--GVPVFECQYGTHNAKYAIRIERSLRGND 324


>gi|161502902|ref|YP_001570014.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160864249|gb|ABX20872.1| hypothetical protein SARI_00961 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 334

 Score =  245 bits (625), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 40/305 (13%), Positives = 95/305 (31%), Gaps = 10/305 (3%)

Query: 3   GQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISY 62
           G +   +  P  P    R+       +   +    +   + +         +    DI+ 
Sbjct: 28  GIASDSDIRPYDPNTQRRVV------RERLQALEIINERFARQFRMGLFNLLRRSPDITV 81

Query: 63  TSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQL 122
            + +   +     +       +   L        +  S +LV   ++NL G       ++
Sbjct: 82  GAIRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKV 141

Query: 123 YNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVT 182
             R  +  E+++  R +       +                  +     N     N+ V 
Sbjct: 142 EGREFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVRSE-MQVKFTNITTSPNDIVV 200

Query: 183 TINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVN 241
               ++ I N+   F + +P   +     + ++   + S ++ ++  D   R+     + 
Sbjct: 201 NTPFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRHEDQNWRDNLVRQVQHSELE 260

Query: 242 IDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
           +          L  ++ LK G V+P         I   +G  + + + G V   Y +R+ 
Sbjct: 261 LVANFADIPLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTVNGQYALRVE 318

Query: 302 DRINF 306
             IN 
Sbjct: 319 HLINP 323


>gi|16760920|ref|NP_456537.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|29141388|ref|NP_804730.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|213424998|ref|ZP_03357748.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213584776|ref|ZP_03366602.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|213855271|ref|ZP_03383511.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|289829468|ref|ZP_06547080.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|25298898|pir||AI0752 flagellar motor switch protein FliM [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16503217|emb|CAD05724.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29137015|gb|AAO68579.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
          Length = 334

 Score =  245 bits (625), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 40/305 (13%), Positives = 95/305 (31%), Gaps = 10/305 (3%)

Query: 3   GQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISY 62
           G +   +  P  P    R+       +   +    +   + +         +    DI+ 
Sbjct: 28  GIASDSDIRPYDPNTQRRVV------RERLQALEIINERFARQFRMGLFNLLRRSPDITV 81

Query: 63  TSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQL 122
            + +   +     +       +   L        +  S +LV   ++NL G       ++
Sbjct: 82  GAIRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFITVDNLFGGDGRFPTKV 141

Query: 123 YNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVT 182
             R  +  E+++  R +       +                  +     N     N+ V 
Sbjct: 142 EGREFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVRSE-MQVKFTNITTSPNDIVV 200

Query: 183 TINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVN 241
               ++ I N+   F + +P   +     + ++   + S ++ ++  D   R+     + 
Sbjct: 201 NTPFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRHEDQNWRDNLVRQVQHSELE 260

Query: 242 IDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
           +          L  ++ LK G V+P         I   +G  + + + G V   Y +R+ 
Sbjct: 261 LVANFADIPLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTVNGQYALRVE 318

Query: 302 DRINF 306
             IN 
Sbjct: 319 HLINP 323


>gi|302872559|ref|YP_003841195.1| flagellar motor switch protein FliM [Caldicellulosiruptor
           obsidiansis OB47]
 gi|302575418|gb|ADL43209.1| flagellar motor switch protein FliM [Caldicellulosiruptor
           obsidiansis OB47]
          Length = 329

 Score =  245 bits (625), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 39/305 (12%), Positives = 99/305 (32%), Gaps = 13/305 (4%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
            KN         ++        K   +    +   Y + +       +   V +   S +
Sbjct: 33  EKNVRVYDFKRPSKF------AKDHLRTLQMIFENYARIVTTFLSGYLRTIVQMDVLSVE 86

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
              +    +S     V    + +    +     +  +   +++ +LG   + I ++  R+
Sbjct: 87  QLTYYEFSNSLSNPVVMGIVNFTPLKGSIVYEMAPEIAFAMIDRVLGGFGKGIDKV--RT 144

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            + +E  L +R + Q+     +      E  P LE        +       NE +  + +
Sbjct: 145 FTEIELALIERLLQQLVNYFQEAWENIVELRPRLEKIET--NPQFTQIVSPNETIALVTI 202

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNID 243
            M +  V     + +P   +                ++  SE+  +   +K  +  V + 
Sbjct: 203 AMKVGEVEGMANICLPHMVIEPIMPRLSTKFWFSTSAKETSEETKEYLQKKIERTRVTVK 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
             +   + T+++ + L++G V+    R+     +    K  +    GR      ++IT  
Sbjct: 263 AVLGRTQITVREFLELQVGDVLRLDRRKNQEIEVFVGNKLKFYGVPGRKEGRIAVKITRV 322

Query: 304 INFDQ 308
              + 
Sbjct: 323 EEGED 327


>gi|308173594|ref|YP_003920299.1| flagellar motor switching and energizing component [Bacillus
           amyloliquefaciens DSM 7]
 gi|307606458|emb|CBI42829.1| flagellar motor switching and energizing component [Bacillus
           amyloliquefaciens DSM 7]
 gi|328553474|gb|AEB23966.1| flagellar motor switch protein FliM [Bacillus amyloliquefaciens
           TA208]
 gi|328911735|gb|AEB63331.1| flagellar motor switching and energizing component [Bacillus
           amyloliquefaciens LL3]
          Length = 332

 Score =  245 bits (625), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 40/286 (13%), Positives = 93/286 (32%), Gaps = 8/286 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +  + +   + + L   F  K+   + IS +S     +   I S     + +   
Sbjct: 49  SKDQIRSLTRIHDNFARLLTTHFSAKLRTYIHISVSSVDQVPYEEFIRSIPNMTILNLFD 108

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +        +  +  +   +L+ ++G    T  +  N  L+ +E  +             
Sbjct: 109 VHPMEGRIMMEVNPTIAYAMLDRVMGGIGITHNKADN--LTEIETNIISNLFENALGNYK 166

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +   +  +  P  E        +       NE V  I++N  I  ++    L IP   L 
Sbjct: 167 EAWQSIADIDP--EMTEFEVNPQFVQMVSPNETVVVISLNTQIGEISGVINLCIPHVVLE 224

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                       Q+       +      ++     + +   +   + T+++ ++L++G  
Sbjct: 225 PIIPKLSVHYWMQSDRNEAKPEETKSLEKRIMTAQIPVVALLGASELTIEEFLSLEVGDC 284

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR-INFDQK 309
           I           +    K  +  + GRV +   ++I D  I  +Q 
Sbjct: 285 ITLDKSVTDPLTVLVGNKPKFLGQAGRVNRRQAVQILDHDIRGEQD 330


>gi|229544404|ref|ZP_04433462.1| flagellar motor switch protein FliM [Bacillus coagulans 36D1]
 gi|229324889|gb|EEN90566.1| flagellar motor switch protein FliM [Bacillus coagulans 36D1]
          Length = 333

 Score =  245 bits (625), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 50/280 (17%), Positives = 102/280 (36%), Gaps = 7/280 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +  + +   + + L      ++   V IS  S     +   I S  +  + +   
Sbjct: 48  SKDQIRSLTRIHENFSRILTTFLSAQLRTYVQISVASADQIPYEEFIRSIPKMTLLTVYE 107

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +     N  +  + N+  T+++ +LG   E+I ++    L+ +EKK+  R   Q    L 
Sbjct: 108 VPPLDGNIIMEINPNIAYTMMDRVLGGYGESINKIDK--LTEIEKKIMTRIFDQTIDQLK 165

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  S   E +P L         +       NE V  I++N TI + +    L +PQ  L 
Sbjct: 166 EAWSEIIEINPFL--TELEVNPQFLQMISPNETVVVISLNTTIGDTSGMINLCLPQVVLD 223

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                       Q+  +    + I        +  V +   +      ++D + L+IG  
Sbjct: 224 PMMPKLSGHYWMQHAGKEPDPNNIRLLEEGIKEAKVPLTAELGTATIKIEDFLNLEIGDC 283

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
           I      +   ++  +    +  + G+ G    ++I D I
Sbjct: 284 IRLNQTIEEPLVVKVDKIPKFIGQPGKQGTKMAVQILDII 323


>gi|149908450|ref|ZP_01897113.1| Flagellar motor switch protein [Moritella sp. PE36]
 gi|149808613|gb|EDM68548.1| Flagellar motor switch protein [Moritella sp. PE36]
          Length = 350

 Score =  245 bits (625), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 37/294 (12%), Positives = 93/294 (31%), Gaps = 11/294 (3%)

Query: 13  LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSH 72
                  R+                +   + + +       M    ++S    Q  KF  
Sbjct: 37  FDFSSQDRIVRG------RMPTLELVNERFARHMRISLFNMMRRTAEVSINGVQMLKFGE 90

Query: 73  IIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEK 132
            +H+       +            +     LV  L+EN  G       ++  R  +  E+
Sbjct: 91  YVHTLFVPTSLNMVRFRPLKGTALVTMEARLVFILVENFFGGDGRYHAKIEGREFTPTER 150

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
           ++ +  +  +    ++  +   ++    E                 E V   + ++ ++ 
Sbjct: 151 RIIQMLLKIVFEDYHEAWAPVMDAE--FEYLDSEVNPAMANIVSPTEVVVVSSFHIELDG 208

Query: 193 VASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
               F + +P   L     +  +  Q+  E+  E        +   + V + T++   + 
Sbjct: 209 GGGDFHITMPYSMLEPIRELLDAGVQSDKEDTDERWSSALQEEILDVPVELSTKLLETEL 268

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           T+  ++ L++G +IP          +       Y  +LGR   N  ++I+ ++ 
Sbjct: 269 TIGQIMELRVGDIIPIEMP--EELTVFIEDLPSYKAKLGRNKDNVAVKISRKLK 320


>gi|260222423|emb|CBA31972.1| Flagellar motor switch protein fliM [Curvibacter putative symbiont
           of Hydra magnipapillata]
          Length = 334

 Score =  245 bits (625), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 43/305 (14%), Positives = 96/305 (31%), Gaps = 11/305 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           + H      +     R+                +   + + L       +    +IS   
Sbjct: 30  AEHGEVRAYNISSQERIVRG------RMPTMEIVNERFARNLRVGLFNFIRRSPEISVGP 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
               ++S  +        F+  ++     +  + C   LV  +++ L G   +   ++  
Sbjct: 84  VVVQRYSAFLRELAVPTNFNIVAIRPLRGSGLVVCEPALVFGVIDTLYGGIGKFQTRIEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  S  E+++  R +  I+    +           LE        +       +E V + 
Sbjct: 144 RDFSATEQRVINRLVDVITTEYKKAWKGIYPLE--LEYQRSEMQPQFANIATPSEIVIST 201

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNID 243
           +  + I ++  +     P  TL     +   S+Q  S       ++   R+     V I 
Sbjct: 202 SFQLEIGDITGAIHFSFPYSTLEPIRDVLYSSTQGDSIEVDRRWVNVLTREIQAAEVTIV 261

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
             +     T++ ++ +K G  I            + +G  I+ C+ G     Y IRI   
Sbjct: 262 AELARADATVEQLLGMKKGDFIELDRAP--RIQATVDGVPIFECQYGTHNSKYAIRIEKA 319

Query: 304 INFDQ 308
           +  + 
Sbjct: 320 LRGND 324


>gi|84388118|ref|ZP_00991014.1| flagellar motor switch protein [Vibrio splendidus 12B01]
 gi|84377185|gb|EAP94055.1| flagellar motor switch protein [Vibrio splendidus 12B01]
          Length = 347

 Score =  245 bits (625), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 36/304 (11%), Positives = 93/304 (30%), Gaps = 11/304 (3%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           ++ + +          R+                +   + + +       +    ++S  
Sbjct: 28  ETENDSAVNFDFSSQDRIVRG------RMPTLELINERFARHMRISLFNMLRKTAEVSIN 81

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
             Q  KF    ++       +            I     LV  L+EN  G       ++ 
Sbjct: 82  GVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRFHAKIE 141

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  +  E+++ +  +  +     +  S         E                 E +  
Sbjct: 142 GREFTPTERRIIQLLLKIVFEDYKEAWSPVMGVE--FEYLDSEVNPSMANIVSPTEVIVV 199

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNI 242
            + ++ ++     F +++P   +     +  +  Q+               +   + VN 
Sbjct: 200 SSFHIEVDGGGGDFHVVMPYSMVEPIRELLDAGVQSDKMETDVRWSTALRDEIMDVPVNF 259

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
              +  +  +L+D++ L+ G VIP        A +       Y  ++GR G+   ++I++
Sbjct: 260 RVNLLEQDISLRDLMELRPGDVIPMNMP--EHATMFVEELPTYRVKMGRSGEKLAVQISE 317

Query: 303 RINF 306
           +I  
Sbjct: 318 KIQR 321


>gi|126175121|ref|YP_001051270.1| flagellar motor switch protein FliM [Shewanella baltica OS155]
 gi|153001445|ref|YP_001367126.1| flagellar motor switch protein FliM [Shewanella baltica OS185]
 gi|304409952|ref|ZP_07391571.1| flagellar motor switch protein FliM [Shewanella baltica OS183]
 gi|307302335|ref|ZP_07582093.1| flagellar motor switch protein FliM [Shewanella baltica BA175]
 gi|125998326|gb|ABN62401.1| flagellar motor switch protein FliM [Shewanella baltica OS155]
 gi|151366063|gb|ABS09063.1| flagellar motor switch protein FliM [Shewanella baltica OS185]
 gi|304351361|gb|EFM15760.1| flagellar motor switch protein FliM [Shewanella baltica OS183]
 gi|306914373|gb|EFN44794.1| flagellar motor switch protein FliM [Shewanella baltica BA175]
          Length = 342

 Score =  245 bits (625), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 42/305 (13%), Positives = 95/305 (31%), Gaps = 11/305 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           ++ ++          R+                +   + + L       M    ++S   
Sbjct: 27  AVGEDARSYDFSSQDRIVRG------RMPTLEIVNERFARHLRISMFNMMRRAAEVSING 80

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            Q  KF   +H+       +    S       I     LV  L++N  G       ++  
Sbjct: 81  VQMLKFGEYVHTLFVPTSLNMVRFSPLKGTALITMEARLVFILVDNFFGGDGRFHAKIEG 140

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++ +  +  I        +   +     +                 E V   
Sbjct: 141 REFTPTERRIVQLLLKIIFEDYKDAWAPVMDVE--FDYLDSEVNPAMANIVSPTEVVVIN 198

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNID 243
           + ++ ++     F + +P   +     +  +  Q+  ++           +   + V  D
Sbjct: 199 SFHIEVDGGGGDFHITMPYSMIEPIRELLDAGVQSDKQDTDMRWSQALHDEIMDVKVGFD 258

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
             I   + TLKDV+  K G +IP         ++       Y C++GR   N  ++I ++
Sbjct: 259 ANIVEHELTLKDVMNFKAGDIIPIELP--EYIMMKIEDLPTYRCKMGRSRDNLALKIYEK 316

Query: 304 INFDQ 308
           I   +
Sbjct: 317 IPRPE 321


>gi|323174676|gb|EFZ60296.1| flagellar motor switch protein FliM [Escherichia coli LT-68]
          Length = 334

 Score =  244 bits (624), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 41/303 (13%), Positives = 94/303 (31%), Gaps = 10/303 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+       +   +    +   + +         +    DI+  +
Sbjct: 30  SGESDIRPYDPNTQRRVV------RERLQTLEIINERFARHFRMGLFNLLRRSPDITVGA 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G       ++  
Sbjct: 84  IRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +                  +     N     N+ V   
Sbjct: 144 REFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVRSE-MQVKFTNITTSPNDIVVNT 202

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     + ++   + S N+ ++  D   R+     + + 
Sbjct: 203 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELV 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK G V+P         I   +G  + + + G +   Y +RI   
Sbjct: 263 ANFADISLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRIEHL 320

Query: 304 INF 306
           IN 
Sbjct: 321 INP 323


>gi|16765314|ref|NP_460929.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|62180551|ref|YP_216968.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161613455|ref|YP_001587420.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167552791|ref|ZP_02346542.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|167993551|ref|ZP_02574645.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168234149|ref|ZP_02659207.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168239216|ref|ZP_02664274.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|168244827|ref|ZP_02669759.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|168259737|ref|ZP_02681710.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|168462482|ref|ZP_02696413.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|168823019|ref|ZP_02835019.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|194444199|ref|YP_002041241.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194451006|ref|YP_002046027.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194737897|ref|YP_002115010.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197249640|ref|YP_002146047.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197265099|ref|ZP_03165173.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|198245200|ref|YP_002215110.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|200389660|ref|ZP_03216271.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204931068|ref|ZP_03221894.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205352330|ref|YP_002226131.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|207856511|ref|YP_002243162.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|224583525|ref|YP_002637323.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|238912451|ref|ZP_04656288.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|120346|sp|P26418|FLIM_SALTY RecName: Full=Flagellar motor switch protein FliM
 gi|154035|gb|AAA27104.1| fliM flagellar switch protein [Salmonella enterica subsp. enterica
           serovar Typhimurium]
 gi|16420511|gb|AAL20888.1| flagellar biosynthesis protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|62128184|gb|AAX65887.1| flagellar biosynthesis, component of motor switch and energizing
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|161362819|gb|ABX66587.1| hypothetical protein SPAB_01172 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194402862|gb|ACF63084.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194409310|gb|ACF69529.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194713399|gb|ACF92620.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195634275|gb|EDX52627.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197213343|gb|ACH50740.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197243354|gb|EDY25974.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197288083|gb|EDY27470.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|197939716|gb|ACH77049.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|199602105|gb|EDZ00651.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204320112|gb|EDZ05317.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205272111|emb|CAR36964.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|205322661|gb|EDZ10500.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205328413|gb|EDZ15177.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205331867|gb|EDZ18631.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205336350|gb|EDZ23114.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205340670|gb|EDZ27434.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205350615|gb|EDZ37246.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|206708314|emb|CAR32617.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|224468052|gb|ACN45882.1| flagellar motor switch protein [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|261247142|emb|CBG24965.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267993965|gb|ACY88850.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301158490|emb|CBW18000.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312912966|dbj|BAJ36940.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|320085405|emb|CBY95186.1| Flagellar motor switch protein fliM [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|321224621|gb|EFX49684.1| Flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322616969|gb|EFY13877.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322618208|gb|EFY15100.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322625879|gb|EFY22698.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322626331|gb|EFY23141.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322632746|gb|EFY29491.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322639088|gb|EFY35781.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322640404|gb|EFY37060.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322647235|gb|EFY43734.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322649917|gb|EFY46338.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322655525|gb|EFY51833.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322660303|gb|EFY56541.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322662984|gb|EFY59191.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322668169|gb|EFY64328.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674072|gb|EFY70166.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322675576|gb|EFY71650.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322683013|gb|EFY79029.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322686707|gb|EFY82685.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|322715027|gb|EFZ06598.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
 gi|323130255|gb|ADX17685.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|323195405|gb|EFZ80585.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323198067|gb|EFZ83184.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323204461|gb|EFZ89467.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323207551|gb|EFZ92499.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323211010|gb|EFZ95870.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323217536|gb|EGA02255.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323220731|gb|EGA05175.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323226682|gb|EGA10879.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323231558|gb|EGA15671.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323236001|gb|EGA20080.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323240571|gb|EGA24614.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323245463|gb|EGA29463.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323247581|gb|EGA31532.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323253956|gb|EGA37780.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323255516|gb|EGA39277.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323262114|gb|EGA45677.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323266237|gb|EGA49727.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323270654|gb|EGA54095.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|326622858|gb|EGE29203.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326627380|gb|EGE33723.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
 gi|332988865|gb|AEF07848.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 334

 Score =  244 bits (624), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 40/305 (13%), Positives = 95/305 (31%), Gaps = 10/305 (3%)

Query: 3   GQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISY 62
           G +   +  P  P    R+       +   +    +   + +         +    DI+ 
Sbjct: 28  GIASDSDIRPYDPNTQRRVV------RERLQALEIINERFARQFRMGLFNLLRRSPDITV 81

Query: 63  TSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQL 122
            + +   +     +       +   L        +  S +LV   ++NL G       ++
Sbjct: 82  GAIRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKV 141

Query: 123 YNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVT 182
             R  +  E+++  R +       +                  +     N     N+ V 
Sbjct: 142 EGREFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVRSE-MQVKFTNITTSPNDIVV 200

Query: 183 TINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVN 241
               ++ I N+   F + +P   +     + ++   + S ++ ++  D   R+     + 
Sbjct: 201 NTPFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRHEDQNWRDNLVRQVQHSELE 260

Query: 242 IDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
           +          L  ++ LK G V+P         I   +G  + + + G V   Y +R+ 
Sbjct: 261 LVANFADIPLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTVNGQYALRVE 318

Query: 302 DRINF 306
             IN 
Sbjct: 319 HLINP 323


>gi|260598454|ref|YP_003211025.1| flagellar motor switch protein FliM [Cronobacter turicensis z3032]
 gi|260217631|emb|CBA31927.1| Flagellar motor switch protein fliM [Cronobacter turicensis z3032]
          Length = 334

 Score =  244 bits (624), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 38/301 (12%), Positives = 91/301 (30%), Gaps = 10/301 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
             +  P  P    R+       +   +    +   + +         +    DI+  + +
Sbjct: 31  DGDIRPYDPNTQRRVV------RERLQALEIINERFARQFRMGLFNLLRRSPDITVGAIR 84

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
              +     +       +   L           S +LV   ++NL G       ++  R 
Sbjct: 85  IQPYHEFARNLPVPTNLNLIHLKPLRGTGLFVFSPSLVFIAVDNLFGGDGRFPTKVEGRE 144

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E+++  R +       +                  +     N     N+ V     
Sbjct: 145 FTHTEQRVINRMLKLALEAYSDAWKAINPLDVEYVRSE-MQVKFTNITTSPNDIVVNTPF 203

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNIDTR 245
           ++ I N+   F + +P   +     + ++   + S  + +   D   R+     + +   
Sbjct: 204 HVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRQEDQHWRDNLVRQVQHSELELIAN 263

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
                  L  ++ LK G V+P         ++  +G  + + + G V   Y +R+   IN
Sbjct: 264 FAEIPLRLSKILKLKPGDVLPIEKP--DRILVHVDGVPVLTSQYGTVSGQYALRVEHLIN 321

Query: 306 F 306
            
Sbjct: 322 P 322


>gi|77165630|ref|YP_344155.1| flagellar motor switch protein FliM [Nitrosococcus oceani ATCC
           19707]
 gi|254434449|ref|ZP_05047957.1| flagellar motor switch protein FliM [Nitrosococcus oceani AFC27]
 gi|76883944|gb|ABA58625.1| Flagellar motor switch protein FliM [Nitrosococcus oceani ATCC
           19707]
 gi|207090782|gb|EDZ68053.1| flagellar motor switch protein FliM [Nitrosococcus oceani AFC27]
          Length = 336

 Score =  244 bits (624), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 40/307 (13%), Positives = 94/307 (30%), Gaps = 11/307 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
            K   P       R+       +    +   +   + +         +    +++    Q
Sbjct: 34  EKTIRPYDFSSEDRI------ARAYVPLLEMINERFARQFRLSLFNLLRRATEVTVGGVQ 87

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
             KFS  +H+       +   +              LV  L+E   G S +   +L NR 
Sbjct: 88  VLKFSEYLHTLFMPTSLNLVQIDPLRGTGLFVFDPKLVFMLVEQYFGGSGQFYNRLENRE 147

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E  + +  + +  A L Q        +   E        +  T   S+E V     
Sbjct: 148 FTPTEVHIIQLVLERTFADLKQAWEPVLAVN--FEYLQTELNPRLATIASSSEMVVVSTF 205

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSSQNKS-ENQSEDLIDPFARKTYQLNVNIDTR 245
           ++  E     F + +P   L     +  + +                +      V +   
Sbjct: 206 HVEFEGGGGEFHIALPYTLLEPVRELLATGKKDDFAQADGGWNQALRKNVSDAEVELSCT 265

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           +   + +L +++ LK G ++P      +     A+G  ++    G    +  +++ +R+ 
Sbjct: 266 LTEIQLSLGEILALKSGDILPIELP--STVTALADGIPVFRVRYGIHHGSRALKVVERLL 323

Query: 306 FDQKSLK 312
             +   +
Sbjct: 324 SPESFTE 330


>gi|206890128|ref|YP_002249868.1| flagellar motor switch protein FliM [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206742066|gb|ACI21123.1| flagellar motor switch protein FliM [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 322

 Score =  244 bits (624), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 36/296 (12%), Positives = 82/296 (27%), Gaps = 9/296 (3%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
               P       ++                +     +         +   VD+   +   
Sbjct: 33  SGVRPYDFTSQEKIVRGK------MPSLDIINERLARSFRVSLASDIRKIVDVINVNVNI 86

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSL 127
            KF   + S       +   L        +     ++ TL+E   G S +   +   R  
Sbjct: 87  TKFYDFLRSVPFPSSLNIIKLEPLRGFSLVVFDAPMIFTLIEFYFGGSGKGYYKPEGREF 146

Query: 128 STVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMN 187
           + +E+++  + +      + +      +  P+          +  T     + V      
Sbjct: 147 TPIEQRIIHKVVMMFLESMEEAWKPIFQIKPHFIRTEM--NPQFVTIVTPVDVVIETEFT 204

Query: 188 MTIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRI 246
           + IE      ++ IP  ++         +     +      I     +     V ++  +
Sbjct: 205 LEIETRECKIMVCIPYSSVEPIKEKLYSAFLADRDEMDMKWIGRLKAQIKNAPVQVEAIL 264

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
                  K ++ LK G ++    R      L   G   +  +LG    NY I+I  
Sbjct: 265 GKVTIDFKTLLDLKSGDIVTLQRRIDEEVDLLVEGVPKFKGKLGTFKGNYAIKIIK 320


>gi|148976420|ref|ZP_01813126.1| flagellar motor switch protein M [Vibrionales bacterium SWAT-3]
 gi|145964243|gb|EDK29499.1| flagellar motor switch protein M [Vibrionales bacterium SWAT-3]
          Length = 347

 Score =  244 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 36/295 (12%), Positives = 89/295 (30%), Gaps = 11/295 (3%)

Query: 13  LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSH 72
                  R+                +   + + +       +    ++S    Q  KF  
Sbjct: 37  FDFSSQDRIVRG------RMPTLELINERFSRHMRISLFNMLRKTAEVSINGVQMMKFGE 90

Query: 73  IIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEK 132
             ++       +            I     LV  L+EN  G       ++  R  +  E+
Sbjct: 91  YQNTLYVPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRFHAKIEGREFTPTER 150

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
           ++ +  +  +     +  S         E                 E +   + ++ ++ 
Sbjct: 151 RIIQLLLKIVFEDYKEAWSPVMGVE--FEYLDSEVNPSMANIVSPTEVIVVSSFHIEVDG 208

Query: 193 VASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
               F +++P   +     +  +  Q+               +   + VN    +  +  
Sbjct: 209 GGGDFHVVMPYSMVEPIRELLDAGVQSDKMETDVRWSTALRDEIMDVPVNFRVNLLEQDI 268

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
           +L+D++ L+ G VIP        A +       Y  ++GR G+   ++I+++I  
Sbjct: 269 SLRDLMELRPGDVIPMNMP--EHATMFVEELPTYRVKMGRSGEKLAVQISEKIQR 321


>gi|239997091|ref|ZP_04717615.1| flagellar motor switch protein FliM [Alteromonas macleodii ATCC
           27126]
          Length = 352

 Score =  244 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 42/303 (13%), Positives = 91/303 (30%), Gaps = 11/303 (3%)

Query: 3   GQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISY 62
           G     +T         R+                +   + + +       M    ++S 
Sbjct: 27  GSDSDASTLEYDFSSQDRIVRG------RMPTLEIVNERFARHMRVSLFNMMRRSAEVSI 80

Query: 63  TSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQL 122
              Q  KF   IH+       +            I     LV  L++N  G       ++
Sbjct: 81  NGIQMIKFGEYIHTLFVPTSLNMVRFRPLKGTGLITMEARLVFILVDNFFGGDGRYHAKI 140

Query: 123 YNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVT 182
             R  +  E+++ +  +  I     +  +   +   + E                 E V 
Sbjct: 141 EGREFTPTERRIIQMLLKIIFEDYKEAWAPVMDV--SFEYLDSEVNPAMANIVSPTEVVV 198

Query: 183 TINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVN 241
             + ++ ++     F + +P   L     +  +  Q+  E+           +   + V 
Sbjct: 199 ISSFHIELDGGGGDFHVSLPYSMLEPIRELLDAGVQSDKEDTDLRWSKALRDEIMDVKVA 258

Query: 242 IDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
           + T +      L+DV+  K G +IP          +       +  +LGR   N  ++I 
Sbjct: 259 LTTHMLDVDVPLRDVMEFKPGDIIPVEMP--ETITVLIEDLPTFRAKLGRSRDNLALKIV 316

Query: 302 DRI 304
           ++I
Sbjct: 317 EKI 319


>gi|311105953|ref|YP_003978806.1| flagellar motor switch protein FliM [Achromobacter xylosoxidans A8]
 gi|310760642|gb|ADP16091.1| flagellar motor switch protein FliM [Achromobacter xylosoxidans A8]
          Length = 335

 Score =  244 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 37/311 (11%), Positives = 100/311 (32%), Gaps = 9/311 (2%)

Query: 4   QSIHKNTSPLHPILLAR---LTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
                 T+       AR   L+      +   +    +   + + +  +    M    DI
Sbjct: 21  GESDSKTTATDQSAGARAYDLSSPERVVRRRMQTLELINERFARQMRHVLLNFMRRSADI 80

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           +  S +  K++    +       +   +             NLV  ++++L G       
Sbjct: 81  TVGSIKIQKYADFERNLPVPSNLNMIQMKPLRGTALFTYDPNLVFLVIDSLFGGDGRYHT 140

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++  R  +T E+++ +R +        +                     K  +   +NE 
Sbjct: 141 RVEGRDFTTTEQRIIRRLLNLTLESYGKSWDPVYPIEFEYVRSEMHT--KFASITGNNEV 198

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKS--ENQSEDLIDPFARKTYQL 238
           V   + ++          + +P   +     +      ++  E   +      +R+    
Sbjct: 199 VVVTSFHIEFGATGGDLNICLPYSMIEPVRDLLTRPLQETTLEEVDQRWAQQLSRQVRSA 258

Query: 239 NVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTI 298
           ++++        +++++++ LK+G V+P         + S +G  +  C  G     Y +
Sbjct: 259 DIDVVAEFARIPSSIRELMRLKVGDVLPVTVP--ETIVASVDGVPLMECGYGVFNGQYAL 316

Query: 299 RITDRINFDQK 309
           R+ +    D +
Sbjct: 317 RVQNMFTHDTE 327


>gi|312135842|ref|YP_004003180.1| flagellar motor switch protein flim [Caldicellulosiruptor
           owensensis OL]
 gi|311775893|gb|ADQ05380.1| flagellar motor switch protein FliM [Caldicellulosiruptor
           owensensis OL]
          Length = 329

 Score =  244 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 37/292 (12%), Positives = 94/292 (32%), Gaps = 7/292 (2%)

Query: 20  RLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKE 79
                    K   +    +   Y + +       +   V +   S +   +    +S   
Sbjct: 40  DFKRPSKFAKDHLRTLQMIFENYARIVTTFLSGYLRTVVQMDVLSVEQLTYYEFSNSLSN 99

Query: 80  NFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTI 139
             V    + +    +     +  +   +++ +LG   + I ++  R+ + +E  L +R +
Sbjct: 100 PVVMGIVNFAPLKGSIVYEMAPEIAFAMIDRVLGGFGKGIDKI--RTFTEIELALIERLL 157

Query: 140 AQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVL 199
            Q+     +      +  P LE        +       NE V  + + M +        +
Sbjct: 158 QQLINYFQEAWENIIQLRPRLEKIET--NPQFTQIVSPNETVALVTIAMKVGEAEGMANI 215

Query: 200 IIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDV 256
            +P   +                ++  SE+  +   +K  +  V +   +   + T+++ 
Sbjct: 216 CLPHMVIEPIMPRLSTKFWFSTSAKETSEETKEYLQKKIERTRVTVKAVLGRTQITVREF 275

Query: 257 VTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
           + L++G V+    R+     +    K  +    GR      I+IT     + 
Sbjct: 276 LELQVGDVLRLDRRKNQEIEVYVGNKLKFYGVPGRKEGRVAIKITRVEEGED 327


>gi|293115681|ref|ZP_06604569.1| flagellar motor switch protein FliM [Butyrivibrio crossotus DSM
           2876]
 gi|292808783|gb|EFF67988.1| flagellar motor switch protein FliM [Butyrivibrio crossotus DSM
           2876]
          Length = 329

 Score =  244 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 34/308 (11%), Positives = 97/308 (31%), Gaps = 13/308 (4%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           +  K          A+        K   +    +   Y + L       + + V +   +
Sbjct: 32  TEEKTVKDYDFARPAKF------SKEHLRTLEIIFEHYGRLLSTNLPAYLRMPVQVEVKT 85

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            ++  +S   ++     +           N  +  ++NL   +++ LLG + + + +   
Sbjct: 86  SEAVIYSEFSNALSNPVLLGVVDFEPLDGNIVLEIASNLGFVIIDRLLGGAGKPLSK--G 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  S +E  + +R       +L +         P +E        +       +E +  +
Sbjct: 144 RDFSEIELSIIERIFNICVNLLREPWQNVLSIVPRMERIET--NSQFAQIISPSEMIAIV 201

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLIS---LSSQNKSENQSEDLIDPFARKTYQLNVN 241
            +++ + +      + +P   L                     +   D  +    +  + 
Sbjct: 202 TISIKLGDTEGLMNVCLPYSVLEPVMDKLNTKYWFSTMQHRDVKTYEDAISSLISKAQIP 261

Query: 242 IDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
           +   +     ++ D + L +G +I    +      +       ++   G    NY +RIT
Sbjct: 262 VKAVLGNSTISVNDFLNLNVGDIIRLDRKVDEELDVYVGNIHKFTALPGSADDNYAVRIT 321

Query: 302 DRINFDQK 309
           + +  +++
Sbjct: 322 NVLRGEEE 329


>gi|294636877|ref|ZP_06715207.1| flagellar motor switch protein FliM [Edwardsiella tarda ATCC 23685]
 gi|291089907|gb|EFE22468.1| flagellar motor switch protein FliM [Edwardsiella tarda ATCC 23685]
          Length = 337

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 39/301 (12%), Positives = 95/301 (31%), Gaps = 10/301 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
                P  P    R+       +   +    +   + +         +    DI+  + +
Sbjct: 34  DGEVRPYDPTTQRRVV------RERLQALEIVNERFARQFRMGLFNLLRRSPDITVGAVR 87

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
              +     +       +   L        +    +LV   ++NL G       ++  R 
Sbjct: 88  IQPYHEFARNLPVPTNLNLVHLKPLRGTALMVFEPSLVFMAVDNLFGGDGRFPTKVDGRE 147

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E+++ +R +               +          I     N     N+ V T   
Sbjct: 148 FTHTEQRVIQRMLRLALDAYRDAWGAIFKLEVEYVRSE-IQVKFTNITTSPNDIVVTTPF 206

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNIDTR 245
            + +  ++  F + IP   +     + ++   + S+ + +   D  +++     + +   
Sbjct: 207 TVEVGALSGEFNICIPFSMIEPLRELLVNPPLENSKQEDQHWRDTLSKQVQHSELELVAN 266

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
                  L DV+ L++G V+P         I + +G  + +C+ G     Y +R+   IN
Sbjct: 267 FVDIPLRLSDVLKLQVGDVLPIDRP--DRLIANVDGVPVLTCQYGCYHGQYALRVEKMIN 324

Query: 306 F 306
            
Sbjct: 325 P 325


>gi|74312485|ref|YP_310904.1| flagellar motor switch protein FliM [Shigella sonnei Ss046]
 gi|73855962|gb|AAZ88669.1| flagellar motor switch protein FliM [Shigella sonnei Ss046]
 gi|323168934|gb|EFZ54614.1| flagellar motor switch protein FliM [Shigella sonnei 53G]
          Length = 334

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 41/303 (13%), Positives = 95/303 (31%), Gaps = 10/303 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+       +   +    +   + +         +    DI+  +
Sbjct: 30  SGESDIRPYDPNTQRRVV------RERLQALEIINERFARHFRMGLFNLLRRSPDITVGA 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G +     ++  
Sbjct: 84  IRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGNGRFPTKVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +                  +     N     N+ V   
Sbjct: 144 REFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVRSE-MQVKFTNITTSPNDIVVNT 202

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     + ++   + S N+ ++  D   R+     + + 
Sbjct: 203 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELV 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK G V+P         I   +G  + + + G +   Y +RI   
Sbjct: 263 ANFADISLRLSQILKLKPGDVLPIEKP--DGIIAHVDGVPVLTSQYGTLNGQYALRIEHL 320

Query: 304 INF 306
           IN 
Sbjct: 321 INP 323


>gi|224826626|ref|ZP_03699727.1| flagellar motor switch protein FliM [Lutiella nitroferrum 2002]
 gi|224601227|gb|EEG07409.1| flagellar motor switch protein FliM [Lutiella nitroferrum 2002]
          Length = 335

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 38/308 (12%), Positives = 92/308 (29%), Gaps = 11/308 (3%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
               +           R+                +   + + L       +  + +IS  
Sbjct: 28  GQDSQGVRTYDIGRQERIVRG------RMPTLEIINERFARNLRIGLFNFIRRNAEISVG 81

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
             +  K+S  I +       +   +        +    +LV  +++NL G+      ++ 
Sbjct: 82  PVRVQKYSEFIRNLVVPTNLNLVHVKPLRGTGLLIFDPDLVFLVVDNLFGSDGRYHVRVE 141

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  +  E+++ +R +  +     +                     +        E V  
Sbjct: 142 GRDFTPTEQRIIRRLLEVVFTEYQKAWEPVYPIE--FVYLRSEMNTQFANIATPTEVVVA 199

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQLNVNI 242
           +  ++ +      F + +P   +     +  S  Q          +   +R+     V++
Sbjct: 200 MTFHIEMGAGGGEFHVCLPYSMVEPIRDVLSSTMQADRTEVDNRWVSLMSRQVQAAEVDL 259

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
              +     TL  V+ LK G V+     E   A +S  G  +  C  G V  +Y +++  
Sbjct: 260 VATLAGTSVTLGQVLNLKQGDVVTLEIPEMIIADVS--GIPVVECTYGTVQGHYALKVET 317

Query: 303 RINFDQKS 310
            +    + 
Sbjct: 318 ILAGAHEL 325


>gi|323968361|gb|EGB63768.1| flagellar motor switch protein FliM [Escherichia coli M863]
 gi|323977874|gb|EGB72960.1| flagellar motor switch protein FliM [Escherichia coli TW10509]
 gi|327253077|gb|EGE64731.1| flagellar motor switch protein FliM [Escherichia coli STEC_7v]
          Length = 334

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 41/303 (13%), Positives = 94/303 (31%), Gaps = 10/303 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+       +   +    +   + +         +    DI+  +
Sbjct: 30  SGDSDIRPYDPNTQRRVV------RERLQALEIINERFARHFRMGLFNLLRRSPDITVGA 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G       ++  
Sbjct: 84  IRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +                  +     N     N+ V   
Sbjct: 144 REFTHTEQRVINRMLKLALEGYSDAWKAINPLDVEYVRSE-MQVKFTNITTSPNDIVVNT 202

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     + ++   + S N+ ++  D   R+     + + 
Sbjct: 203 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELV 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK G V+P         I   +G  + + + G +   Y +RI   
Sbjct: 263 ANFADISLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRIEHL 320

Query: 304 INF 306
           IN 
Sbjct: 321 INP 323


>gi|300994270|ref|ZP_07180822.1| flagellar motor switch protein FliM [Escherichia coli MS 200-1]
 gi|300304935|gb|EFJ59455.1| flagellar motor switch protein FliM [Escherichia coli MS 200-1]
          Length = 334

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 41/303 (13%), Positives = 94/303 (31%), Gaps = 10/303 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+       +   +    +   + +         +    DI+  +
Sbjct: 30  SGESDIRPYDPNTQRRVV------RERLQALEIINERFARHFRMGLFNLLRRSPDITVGA 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G       ++  
Sbjct: 84  IRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +                  +     N     N+ V   
Sbjct: 144 REFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVRSE-MQVKFTNITTSPNDIVVNT 202

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     + ++   + S N+ ++  D   R+     + + 
Sbjct: 203 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELV 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK G V+P         I   +G  + + + G +   Y +RI   
Sbjct: 263 ANFADISLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRIEHL 320

Query: 304 INF 306
           IN 
Sbjct: 321 INP 323


>gi|269139494|ref|YP_003296195.1| flagellar motor switch protein [Edwardsiella tarda EIB202]
 gi|267985155|gb|ACY84984.1| flagellar motor switch protein [Edwardsiella tarda EIB202]
 gi|304559383|gb|ADM42047.1| Flagellar motor switch protein FliM [Edwardsiella tarda FL6-60]
          Length = 337

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 39/304 (12%), Positives = 98/304 (32%), Gaps = 10/304 (3%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           ++   +  P  P    R+       +   +    +   + +         +    DI+  
Sbjct: 31  ENHDGDVRPYDPTTQRRVV------RERLQALEIVNERFARQFRMGLFNLLRRSPDITVG 84

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
           + +   +     +       +   L        +    +LV   ++NL G       ++ 
Sbjct: 85  AVRIQPYHEFARNLPVPTNLNLVHLKPLRGTALMVFEPSLVFMAVDNLFGGDGRFPTKVD 144

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  +  E+++ +R +               +          I     N     N+ V T
Sbjct: 145 GREFTHTEQRVIQRMLRLALDAYRDAWGAIFKLDVEYVRSE-IQVKFTNITTSPNDIVVT 203

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNI 242
               + +  ++  F + IP   +     + ++   + S+ + +   D  +++     + +
Sbjct: 204 TPFTVEVGALSGEFNICIPFSMIEPLRELLVNPPLENSKQEDQHWRDTLSKQVQHSELEL 263

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
                     L DV+ L+IG V+P         + + +G  + +C+ G     Y +R+  
Sbjct: 264 VANFVDVPLRLSDVLKLQIGDVLPIDRP--DRLVANVDGVPVLTCQYGCYHGQYALRVEK 321

Query: 303 RINF 306
            IN 
Sbjct: 322 MINP 325


>gi|56413111|ref|YP_150186.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197362037|ref|YP_002141674.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|56127368|gb|AAV76874.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197093514|emb|CAR58975.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
          Length = 334

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 40/305 (13%), Positives = 95/305 (31%), Gaps = 10/305 (3%)

Query: 3   GQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISY 62
           G +   +  P  P    R+       +   +    +   + +         +    DI+ 
Sbjct: 28  GIASDSDIRPYDPNTQRRVV------RERLQALEIINERFARQFRMGLFNLLRRSPDITV 81

Query: 63  TSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQL 122
            + +   +     +       +   L        +  S +LV   ++NL G       ++
Sbjct: 82  GTIRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKV 141

Query: 123 YNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVT 182
             R  +  E+++  R +       +                  +     N     N+ V 
Sbjct: 142 EGREFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVRSE-MQVKFTNITTSPNDIVV 200

Query: 183 TINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVN 241
               ++ I N+   F + +P   +     + ++   + S ++ ++  D   R+     + 
Sbjct: 201 NTPFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRHEDQNWRDNLVRQVQHSELE 260

Query: 242 IDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
           +          L  ++ LK G V+P         I   +G  + + + G V   Y +R+ 
Sbjct: 261 LVANFADIPLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTVNGQYALRVE 318

Query: 302 DRINF 306
             IN 
Sbjct: 319 HLINP 323


>gi|332284035|ref|YP_004415946.1| flagellar motor switch protein FliM [Pusillimonas sp. T7-7]
 gi|330427988|gb|AEC19322.1| flagellar motor switch protein FliM [Pusillimonas sp. T7-7]
          Length = 330

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 37/312 (11%), Positives = 101/312 (32%), Gaps = 8/312 (2%)

Query: 1   MRGQSIHKNTSPLHPILLA--RLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDV 58
           + G+S  K ++   P  +    L+      +   +    +   + + L  +    M  + 
Sbjct: 19  VTGESNEKTSTADDPPGVRPYDLSSPDRVVRHRMQTLELINERFARRLRSVLLSFMRRNA 78

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
           DI+  S +  K+S    +       +  ++             NLV  ++++L G     
Sbjct: 79  DITVGSIRIQKYSDFERNLPVPSNLNMVTMKPLRGAALFTFDPNLVFLVIDSLFGGHGRY 138

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSN 178
             ++  R  +T E+++ +R +                     E      + K  +    N
Sbjct: 139 STRVEGRDFTTTEQRIIRRLLNLTLESYGGAWEQVYPVQ--FEYIRSEMHTKFASITSGN 196

Query: 179 EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSE--NQSEDLIDPFARKTY 236
           E V   + N+ +     +  + +P   +     +      ++      +       R+  
Sbjct: 197 EIVVVTSFNIELGASGGNLNICLPYSMIEPVRDLLTRPLQEANAGAIDQRWTHQLTRQVR 256

Query: 237 QLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNY 296
             +V +       ++++ +++ L++  ++P              G  +  C  G     Y
Sbjct: 257 SADVELVAEFARIESSIGELMRLEVNDILPLEITP--AINAHVGGVPVMECTYGTFNGRY 314

Query: 297 TIRITDRINFDQ 308
            +R+   +   +
Sbjct: 315 ALRVKKVLASSE 326


>gi|238785486|ref|ZP_04629469.1| Flagellar motor switch protein fliM [Yersinia bercovieri ATCC
           43970]
 gi|238713588|gb|EEQ05617.1| Flagellar motor switch protein fliM [Yersinia bercovieri ATCC
           43970]
          Length = 334

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 36/302 (11%), Positives = 88/302 (29%), Gaps = 10/302 (3%)

Query: 6   IHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSC 65
              +  P  P    R+       +        +   + +         +    DI+    
Sbjct: 30  TETDVKPYDPTTQRRVV------RERLHALEIINERFARQFRMGLFNLLRRSPDITVGPI 83

Query: 66  QSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNR 125
           +   +     +       +   L           + +LV   ++NL G       ++  R
Sbjct: 84  KIQPYHDFARNLPVPTNLNLIHLKPLRGTALFVFAPSLVFIAVDNLFGGDGRFPTKVEGR 143

Query: 126 SLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTIN 185
             +  E+++  R +           +   +          I     N     N+ V T  
Sbjct: 144 EFTHTEQRVINRMLRLALDAYRDAWAPIYKIDVEYVRSE-IQVKFTNITTSPNDIVVTTP 202

Query: 186 MNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNIDT 244
            ++ I  ++  F + IP   +     +  +   + S  +     +   ++     + +  
Sbjct: 203 FHVEIGALSGEFNICIPFAMIEPLRELLTNPPLENSRQEDSHWRETLVKQVQHSELELVA 262

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
                   L  ++ L+ G V+P         I   +G  + + + G +   Y +R+   I
Sbjct: 263 NFVDIPLRLSQILKLQPGDVLPIDKP--DRLIGHVDGVPVLTSQYGTLNGQYALRVEHLI 320

Query: 305 NF 306
           N 
Sbjct: 321 NP 322


>gi|299068765|emb|CBJ40005.1| flagellar motor switching and energizing component [Ralstonia
           solanacearum CMR15]
          Length = 335

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 33/276 (11%), Positives = 90/276 (32%), Gaps = 5/276 (1%)

Query: 31  IEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSS 90
                  +   + +         +  + +IS    +  K+S  I +       +   +  
Sbjct: 50  RMPTLEIINERFARNWRMGLFNFLRRNAEISVGPVKVQKYSEFIRNLVVPAAINLVHVKP 109

Query: 91  WSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCI 150
                      NL+  ++++L G       ++  R  + VE+++ +R +  +     +  
Sbjct: 110 LRGTALFVFDPNLIFIVVDHLFGGDGRFHMRVEGRDFTQVEQRIIQRMLQLMFEHYGKAW 169

Query: 151 STTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTT 210
                     E      + +       NE V +   +M + +      + +P   +    
Sbjct: 170 QPIYPIE--FEPLRMEMHTEFANVATPNEVVVSTRFSMELGSNGGDVHVCMPYTMIEPIR 227

Query: 211 LISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLH 269
            +  S+ Q ++    +  +   +++     V +   +      + D++ +K+G V+P   
Sbjct: 228 DLLTSAIQGEALEVDKRWVRLLSQQVQTAEVEVVAHLANANVHVSDILNMKVGDVVPIEL 287

Query: 270 REKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
                     +G  +  C  G     Y +R+   +N
Sbjct: 288 --DDAVTARVDGVPVMECAYGTFNGQYALRVNRMLN 321


>gi|15831938|ref|NP_310711.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           Sakai]
 gi|82543593|ref|YP_407540.1| flagellar motor switch protein FliM [Shigella boydii Sb227]
 gi|157156914|ref|YP_001463247.1| flagellar motor switch protein FliM [Escherichia coli E24377A]
 gi|157161416|ref|YP_001458734.1| flagellar motor switch protein FliM [Escherichia coli HS]
 gi|168751874|ref|ZP_02776896.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4113]
 gi|168758259|ref|ZP_02783266.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4401]
 gi|168764429|ref|ZP_02789436.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4501]
 gi|168771552|ref|ZP_02796559.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4486]
 gi|168777372|ref|ZP_02802379.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4196]
 gi|168783342|ref|ZP_02808349.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4076]
 gi|168790295|ref|ZP_02815302.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC869]
 gi|168802292|ref|ZP_02827299.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC508]
 gi|170019722|ref|YP_001724676.1| flagellar motor switch protein FliM [Escherichia coli ATCC 8739]
 gi|170684212|ref|YP_001743300.1| flagellar motor switch protein FliM [Escherichia coli SMS-3-5]
 gi|188494069|ref|ZP_03001339.1| flagellar motor switch protein FliM [Escherichia coli 53638]
 gi|191168308|ref|ZP_03030101.1| flagellar motor switch protein FliM [Escherichia coli B7A]
 gi|191173313|ref|ZP_03034843.1| flagellar motor switch protein FliM [Escherichia coli F11]
 gi|193071140|ref|ZP_03052064.1| flagellar motor switch protein FliM [Escherichia coli E110019]
 gi|194429931|ref|ZP_03062441.1| flagellar motor switch protein FliM [Escherichia coli B171]
 gi|194439587|ref|ZP_03071660.1| flagellar motor switch protein FliM [Escherichia coli 101-1]
 gi|195939251|ref|ZP_03084633.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4024]
 gi|208810354|ref|ZP_03252230.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4206]
 gi|208816529|ref|ZP_03257649.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4045]
 gi|208818778|ref|ZP_03259098.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4042]
 gi|209396357|ref|YP_002271061.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4115]
 gi|209919367|ref|YP_002293451.1| flagellar motor switch protein FliM [Escherichia coli SE11]
 gi|215487145|ref|YP_002329576.1| flagellar motor switch protein FliM [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217328609|ref|ZP_03444690.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           TW14588]
 gi|218554525|ref|YP_002387438.1| flagellar motor switch protein FliM [Escherichia coli IAI1]
 gi|218558802|ref|YP_002391715.1| flagellar motor switch protein FliM [Escherichia coli S88]
 gi|218689940|ref|YP_002398152.1| flagellar motor switch protein FliM [Escherichia coli ED1a]
 gi|218695550|ref|YP_002403217.1| flagellar motor switch protein FliM [Escherichia coli 55989]
 gi|218699494|ref|YP_002407123.1| flagellar motor switch protein FliM [Escherichia coli IAI39]
 gi|218705438|ref|YP_002412957.1| flagellar motor switch protein FliM [Escherichia coli UMN026]
 gi|227885626|ref|ZP_04003431.1| flagellar motor switch protein FliM [Escherichia coli 83972]
 gi|254793595|ref|YP_003078432.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           TW14359]
 gi|256017862|ref|ZP_05431727.1| flagellar motor switch protein FliM [Shigella sp. D9]
 gi|256022397|ref|ZP_05436262.1| flagellar motor switch protein FliM [Escherichia sp. 4_1_40B]
 gi|260844344|ref|YP_003222122.1| flagellar motor switching and energizing component FliM
           [Escherichia coli O103:H2 str. 12009]
 gi|260855920|ref|YP_003229811.1| flagellar motor switching and energizing component FliM
           [Escherichia coli O26:H11 str. 11368]
 gi|260868538|ref|YP_003234940.1| flagellar motor switching and energizing component FliM
           [Escherichia coli O111:H- str. 11128]
 gi|261227560|ref|ZP_05941841.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261254616|ref|ZP_05947149.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291283122|ref|YP_003499940.1| Flagellar motor switch protein FliM [Escherichia coli O55:H7 str.
           CB9615]
 gi|293405428|ref|ZP_06649420.1| flagellar motor switch protein fliM [Escherichia coli FVEC1412]
 gi|293410301|ref|ZP_06653877.1| flagellar motor switch protein FliM [Escherichia coli B354]
 gi|293415255|ref|ZP_06657898.1| flagellar motor switch protein FliM [Escherichia coli B185]
 gi|293446325|ref|ZP_06662747.1| flagellar motor switch protein FliM [Escherichia coli B088]
 gi|298381072|ref|ZP_06990671.1| flagellar motor switch protein fliM [Escherichia coli FVEC1302]
 gi|300818635|ref|ZP_07098843.1| flagellar motor switch protein FliM [Escherichia coli MS 107-1]
 gi|300822285|ref|ZP_07102426.1| flagellar motor switch protein FliM [Escherichia coli MS 119-7]
 gi|300899202|ref|ZP_07117478.1| flagellar motor switch protein FliM [Escherichia coli MS 198-1]
 gi|300904835|ref|ZP_07122661.1| flagellar motor switch protein FliM [Escherichia coli MS 84-1]
 gi|300920164|ref|ZP_07136614.1| flagellar motor switch protein FliM [Escherichia coli MS 115-1]
 gi|300923892|ref|ZP_07139907.1| flagellar motor switch protein FliM [Escherichia coli MS 182-1]
 gi|300931158|ref|ZP_07146505.1| flagellar motor switch protein FliM [Escherichia coli MS 187-1]
 gi|300940400|ref|ZP_07154985.1| flagellar motor switch protein FliM [Escherichia coli MS 21-1]
 gi|300951570|ref|ZP_07165403.1| flagellar motor switch protein FliM [Escherichia coli MS 116-1]
 gi|300956539|ref|ZP_07168821.1| flagellar motor switch protein FliM [Escherichia coli MS 175-1]
 gi|301018205|ref|ZP_07182720.1| flagellar motor switch protein FliM [Escherichia coli MS 69-1]
 gi|301305288|ref|ZP_07211385.1| flagellar motor switch protein FliM [Escherichia coli MS 124-1]
 gi|301327732|ref|ZP_07220937.1| flagellar motor switch protein FliM [Escherichia coli MS 78-1]
 gi|301644596|ref|ZP_07244585.1| flagellar motor switch protein FliM [Escherichia coli MS 146-1]
 gi|306814232|ref|ZP_07448398.1| flagellar motor switch protein FliM [Escherichia coli NC101]
 gi|307138612|ref|ZP_07497968.1| flagellar motor switch protein FliM [Escherichia coli H736]
 gi|307312469|ref|ZP_07592103.1| flagellar motor switch protein FliM [Escherichia coli W]
 gi|309795948|ref|ZP_07690361.1| flagellar motor switch protein FliM [Escherichia coli MS 145-7]
 gi|312967142|ref|ZP_07781360.1| flagellar motor switch protein FliM [Escherichia coli 2362-75]
 gi|312973838|ref|ZP_07788010.1| flagellar motor switch protein FliM [Escherichia coli 1827-70]
 gi|331657991|ref|ZP_08358953.1| flagellar motor switch protein FliM [Escherichia coli TA206]
 gi|331663441|ref|ZP_08364351.1| flagellar motor switch protein FliM [Escherichia coli TA143]
 gi|331668636|ref|ZP_08369484.1| flagellar motor switch protein FliM [Escherichia coli TA271]
 gi|331683497|ref|ZP_08384098.1| flagellar motor switch protein FliM [Escherichia coli H299]
 gi|13362152|dbj|BAB36107.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           Sakai]
 gi|81245004|gb|ABB65712.1| FliM [Shigella boydii Sb227]
 gi|157067096|gb|ABV06351.1| flagellar motor switch protein FliM [Escherichia coli HS]
 gi|157078944|gb|ABV18652.1| flagellar motor switch protein FliM [Escherichia coli E24377A]
 gi|169754650|gb|ACA77349.1| flagellar motor switch protein FliM [Escherichia coli ATCC 8739]
 gi|170521930|gb|ACB20108.1| flagellar motor switch protein FliM [Escherichia coli SMS-3-5]
 gi|187767405|gb|EDU31249.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4196]
 gi|188014186|gb|EDU52308.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4113]
 gi|188489268|gb|EDU64371.1| flagellar motor switch protein FliM [Escherichia coli 53638]
 gi|188999277|gb|EDU68263.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4076]
 gi|189354878|gb|EDU73297.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4401]
 gi|189359725|gb|EDU78144.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4486]
 gi|189365559|gb|EDU83975.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4501]
 gi|189370212|gb|EDU88628.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC869]
 gi|189375729|gb|EDU94145.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC508]
 gi|190901680|gb|EDV61436.1| flagellar motor switch protein FliM [Escherichia coli B7A]
 gi|190906430|gb|EDV66039.1| flagellar motor switch protein FliM [Escherichia coli F11]
 gi|192955535|gb|EDV86014.1| flagellar motor switch protein FliM [Escherichia coli E110019]
 gi|194412020|gb|EDX28332.1| flagellar motor switch protein FliM [Escherichia coli B171]
 gi|194421496|gb|EDX37510.1| flagellar motor switch protein FliM [Escherichia coli 101-1]
 gi|208724870|gb|EDZ74577.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4206]
 gi|208730872|gb|EDZ79561.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4045]
 gi|208738901|gb|EDZ86583.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4042]
 gi|209157757|gb|ACI35190.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC4115]
 gi|209766818|gb|ACI81721.1| flagellar motor switch protein FliM [Escherichia coli]
 gi|209766820|gb|ACI81722.1| flagellar motor switch protein FliM [Escherichia coli]
 gi|209766822|gb|ACI81723.1| flagellar motor switch protein FliM [Escherichia coli]
 gi|209766824|gb|ACI81724.1| flagellar motor switch protein FliM [Escherichia coli]
 gi|209766826|gb|ACI81725.1| flagellar motor switch protein FliM [Escherichia coli]
 gi|209912626|dbj|BAG77700.1| flagellar motor switch protein FliM [Escherichia coli SE11]
 gi|215265217|emb|CAS09607.1| flagellar motor switching and energizing component [Escherichia
           coli O127:H6 str. E2348/69]
 gi|217317956|gb|EEC26383.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           TW14588]
 gi|218352282|emb|CAU98039.1| flagellar motor switching and energizing component [Escherichia
           coli 55989]
 gi|218361293|emb|CAQ98877.1| flagellar motor switching and energizing component [Escherichia
           coli IAI1]
 gi|218365571|emb|CAR03298.1| flagellar motor switching and energizing component [Escherichia
           coli S88]
 gi|218369480|emb|CAR17245.1| flagellar motor switching and energizing component [Escherichia
           coli IAI39]
 gi|218427504|emb|CAR08399.2| flagellar motor switching and energizing component [Escherichia
           coli ED1a]
 gi|218432535|emb|CAR13428.1| flagellar motor switching and energizing component [Escherichia
           coli UMN026]
 gi|222033684|emb|CAP76425.1| flagellar motor switch protein fliM [Escherichia coli LF82]
 gi|227837199|gb|EEJ47665.1| flagellar motor switch protein FliM [Escherichia coli 83972]
 gi|254592995|gb|ACT72356.1| flagellar motor switching and energizing component [Escherichia
           coli O157:H7 str. TW14359]
 gi|257754569|dbj|BAI26071.1| flagellar motor switching and energizing component FliM
           [Escherichia coli O26:H11 str. 11368]
 gi|257759491|dbj|BAI30988.1| flagellar motor switching and energizing component FliM
           [Escherichia coli O103:H2 str. 12009]
 gi|257764894|dbj|BAI36389.1| flagellar motor switching and energizing component FliM
           [Escherichia coli O111:H- str. 11128]
 gi|281179007|dbj|BAI55337.1| flagellar motor switch protein FliM [Escherichia coli SE15]
 gi|284921853|emb|CBG34928.1| flagellar motor switch protein FliM [Escherichia coli 042]
 gi|290762995|gb|ADD56956.1| Flagellar motor switch protein FliM [Escherichia coli O55:H7 str.
           CB9615]
 gi|291323155|gb|EFE62583.1| flagellar motor switch protein FliM [Escherichia coli B088]
 gi|291427636|gb|EFF00663.1| flagellar motor switch protein fliM [Escherichia coli FVEC1412]
 gi|291432903|gb|EFF05882.1| flagellar motor switch protein FliM [Escherichia coli B185]
 gi|291470769|gb|EFF13253.1| flagellar motor switch protein FliM [Escherichia coli B354]
 gi|294492735|gb|ADE91491.1| flagellar motor switch protein FliM [Escherichia coli IHE3034]
 gi|298278514|gb|EFI20028.1| flagellar motor switch protein fliM [Escherichia coli FVEC1302]
 gi|300316639|gb|EFJ66423.1| flagellar motor switch protein FliM [Escherichia coli MS 175-1]
 gi|300357183|gb|EFJ73053.1| flagellar motor switch protein FliM [Escherichia coli MS 198-1]
 gi|300399792|gb|EFJ83330.1| flagellar motor switch protein FliM [Escherichia coli MS 69-1]
 gi|300403262|gb|EFJ86800.1| flagellar motor switch protein FliM [Escherichia coli MS 84-1]
 gi|300412821|gb|EFJ96131.1| flagellar motor switch protein FliM [Escherichia coli MS 115-1]
 gi|300419855|gb|EFK03166.1| flagellar motor switch protein FliM [Escherichia coli MS 182-1]
 gi|300449197|gb|EFK12817.1| flagellar motor switch protein FliM [Escherichia coli MS 116-1]
 gi|300454794|gb|EFK18287.1| flagellar motor switch protein FliM [Escherichia coli MS 21-1]
 gi|300461015|gb|EFK24508.1| flagellar motor switch protein FliM [Escherichia coli MS 187-1]
 gi|300525168|gb|EFK46237.1| flagellar motor switch protein FliM [Escherichia coli MS 119-7]
 gi|300528807|gb|EFK49869.1| flagellar motor switch protein FliM [Escherichia coli MS 107-1]
 gi|300839494|gb|EFK67254.1| flagellar motor switch protein FliM [Escherichia coli MS 124-1]
 gi|300845732|gb|EFK73492.1| flagellar motor switch protein FliM [Escherichia coli MS 78-1]
 gi|301077071|gb|EFK91877.1| flagellar motor switch protein FliM [Escherichia coli MS 146-1]
 gi|305852391|gb|EFM52842.1| flagellar motor switch protein FliM [Escherichia coli NC101]
 gi|306907640|gb|EFN38143.1| flagellar motor switch protein FliM [Escherichia coli W]
 gi|307553958|gb|ADN46733.1| flagellar motor switch protein FliM [Escherichia coli ABU 83972]
 gi|307626579|gb|ADN70883.1| flagellar motor switch protein FliM [Escherichia coli UM146]
 gi|308120398|gb|EFO57660.1| flagellar motor switch protein FliM [Escherichia coli MS 145-7]
 gi|309702234|emb|CBJ01551.1| flagellar motor switch protein FliM [Escherichia coli ETEC H10407]
 gi|310332433|gb|EFP99668.1| flagellar motor switch protein FliM [Escherichia coli 1827-70]
 gi|312288606|gb|EFR16508.1| flagellar motor switch protein FliM [Escherichia coli 2362-75]
 gi|312946538|gb|ADR27365.1| flagellar motor switch protein FliM [Escherichia coli O83:H1 str.
           NRG 857C]
 gi|315061245|gb|ADT75572.1| flagellar motor switching and energizing component [Escherichia
           coli W]
 gi|315257223|gb|EFU37191.1| flagellar motor switch protein FliM [Escherichia coli MS 85-1]
 gi|315286659|gb|EFU46092.1| flagellar motor switch protein FliM [Escherichia coli MS 110-3]
 gi|315290262|gb|EFU49640.1| flagellar motor switch protein FliM [Escherichia coli MS 153-1]
 gi|315296479|gb|EFU55776.1| flagellar motor switch protein FliM [Escherichia coli MS 16-3]
 gi|320175465|gb|EFW50564.1| Flagellar motor switch protein FliM [Shigella dysenteriae CDC
           74-1112]
 gi|320184483|gb|EFW59287.1| Flagellar motor switch protein FliM [Shigella flexneri CDC 796-83]
 gi|320191919|gb|EFW66566.1| Flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           EC1212]
 gi|320194342|gb|EFW68973.1| Flagellar motor switch protein FliM [Escherichia coli WV_060327]
 gi|320198635|gb|EFW73235.1| Flagellar motor switch protein FliM [Escherichia coli EC4100B]
 gi|320641793|gb|EFX11181.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           G5101]
 gi|320647152|gb|EFX15985.1| flagellar motor switch protein FliM [Escherichia coli O157:H- str.
           493-89]
 gi|320652436|gb|EFX20734.1| flagellar motor switch protein FliM [Escherichia coli O157:H- str.
           H 2687]
 gi|320658038|gb|EFX25800.1| flagellar motor switch protein FliM [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320658610|gb|EFX26304.1| flagellar motor switch protein FliM [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320668508|gb|EFX35335.1| flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323152724|gb|EFZ38996.1| flagellar motor switch protein FliM [Escherichia coli EPECa14]
 gi|323158576|gb|EFZ44590.1| flagellar motor switch protein FliM [Escherichia coli E128010]
 gi|323180802|gb|EFZ66342.1| flagellar motor switch protein FliM [Escherichia coli 1180]
 gi|323183929|gb|EFZ69316.1| flagellar motor switch protein FliM [Escherichia coli 1357]
 gi|323186821|gb|EFZ72141.1| flagellar motor switch protein FliM [Escherichia coli RN587/1]
 gi|323378178|gb|ADX50446.1| flagellar motor switch protein FliM [Escherichia coli KO11]
 gi|323937215|gb|EGB33495.1| flagellar motor switch protein FliM [Escherichia coli E1520]
 gi|323940396|gb|EGB36587.1| flagellar motor switch protein FliM [Escherichia coli E482]
 gi|323948351|gb|EGB44338.1| flagellar motor switch protein FliM [Escherichia coli H120]
 gi|323952438|gb|EGB48311.1| flagellar motor switch protein FliM [Escherichia coli H252]
 gi|323956341|gb|EGB52084.1| flagellar motor switch protein FliM [Escherichia coli H263]
 gi|323961989|gb|EGB57588.1| flagellar motor switch protein FliM [Escherichia coli H489]
 gi|323972755|gb|EGB67955.1| flagellar motor switch protein FliM [Escherichia coli TA007]
 gi|324005856|gb|EGB75075.1| flagellar motor switch protein FliM [Escherichia coli MS 57-2]
 gi|324013500|gb|EGB82719.1| flagellar motor switch protein FliM [Escherichia coli MS 60-1]
 gi|324018854|gb|EGB88073.1| flagellar motor switch protein FliM [Escherichia coli MS 117-3]
 gi|324118994|gb|EGC12883.1| flagellar motor switch protein FliM [Escherichia coli E1167]
 gi|326342355|gb|EGD66136.1| Flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           1044]
 gi|326344860|gb|EGD68607.1| Flagellar motor switch protein FliM [Escherichia coli O157:H7 str.
           1125]
 gi|330911751|gb|EGH40261.1| flagellar motor switch protein FliM [Escherichia coli AA86]
 gi|331056239|gb|EGI28248.1| flagellar motor switch protein FliM [Escherichia coli TA206]
 gi|331059240|gb|EGI31217.1| flagellar motor switch protein FliM [Escherichia coli TA143]
 gi|331063830|gb|EGI35741.1| flagellar motor switch protein FliM [Escherichia coli TA271]
 gi|331079712|gb|EGI50909.1| flagellar motor switch protein FliM [Escherichia coli H299]
 gi|332093098|gb|EGI98162.1| flagellar motor switch protein FliM [Shigella boydii 5216-82]
 gi|332096930|gb|EGJ01919.1| flagellar motor switch protein FliM [Shigella boydii 3594-74]
 gi|332343671|gb|AEE57005.1| flagellar motor switch protein FliM [Escherichia coli UMNK88]
          Length = 334

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 41/303 (13%), Positives = 94/303 (31%), Gaps = 10/303 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+       +   +    +   + +         +    DI+  +
Sbjct: 30  SGESDIRPYDPNTQRRVV------RERLQALEIINERFARHFRMGLFNLLRRSPDITVGA 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G       ++  
Sbjct: 84  IRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +                  +     N     N+ V   
Sbjct: 144 REFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVRSE-MQVKFTNITTSPNDIVVNT 202

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     + ++   + S N+ ++  D   R+     + + 
Sbjct: 203 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELV 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK G V+P         I   +G  + + + G +   Y +RI   
Sbjct: 263 ANFADISLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRIEHL 320

Query: 304 INF 306
           IN 
Sbjct: 321 INP 323


>gi|332095507|gb|EGJ00523.1| flagellar motor switch protein FliM [Shigella dysenteriae 155-74]
          Length = 334

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 41/303 (13%), Positives = 94/303 (31%), Gaps = 10/303 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+       +   +    +   + +         +    DI+  +
Sbjct: 30  SGESDIRPYDPNTQRRVV------RKRLQALEIINERFARHFRMGLFNLLRRSPDITVGA 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G       ++  
Sbjct: 84  IRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +                  +     N     N+ V   
Sbjct: 144 REFTHTEQRVINRMLKLALEGYSDAWKAINPLDVEYVRSE-MQVKFTNITTSPNDIVVNT 202

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     + ++   + S N+ ++  D   R+     + + 
Sbjct: 203 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELV 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK G V+P         I   +G  + + + G +   Y +RI   
Sbjct: 263 ANFADISLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRIEHL 320

Query: 304 INF 306
           IN 
Sbjct: 321 INP 323


>gi|320529422|ref|ZP_08030510.1| flagellar motor switch protein FliM [Selenomonas artemidis F0399]
 gi|320138388|gb|EFW30282.1| flagellar motor switch protein FliM [Selenomonas artemidis F0399]
          Length = 334

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 47/286 (16%), Positives = 95/286 (33%), Gaps = 8/286 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +    L   + + L       +   V+I   S +   +   + S     V    +
Sbjct: 49  SKDQIRTLFMLHESFSRLLNTYLSASLRTMVNIEVLSVEQMTYQEFVQSMANPSVIGIIA 108

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           L     N  I    ++    ++ + G   +  P + +R+L+ +E  + +R I  +     
Sbjct: 109 LPPLKGNIIIEVGPDIAFAYVDRVFGGEGK--PSVKSRALTDIESAVMRRFIDTVINYFR 166

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  S   E  PN E        +       ++ V  + ++M + +V     + IP   L 
Sbjct: 167 EAWSNVVEFRPNFETMET--NPQFAQIVPPSDMVVLVTIHMKLGDVEGMMNICIPYLVLE 224

Query: 208 KTTLISLSS----QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQ 263
                  +S     +     S D +    RK  +  V     +     T+ + +TL  G 
Sbjct: 225 PVMSKLTTSFWVASSVDRESSPDQVADLQRKIERTWVPFSVELGTVDITINEFLTLGFGD 284

Query: 264 VIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
           V+      K   +        +    G  GK   ++I+  I  D+ 
Sbjct: 285 VLQLDTLAKDELVCYVGTNAKFRAHPGTAGKRMAVQISGIIEGDED 330


>gi|194434971|ref|ZP_03067214.1| flagellar motor switch protein FliM [Shigella dysenteriae 1012]
 gi|194416806|gb|EDX32932.1| flagellar motor switch protein FliM [Shigella dysenteriae 1012]
          Length = 334

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 41/303 (13%), Positives = 94/303 (31%), Gaps = 10/303 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+       +   +    +   + +         +    DI+  +
Sbjct: 30  SGESDIRPYDPNTQRRVV------RERLQALEIINERFARHFRMGLFNLLRRSPDITVGA 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G       ++  
Sbjct: 84  IRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +                  +     N     N+ V   
Sbjct: 144 REFTHTEQRVINRMLKLALEGYSDAWKAINPLDVEYVRSE-MQVKFTNITTSPNDIVVNT 202

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     + ++   + S N+ ++  D   R+     + + 
Sbjct: 203 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELV 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK G V+P         I   +G  + + + G +   Y +RI   
Sbjct: 263 ANFADISLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRIEHL 320

Query: 304 INF 306
           IN 
Sbjct: 321 INP 323


>gi|146312182|ref|YP_001177256.1| flagellar motor switch protein FliM [Enterobacter sp. 638]
 gi|145319058|gb|ABP61205.1| flagellar motor switch protein FliM [Enterobacter sp. 638]
          Length = 334

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 37/301 (12%), Positives = 90/301 (29%), Gaps = 10/301 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
                P  P    R+       +   +    +   + +         +    DI+  + +
Sbjct: 32  EPEIRPYDPNTQRRVV------RERLQALEIINERFARQFRMGLFNLLRRSPDITVGAIR 85

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
              +     +       +   L           S +LV   ++NL G       ++  R 
Sbjct: 86  IQPYHEFARNLPVPTNLNLIHLKPLRGTGLFVFSPSLVFIAVDNLFGGDGRFPTKVEGRE 145

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E+++  R +       +                  +     N     N+ V     
Sbjct: 146 FTHTEQRVINRMLKLALESYSDAWKAIHPLEVEYVRSE-MQVKFTNITTSPNDIVVNTPF 204

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNIDTR 245
           ++ I N+   F + +P   +     + ++   + S N+ ++  +   R+     + +   
Sbjct: 205 HVEIGNLTGEFNICLPFSMIEPLREVLVNPPLENSRNEDQNWRENLVRQVQHSQLELVAS 264

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
                  L  ++ L+ G V+P         I   +   + + + G V   Y +R+   IN
Sbjct: 265 FADIPLRLSQILKLQPGDVLPIEKP--DRIIAHVDDVPVLTSQYGTVNGQYALRVEHLIN 322

Query: 306 F 306
            
Sbjct: 323 P 323


>gi|170769401|ref|ZP_02903854.1| flagellar motor switch protein FliM [Escherichia albertii TW07627]
 gi|170121725|gb|EDS90656.1| flagellar motor switch protein FliM [Escherichia albertii TW07627]
          Length = 334

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 41/303 (13%), Positives = 94/303 (31%), Gaps = 10/303 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+       +   +    +   + +         +    DI+  +
Sbjct: 30  STESDIRPYDPNTQQRVV------RERLQALEIINERFARHFRMGLFNLLRRSPDITVGA 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G       ++  
Sbjct: 84  IRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +         +        +     N     N+ V   
Sbjct: 144 REFTDTEQRVINRMLKLALEGYSDAWKAINPLNVEYVRSE-MQVKFTNITTSPNDIVVNT 202

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     + ++  Q  S N+ ++  D   R+     + + 
Sbjct: 203 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPQENSRNEDQNWRDNLVRQVQHSQLELV 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK   V+P         I   +G  + + + G +   Y +RI   
Sbjct: 263 ANFADISLRLSQILKLKPSDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRIEHL 320

Query: 304 INF 306
           IN 
Sbjct: 321 INP 323


>gi|320182738|gb|EFW57622.1| Flagellar motor switch protein FliM [Shigella boydii ATCC 9905]
          Length = 334

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 41/303 (13%), Positives = 94/303 (31%), Gaps = 10/303 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+       +   +    +   + +         +    DI+  +
Sbjct: 30  SGESDIRPYDPNTQRRVV------RERLQALEIINERFARHFRMGLFNLLRRSPDITVGA 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G       ++  
Sbjct: 84  IRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +                  +     N     N+ V   
Sbjct: 144 REFTHTEQRVINRMLKLALEGYSDAWKAINPLDVEYVRSE-MQVKFTNITTSPNDIVVNT 202

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     + ++   + S N+ ++  D   R+     + + 
Sbjct: 203 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELV 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK G V+P         I   +G  + + + G +   Y +RI   
Sbjct: 263 ANFADISLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRIEHL 320

Query: 304 INF 306
           IN 
Sbjct: 321 INP 323


>gi|167630301|ref|YP_001680800.1| flagellar motor switch protein flim [Heliobacterium modesticaldum
           Ice1]
 gi|167593041|gb|ABZ84789.1| flagellar motor switch protein flim [Heliobacterium modesticaldum
           Ice1]
          Length = 331

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 44/317 (13%), Positives = 102/317 (32%), Gaps = 9/317 (2%)

Query: 2   RGQSIHKNTSPLHPILLA--RLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVD 59
            GQ   ++        +            K        +   Y + L       +   V 
Sbjct: 19  SGQVTPEDVKDDLTSKIRVYDFKRPNKFSKDQIHTLQVIYENYCRSLTTYLAANLRTLVQ 78

Query: 60  ISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETI 119
           IS  S     +   I S     + +  ++S  + N  +    N+   +++ L G +    
Sbjct: 79  ISVQSLDQLTYEEFIRSIPNPTIVNIFTMSPLNGNGIMEIHPNIAFAVIDRLFGGTGNPP 138

Query: 120 PQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNE 179
            ++  R L+ +E+ + +RT  ++     +      +    LE        +        E
Sbjct: 139 DKI--RGLTEIEQSVFQRTTRRMLDSFTEAWDNIAQVKARLEMIET--NPQFIQIVAPTE 194

Query: 180 FVTTINMNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTY 236
            V  I +   I +V     + +P   L              N ++ ++ + ++    +  
Sbjct: 195 MVVVITLACKIGDVEGMINICLPYILLEPIISKLSAHFWFSNAAKERTTEQLEALRNRLE 254

Query: 237 QLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNY 296
           +  V I   +     ++ +++ L++G VI   +R  +   +    +  Y    G  G   
Sbjct: 255 RALVPITVLLGRTTLSVSELLDLQLGDVIQLDNRADSELEVLIGQRVKYLARPGLSGSKL 314

Query: 297 TIRITDRINFDQKSLKN 313
            I+IT       ++   
Sbjct: 315 GIQITATYEKGVETDDE 331


>gi|238794009|ref|ZP_04637627.1| Flagellar motor switch protein fliM [Yersinia intermedia ATCC
           29909]
 gi|238726641|gb|EEQ18177.1| Flagellar motor switch protein fliM [Yersinia intermedia ATCC
           29909]
          Length = 334

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 36/301 (11%), Positives = 89/301 (29%), Gaps = 10/301 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
             +  P  P    R+       +   +    +   + +         +    DI+    +
Sbjct: 31  ETDVKPYDPTTQRRVV------RERLQALEIINERFARQFRMGLFNLLRRSPDITVGPIK 84

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
              +     +       +   L           + +LV   ++NL G       ++  R 
Sbjct: 85  IQPYHDFARNLPVPTNLNLIHLKPLRGTALFVFAPSLVFIAVDNLFGGDGRFPTKVEGRE 144

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E+++  R +           +   +          I     N     N+ V T   
Sbjct: 145 FTHTEQRVINRMLRLALDAYRDAWAPIYKIDVEYVRSE-IQVKFTNITTSPNDIVVTTPF 203

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNIDTR 245
           ++ I  ++  F + IP   +     +  +   + S  +     +   ++     + +   
Sbjct: 204 HVEIGALSGEFNICIPFAMIEPLRELLTNPPLENSRQEDSHWRETLVKQVQHSELELVAN 263

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
                  L  ++ L+ G V+P         I   +G  + + + G +   Y +R+   IN
Sbjct: 264 FVDIPLRLSQILKLQPGDVLPIDKP--DRLIAHVDGVPVLTSQYGTLNGQYALRVEHLIN 321

Query: 306 F 306
            
Sbjct: 322 P 322


>gi|120598257|ref|YP_962831.1| flagellar motor switch protein FliM [Shewanella sp. W3-18-1]
 gi|146293665|ref|YP_001184089.1| flagellar motor switch protein FliM [Shewanella putrefaciens CN-32]
 gi|120558350|gb|ABM24277.1| flagellar motor switch protein FliM [Shewanella sp. W3-18-1]
 gi|145565355|gb|ABP76290.1| flagellar motor switch protein FliM [Shewanella putrefaciens CN-32]
 gi|319427064|gb|ADV55138.1| flagellar motor switch protein FliM [Shewanella putrefaciens 200]
          Length = 343

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 41/305 (13%), Positives = 94/305 (30%), Gaps = 11/305 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           +  ++          R+                +   + + L       M    ++S   
Sbjct: 28  AASQDARSYDFSSQDRIVRG------RMPTLEIVNERFARHLRISMFNMMRRAAEVSING 81

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            Q  KF   +H+       +    S       I     LV  L++N  G       ++  
Sbjct: 82  VQMLKFGEYVHTLFVPTSLNMVRFSPLKGTALITMEARLVFILVDNFFGGDGRFHAKIEG 141

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++ +  +  I        +   +     +                 E V   
Sbjct: 142 REFTPTERRIVQLLLKIIFEDYKDAWAPVMDVE--FDYLDSEVNPAMANIVSPTEVVVIN 199

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNID 243
           + ++ ++     F + +P   +     +  +  Q+  ++           +   + V  D
Sbjct: 200 SFHIEVDGGGGDFHITMPYSMIEPIRELLDAGVQSDKQDTDMRWSQALHDEIMDVKVGFD 259

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
             +   + TLKDV+  K G +IP         ++       Y C++GR   N  ++I ++
Sbjct: 260 ACVVEHELTLKDVMNFKAGDIIPVELP--EYIMMKIEDLPTYRCKMGRSRDNLALKIYEK 317

Query: 304 INFDQ 308
           I   +
Sbjct: 318 IPRPE 322


>gi|138894751|ref|YP_001125204.1| flagellar motor switch protein FliM [Geobacillus
           thermodenitrificans NG80-2]
 gi|196247627|ref|ZP_03146329.1| flagellar motor switch protein FliM [Geobacillus sp. G11MC16]
 gi|134266264|gb|ABO66459.1| Flagellar motor switch protein [Geobacillus thermodenitrificans
           NG80-2]
 gi|196212411|gb|EDY07168.1| flagellar motor switch protein FliM [Geobacillus sp. G11MC16]
          Length = 334

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 40/289 (13%), Positives = 98/289 (33%), Gaps = 7/289 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +  + +   + + L   F  ++   V IS  S     +   + S  +  + +   
Sbjct: 50  SKDQIRSLTRIHENFARLLTTFFSAQLRTYVQISVASADQIPYEEFVRSIPKMTIINVFE 109

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +     +  +  + N+   +L+ ++G    ++ ++ +  L+ +E ++      +  A   
Sbjct: 110 VPPLDGHVLLEVNPNIAYAMLDRVMGGRGASMDKVEH--LTEIETRIMSSLFDKAFAHWR 167

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
               +  E  P   DF      +       N+ V  I++N  I        + IP   L 
Sbjct: 168 DAWESVAEVDPLFVDFEV--NPQFLRMIAPNDTVVVISLNTQIGEARGMMNVCIPHVVLE 225

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                       Q + + +S +      R+     + I   +     T+ + + L++G V
Sbjct: 226 PIMPRLSVHYWMQAQKKERSPEEAGRIERRIRAAQLPIVAELGTAVVTVGEFLQLEVGDV 285

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKN 313
           I          ++       +  + G+  K   ++I   I   ++S   
Sbjct: 286 IQLKQSIHEPLVVKIGHIPKFIGQPGKRNKKLAVQILAMIEGGEESYDE 334


>gi|317492415|ref|ZP_07950844.1| flagellar motor switch protein FliM [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316919754|gb|EFV41084.1| flagellar motor switch protein FliM [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 337

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 40/302 (13%), Positives = 98/302 (32%), Gaps = 10/302 (3%)

Query: 6   IHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSC 65
              +  P  P    R+       +   +    +   + +         +    DI+  + 
Sbjct: 33  SESDVRPYDPTTQRRVV------RERLQALEIINERFARQFRMGLFNLLRRSPDITVGAV 86

Query: 66  QSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNR 125
           +   +     +       +   L+       +  + +LV   ++NL G       ++  R
Sbjct: 87  KIQPYHEFARNLPVPTNLNLIHLNPLRGTALMVFAPSLVFMAVDNLFGGDGRFPTKVDGR 146

Query: 126 SLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTIN 185
             +  E+++ KR +           S   +          I     N     N+ V T  
Sbjct: 147 EFTHTEQRVIKRMLRLALDAYRDAWSAIYKLEVEYVRSE-IQVKFTNITTSPNDIVVTTP 205

Query: 186 MNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNIDT 244
             + +  ++  F + IP   +     + ++   + S+ + +   D  +++     + +  
Sbjct: 206 FTVEVGALSGEFNICIPFSMIEPLRELLVNPPLENSKQEDQHWRDTLSKQVQHSELELVA 265

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
                   L +V+ L+ G V+P         I + +G  + +C+ G     Y +R+   I
Sbjct: 266 NFVDIPLRLSEVLKLQPGDVLPIEKP--EKLIANVDGVPVLTCQYGSQNGQYALRVERLI 323

Query: 305 NF 306
           N 
Sbjct: 324 NP 325


>gi|149188092|ref|ZP_01866387.1| flagellar motor switch protein M [Vibrio shilonii AK1]
 gi|148838080|gb|EDL55022.1| flagellar motor switch protein M [Vibrio shilonii AK1]
          Length = 349

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 36/301 (11%), Positives = 91/301 (30%), Gaps = 11/301 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +          R+                +   + + +       +    ++S    Q  
Sbjct: 33  DVVHFDFSSQDRIVRG------RMPTLELINERFARHMRISLFNMLRKTAEVSINGVQMM 86

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           KF    ++       +            I     LV  L+EN  G       ++  R  +
Sbjct: 87  KFGEYQNTLYVPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRFHAKIEGREFT 146

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++ +  +  +     +  S         E                 E +   + ++
Sbjct: 147 PTERRIIQLLMKTVFEDYKEAWSPVMGVE--FEYLDSEVNPSMANIVSPTEVIVVSSFHI 204

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            ++     F +++P   +     +  +  Q+               +   + VN    + 
Sbjct: 205 EVDGGGGDFHVVMPYSMVEPIRELLDAGVQSDKMETDVRWSSALREEIMDVPVNFRVNLL 264

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
            K  +L+D++ L+ G +IP    E   A +       +  ++GR G+   ++I+++I   
Sbjct: 265 EKDVSLRDLMELQAGDIIPIDMPEN--ATMFVEELPTFRVKMGRTGEKVAVQISEKIRRP 322

Query: 308 Q 308
            
Sbjct: 323 D 323


>gi|170725980|ref|YP_001760006.1| flagellar motor switch protein FliM [Shewanella woodyi ATCC 51908]
 gi|169811327|gb|ACA85911.1| flagellar motor switch protein FliM [Shewanella woodyi ATCC 51908]
          Length = 342

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 43/297 (14%), Positives = 94/297 (31%), Gaps = 11/297 (3%)

Query: 13  LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSH 72
                  R+                +   + + L       M    ++S    Q  KF  
Sbjct: 35  YDFSSQDRIVRG------RMPTLEIVNERFARHLRISMFNMMRRAAEVSINGVQMLKFGE 88

Query: 73  IIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEK 132
            +H+       +    +       I     LV  L++N  G       ++  R  +  E+
Sbjct: 89  YVHTLFVPTSLNMVRFNPLKGTALITMEARLVFILVDNFFGGDGRFHAKIEGREFTPTER 148

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
           ++ +  +  I        +   +     +                 E V   + ++ ++ 
Sbjct: 149 RIVQLLLKIIFEDYKDAWAPVMDVE--FDYLDSEVNPAMANIVSPTEVVVISSFHIEVDG 206

Query: 193 VASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
               F + +P   +     +  +  Q+ +++           +   +NV +D  +   + 
Sbjct: 207 GGGDFHITMPYSMIEPIRELLDAGVQSDTQDTDMRWSQALKDEIMDVNVGLDATVVEHQI 266

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
           TLKDV+ LK G +IP         IL       + C+LG+   N  +R+  +I   +
Sbjct: 267 TLKDVMELKQGDIIPVELP--EHIILRVEDLPTFRCKLGKARDNLALRVIQKIPRPE 321


>gi|296103565|ref|YP_003613711.1| flagellar motor switch protein FliM [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295058024|gb|ADF62762.1| flagellar motor switch protein FliM [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 334

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 36/301 (11%), Positives = 93/301 (30%), Gaps = 10/301 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
             +  P  P    R+       +   +    +   + +         +    DI+  + +
Sbjct: 32  DSDIRPYDPNTQRRVV------RERLQALEIINERFARQFRMGLFNLLRRSPDITVGAIR 85

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
              +     +       +   L        +  S +LV   ++NL G       ++  R 
Sbjct: 86  IQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEGRE 145

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E+++  R +       +                  +     N     N+ V     
Sbjct: 146 FTHTEQRVINRMLKLALESYSDAWKAINPLEVEYVRSE-MQVKFTNITTSPNDIVVNTPF 204

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNIDTR 245
           ++ I N+   F + +P   +     + ++   + S ++ ++  +   R+     + +   
Sbjct: 205 HVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRHEDQNWRENLVRQVQHSQLELVAS 264

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
                  L  ++ L+ G V+P         I   +G  + + + G +   Y +R+   IN
Sbjct: 265 FADIPLRLSQILKLQPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTINGQYALRVEHLIN 322

Query: 306 F 306
            
Sbjct: 323 P 323


>gi|294140210|ref|YP_003556188.1| flagellar motor switch protein FliM [Shewanella violacea DSS12]
 gi|293326679|dbj|BAJ01410.1| flagellar motor switch protein FliM [Shewanella violacea DSS12]
          Length = 343

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 47/297 (15%), Positives = 96/297 (32%), Gaps = 11/297 (3%)

Query: 13  LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSH 72
                  R+                +   + + L       M    ++S    Q  KF  
Sbjct: 36  YDFSSQDRIVRG------RMPTLEIVNERFARHLRISMFNMMRRAAEVSINGVQMLKFGE 89

Query: 73  IIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEK 132
            +H+       +    S       I     LV  L++N  G       ++  R  +  E+
Sbjct: 90  YVHTLFVPTSLNMVRFSPLKGTGLITMEARLVFILVDNFFGGDGRFHAKIEGREFTPTER 149

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
           ++ +  +  I        +   +     E                 E V   + ++ ++ 
Sbjct: 150 RIVQLLLKIIFEDYKDAWAPVMDVE--FEYLDSEVNPAMANIVSPTEVVVVSSFHIEVDG 207

Query: 193 VASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
               F + +P   +     +  +  Q+ +++           +   ++V ID  I  ++ 
Sbjct: 208 GGGDFHITMPYSMIEPIRELLDAGVQSDTQDTDMRWSLALKDEIMDIDVGIDATIVEQQI 267

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
           TLKDV+  K G +IP         +L       Y C+LG+   N  +RIT++I   +
Sbjct: 268 TLKDVMEFKAGDIIPVELP--EHIVLRVEDLPTYRCKLGKTRDNLALRITEKIPRPE 322


>gi|193066386|ref|ZP_03047434.1| flagellar motor switch protein FliM [Escherichia coli E22]
 gi|192925971|gb|EDV80617.1| flagellar motor switch protein FliM [Escherichia coli E22]
          Length = 334

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 41/303 (13%), Positives = 94/303 (31%), Gaps = 10/303 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+       +   +    +   + +         +    DI+  +
Sbjct: 30  SGESDIRPYDPNTQRRVV------RERLQALEIINERFARHFRMGLFNLLRRSPDITVGA 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G       ++  
Sbjct: 84  IRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +                  +     N     N+ V   
Sbjct: 144 REFTHTEQRVINRMLKLALEGYSDAWKALNPLEVEYVRSE-MQVKFTNITTSPNDIVVNT 202

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     + ++   + S N+ ++  D   R+     + + 
Sbjct: 203 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELV 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK G V+P         I   +G  + + + G +   Y +RI   
Sbjct: 263 ANFADISLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRIEHL 320

Query: 304 INF 306
           IN 
Sbjct: 321 INP 323


>gi|15802380|ref|NP_288406.1| flagellar motor switch protein FliM [Escherichia coli O157:H7
           EDL933]
 gi|12516052|gb|AAG56960.1|AE005417_2 flagellar biosynthesis, component of motor switch and energizing,
           enabling rotation and determining its direction
           [Escherichia coli O157:H7 str. EDL933]
          Length = 334

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 41/303 (13%), Positives = 93/303 (30%), Gaps = 10/303 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+       +   +    +   + +         +    DI+   
Sbjct: 30  SGESDIRPYDPNTQRRVV------RERLQALEIINERFARHFRMGLFNLLRRSPDITVGX 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G       ++  
Sbjct: 84  IRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +                  +     N     N+ V   
Sbjct: 144 REFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVRSE-MQVKFTNITTSPNDIVVNT 202

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     + ++   + S N+ ++  D   R+     + + 
Sbjct: 203 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELV 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK G V+P         I   +G  + + + G +   Y +RI   
Sbjct: 263 ANFADISLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRIEHL 320

Query: 304 INF 306
           IN 
Sbjct: 321 INP 323


>gi|291617855|ref|YP_003520597.1| FliM [Pantoea ananatis LMG 20103]
 gi|291152885|gb|ADD77469.1| FliM [Pantoea ananatis LMG 20103]
 gi|327394272|dbj|BAK11694.1| flagellar motor switch protein FliM [Pantoea ananatis AJ13355]
          Length = 335

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 40/306 (13%), Positives = 92/306 (30%), Gaps = 10/306 (3%)

Query: 2   RGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDIS 61
           +      +  P  P    R+       +   +    +   + +         +    DIS
Sbjct: 27  KQNGPEGDIRPYDPNTQRRVV------RERLQALEIINERFARSFRMALFNLLRRSPDIS 80

Query: 62  YTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQ 121
             + +   +     +       +   L        +  S +LV   ++NL G       +
Sbjct: 81  VGAIKIQPYHEFARNLPVPTNLNLIHLKPLRGTALVVFSPSLVFIAVDNLFGGDGRFPTK 140

Query: 122 LYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFV 181
           +  R  +  E+++ +R +       +                  +     N     N+ V
Sbjct: 141 VEGREFTHTEQRVIRRMLKLALDGYSDAWKAIYPLDVEYVRSE-MQVKFTNITTSPNDIV 199

Query: 182 TTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNV 240
                 + I N+   F + IP   +     + ++   + S ++     D   ++     +
Sbjct: 200 VNTPFQVEIGNLVGEFNICIPFSMIEPLREMLVNPPLENSRSEDTHWRDNLVKQVQHSEL 259

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            +          L  V+ LK G V+P         I   +G  + + + G +   Y +R+
Sbjct: 260 ELIAHFAETSLRLSRVLQLKPGDVLPIEKP--ERIIAHVDGVPVLTSQYGTLNGQYALRV 317

Query: 301 TDRINF 306
              IN 
Sbjct: 318 EHLINP 323


>gi|328948403|ref|YP_004365740.1| flagellar motor switch protein FliM [Treponema succinifaciens DSM
           2489]
 gi|328448727|gb|AEB14443.1| flagellar motor switch protein FliM [Treponema succinifaciens DSM
           2489]
          Length = 344

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 49/314 (15%), Positives = 113/314 (35%), Gaps = 10/314 (3%)

Query: 2   RGQSIHKNTSPLHP---ILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDV 58
            G+S      P+     I +          K   +  S++   + +        ++   V
Sbjct: 19  TGESEADEFKPVTDTRRIKIYDFRRPDKFSKEQIRTVSNMHETFARLTTTSLSAQLRTLV 78

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
            +   S     +   I S       +  ++     N  +  +  +   +++ L G S +T
Sbjct: 79  HVHVASVDQLTYEEFIRSIPTPTTLAVINMDPLKGNAVLEIAPEITFIIIDRLFGGSGDT 138

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSN 178
             ++ NR L+ +E+ + +  I +I A + +  +   +  P L+        +       +
Sbjct: 139 GGKV-NRDLTDIEQSVMEGIIVRILANMREAWTQVIDLRPRLQQIET--NPQFAQIVPPS 195

Query: 179 EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKT 235
           E V  + + + I   A    + IP  T+              +   + +   +     K 
Sbjct: 196 EMVILVTLEIKIGEEAGMMNICIPYITIEPIVSKLSSSFWFSSVRRSSTTQYLGTLKEKL 255

Query: 236 YQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLH-REKTCAILSANGKEIYSCELGRVGK 294
             + + +   I      ++DV++L+ G VI     +      LS   K+ + C+ G VGK
Sbjct: 256 ADVEMELVADIGSINVPIRDVLSLRTGDVIRLNTIKVGEPLTLSVGSKKKFYCQPGVVGK 315

Query: 295 NYTIRITDRINFDQ 308
              ++I ++I+  +
Sbjct: 316 KVAVQIIEKIDEQE 329


>gi|238798578|ref|ZP_04642055.1| Flagellar motor switch protein fliM [Yersinia mollaretii ATCC
           43969]
 gi|238717598|gb|EEQ09437.1| Flagellar motor switch protein fliM [Yersinia mollaretii ATCC
           43969]
          Length = 334

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 36/301 (11%), Positives = 88/301 (29%), Gaps = 10/301 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
             +  P  P    R+       +        +   + +         +    DI+    +
Sbjct: 31  ETDVKPYDPTTQRRVV------RERLHALEIINERFARQFRMGLFNLLRRSPDITVGPIK 84

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
              +     +       +   L           + +LV   ++NL G       ++  R 
Sbjct: 85  IQPYHDFARNLPVPTNLNLIHLKPLRGTALFVFAPSLVFIAVDNLFGGDGRFPTKVEGRE 144

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E+++  R +           +   +          I     N     N+ V T   
Sbjct: 145 FTHTEQRVINRMLRLALDAYRDAWAPIYKIDVEYVRSE-IQVKFTNITTSPNDIVVTTPF 203

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNIDTR 245
           ++ I  ++  F + IP   +     +  +   + S  +     +   ++     + +   
Sbjct: 204 HVEIGALSGEFNICIPFAMIEPLRELLTNPPLENSRQEDSHWRETLVKQVQHSELELVAN 263

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
                  L  ++ L+ G V+P         I   +G  + + + G +   Y +R+   IN
Sbjct: 264 FVDIPLRLSQILKLQPGDVLPIDKP--DRLIAHVDGVPVLTSQYGTLNGQYALRVEHLIN 321

Query: 306 F 306
            
Sbjct: 322 P 322


>gi|154686048|ref|YP_001421209.1| flagellar motor switch protein FliM [Bacillus amyloliquefaciens
           FZB42]
 gi|154351899|gb|ABS73978.1| FliM [Bacillus amyloliquefaciens FZB42]
          Length = 332

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 39/286 (13%), Positives = 93/286 (32%), Gaps = 8/286 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +  + +   + + L   F  K+   + IS +S     +   I S     + +   
Sbjct: 49  SKDQIRSLTRIHDNFARLLTTHFSAKLRTYIHISVSSVDQVPYEEFIRSIPNMTILNLFD 108

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +        +  +  +   +L+ ++G    T  +  +  L+ +E  +             
Sbjct: 109 VHPMEGRIMMEVNPTIAYAMLDRVMGGIGITHNKADS--LTEIETNIISNLFENALGNYK 166

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +   +  +  P  E        +       NE V  I++N  I  ++    L IP   L 
Sbjct: 167 EAWQSIADIDP--EMTEFEVNPQFVQMVSPNETVVVISLNTQIGEISGVINLCIPHVVLE 224

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                       Q+       +      ++     + +   +   + T+++ ++L++G  
Sbjct: 225 PIIPKLSVHYWMQSDRNEAKPEETKLLEKRIMTAQIPVVALLGASELTIEEFLSLEVGDC 284

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR-INFDQK 309
           I           +    K  +  + GRV +   ++I D  I  +Q 
Sbjct: 285 ITLDKSVTDPLTVLVGNKPKFLGQAGRVNRRQAVQILDHDIRGEQD 330


>gi|300717238|ref|YP_003742041.1| flagellar motor switch protein [Erwinia billingiae Eb661]
 gi|299063074|emb|CAX60194.1| Flagellar motor switch protein [Erwinia billingiae Eb661]
          Length = 335

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 38/301 (12%), Positives = 93/301 (30%), Gaps = 10/301 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
             +  P  P    R+       +   +    +   + +         +    DI+  + +
Sbjct: 32  DNDIRPYDPNTQRRMV------RERLQALEIINERFARSYRMALFNLLRRSPDITVGAIK 85

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
              +     +       +   L        +  S +LV   ++NL G       ++  R 
Sbjct: 86  IQPYHEFARNLPVPTNLNLIHLKPLRGTALVVFSPSLVFIAVDNLFGGDGRFPTKVEGRE 145

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E+++ +R +       ++                 +     N     N+ V T   
Sbjct: 146 FTATEQRVIRRMLKLALEGYSEAWKPIYPLDVEYVRSE-MQVKFTNITTSPNDIVITTPF 204

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNIDTR 245
            + I N+   F + IP   +       ++   + S  + ++  D   ++     + +   
Sbjct: 205 QVEIGNLVGEFNICIPFSMIEPLRETLVNPPLENSRQEDQNWRDTLVKQVQHSELELIAN 264

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
                  +  ++ LK G V+P         I   +G  + + + G +   Y +R+   IN
Sbjct: 265 FGEVSMRISRLLALKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRVEHLIN 322

Query: 306 F 306
            
Sbjct: 323 P 323


>gi|254506968|ref|ZP_05119107.1| flagellar motor switch protein FliM [Vibrio parahaemolyticus 16]
 gi|219550253|gb|EED27239.1| flagellar motor switch protein FliM [Vibrio parahaemolyticus 16]
          Length = 349

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 34/305 (11%), Positives = 90/305 (29%), Gaps = 11/305 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           +   +          R+                +   + + +       +    ++S   
Sbjct: 29  ASDSSAVDFDFSSQDRIVRG------RMPTLELINERFARHMRISLFNMLRKTAEVSING 82

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            Q  KF    ++       +            I     LV  L+EN  G       ++  
Sbjct: 83  VQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRFHARIEG 142

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++ +  +  +     +  S         E                 E +   
Sbjct: 143 REFTPTERRIVQLLLKIVFEDYKEAWSPVMGVE--FEYLDSEVNPSMANIVSPTEVIVVS 200

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNID 243
           + ++ ++     F +++P   +     +  +  Q+               +   + VN  
Sbjct: 201 SFHIEVDGGGGDFHVVMPYSMVEPIRELLDAGVQSDKMETDVRWSTALREEIMDVPVNFR 260

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
             +  +  +L+D++ L+ G +IP        A +       Y  ++GR G    ++++++
Sbjct: 261 VNLLEQDISLRDLMELRPGDIIPISMP--EHATMFVEELPTYRVKMGRSGDKLAVQVSEK 318

Query: 304 INFDQ 308
           I    
Sbjct: 319 IKRPD 323


>gi|218133674|ref|ZP_03462478.1| hypothetical protein BACPEC_01543 [Bacteroides pectinophilus ATCC
           43243]
 gi|217991049|gb|EEC57055.1| hypothetical protein BACPEC_01543 [Bacteroides pectinophilus ATCC
           43243]
          Length = 327

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 40/293 (13%), Positives = 98/293 (33%), Gaps = 7/293 (2%)

Query: 20  RLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKE 79
                    K   +    +   + + L       +   V +   + +   +S   ++   
Sbjct: 39  DFARPSKFSKEHLRTLEIIFEHFGRLLATNLPGYLRKTVSVDVVNSEVVIYSEFSNALSN 98

Query: 80  NFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTI 139
             +    ++     N  +  ++NL   +++ LLG S  T+ +   R  S +E  + +R  
Sbjct: 99  PVLLGVVTMPPLKGNIIMEMASNLGYAIIDRLLGGSGNTMDK--ARDFSEIELTILERIF 156

Query: 140 AQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVL 199
                +L +      ++SP LE        +       +E +  + +++ I  V     +
Sbjct: 157 TICVNLLQEPWQNVVQTSPRLERIET--NSQFAQIISPSETIAIVTLSIKIGEVEGLMNI 214

Query: 200 IIPQETLLKTTLIS---LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDV 256
            +P  TL                 +   +   D       +  + +   +   + ++ D 
Sbjct: 215 CLPFVTLEPVMDKLNTKYWFSTLQDKDDQSYQDAIESLIDRAQIPMKAVLGHSRISVGDF 274

Query: 257 VTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
           V L++G +I    +      +     + ++   G     Y IRIT+ I  + +
Sbjct: 275 VNLQLGDIIRLDRKVDDELEVYVGNIKKFAALPGYSEDKYAIRITEVIKEESE 327


>gi|30063384|ref|NP_837555.1| flagellar motor switch protein FliM [Shigella flexneri 2a str.
           2457T]
 gi|56480007|ref|NP_707830.2| flagellar motor switch protein FliM [Shigella flexneri 2a str. 301]
 gi|30041636|gb|AAP17364.1| flagellar motor switch protein FliM [Shigella flexneri 2a str.
           2457T]
 gi|56383558|gb|AAN43537.2| flagellar motor switch protein FliM [Shigella flexneri 2a str. 301]
 gi|313650167|gb|EFS14580.1| flagellar motor switch protein FliM [Shigella flexneri 2a str.
           2457T]
 gi|332757511|gb|EGJ87846.1| flagellar motor switch protein FliM [Shigella flexneri K-671]
 gi|333017577|gb|EGK36889.1| flagellar motor switch protein FliM [Shigella flexneri K-304]
          Length = 334

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 41/303 (13%), Positives = 94/303 (31%), Gaps = 10/303 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+       +   +    +   + +         +    DI+  +
Sbjct: 30  SGESDIRPYDPNTQRRVV------RERLQALEIINERFARHFRMGLFNLLRRSPDITVGA 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G       ++  
Sbjct: 84  IRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +                  +     N     N+ V   
Sbjct: 144 REFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVRSE-MQVEFTNITTSPNDIVVNT 202

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     + ++   + S N+ ++  D   R+     + + 
Sbjct: 203 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELV 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK G V+P         I   +G  + + + G +   Y +RI   
Sbjct: 263 ANFADISLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRIEHL 320

Query: 304 INF 306
           IN 
Sbjct: 321 INP 323


>gi|127512304|ref|YP_001093501.1| flagellar motor switch protein FliM [Shewanella loihica PV-4]
 gi|126637599|gb|ABO23242.1| flagellar motor switch protein FliM [Shewanella loihica PV-4]
          Length = 341

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 44/304 (14%), Positives = 98/304 (32%), Gaps = 5/304 (1%)

Query: 6   IHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSC 65
             +  S          + +    +        +   + + L       M    ++S    
Sbjct: 21  EEEEVSDALDARAYDFSSQDRIVRGRMPTLEIVNERFARHLRISMFNMMRRAAEVSINGV 80

Query: 66  QSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNR 125
           Q  KF   +H+       +    S       I     LV  L++N  G       ++  R
Sbjct: 81  QMLKFGEYVHTLFVPTSLNMVRFSPLKGTALITMEARLVFILVDNFFGGDGRFHAKIEGR 140

Query: 126 SLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTIN 185
             +  E+++ +  +  I     +  +   +     +                 E V   +
Sbjct: 141 EFTPTERRIVQLLLKIIFEDYKEAWAPVMDVE--FDYLDSEVNPAMANIVSPTEVVVVSS 198

Query: 186 MNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDT 244
            ++ ++     F + +P   +     +  +  Q+ +++           +   + V +D 
Sbjct: 199 FHIEVDGGGGDFHITMPYSMIEPIRELLDAGVQSDTQDTDMRWSQALKDEIMDVEVGLDA 258

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
            I  K+ +LKDV+  K G +IP         +L       Y C+LGR  +N  + I ++I
Sbjct: 259 TIVEKEISLKDVMGFKAGDIIPVEMP--EYIVLRVEDLPTYRCKLGRSRENLALNIREKI 316

Query: 305 NFDQ 308
              +
Sbjct: 317 PRPE 320


>gi|332756101|gb|EGJ86454.1| flagellar motor switch protein FliM [Shigella flexneri 4343-70]
 gi|332757253|gb|EGJ87590.1| flagellar motor switch protein FliM [Shigella flexneri 2747-71]
 gi|332766683|gb|EGJ96887.1| flagellar motor switch protein FliM [Shigella flexneri 2930-71]
 gi|333003346|gb|EGK22892.1| flagellar motor switch protein FliM [Shigella flexneri K-218]
          Length = 334

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 41/303 (13%), Positives = 94/303 (31%), Gaps = 10/303 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+       +   +    +   + +         +    DI+  +
Sbjct: 30  SGESDIRPYDPNTQRRVV------RERLQALEIINERFARHFRMGLFNLLRRSPDITVGA 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G       ++  
Sbjct: 84  IRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +                  +     N     N+ V   
Sbjct: 144 REFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVRSE-MQVEFTNITTSPNDIVVNT 202

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     + ++   + S N+ ++  D   R+     + + 
Sbjct: 203 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELV 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK G V+P         I   +G  + + + G +   Y +RI   
Sbjct: 263 ANFADISLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRIEHL 320

Query: 304 INF 306
           IN 
Sbjct: 321 INP 323


>gi|121596087|ref|YP_987983.1| flagellar motor switch protein FliM [Acidovorax sp. JS42]
 gi|222112243|ref|YP_002554507.1| flagellar motor switch protein flim [Acidovorax ebreus TPSY]
 gi|120608167|gb|ABM43907.1| flagellar motor switch protein FliM [Acidovorax sp. JS42]
 gi|221731687|gb|ACM34507.1| flagellar motor switch protein FliM [Acidovorax ebreus TPSY]
          Length = 334

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 39/300 (13%), Positives = 93/300 (31%), Gaps = 11/300 (3%)

Query: 10  TSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGK 69
                     R+                +   + +         +    +IS  +    +
Sbjct: 35  VRNYDISSQERIVRG------RMPTMEIVNERFARNFRIGLFNFIRRSPEISVGTVSVQR 88

Query: 70  FSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLST 129
           +S  +        F+  ++     +  + C  +LV  +++ L G   +   ++  R  S 
Sbjct: 89  YSAFLRELVVPTNFNIVAIRPLRGSGLVVCEPSLVFGIIDTLYGGVGKFQTRIEGRDFSA 148

Query: 130 VEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMT 189
            E+++  R +  I A   +            +        +       +E V +    + 
Sbjct: 149 TEQRVINRLVDVICAEYKKAWQGIYPLELAYQRSEM--QPQFANIATPSEIVVSTAFQLE 206

Query: 190 IENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINL 248
           I ++A +  + +P  TL     +   S Q  +       +    R+     V +   +  
Sbjct: 207 IGDLAGAIHICMPYATLEPIRDVLYSSVQGDAIEVDRRWVRVLTREIQAAEVTLVAELAR 266

Query: 249 KKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
              T++ ++ +K G  I            S  G  ++ C+ G     Y IRI + +   +
Sbjct: 267 ADATVEQLLAMKPGDFIELEREP--RIRASIEGVPVFECQYGTHNSKYAIRIEECLRGAE 324


>gi|121997289|ref|YP_001002076.1| flagellar motor switch protein FliM [Halorhodospira halophila SL1]
 gi|121588694|gb|ABM61274.1| flagellar motor switch protein FliM [Halorhodospira halophila SL1]
          Length = 381

 Score =  243 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 36/302 (11%), Positives = 92/302 (30%), Gaps = 11/302 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
              P       R+                +   + +         +    ++S T  +  
Sbjct: 34  ELRPYTFTAEERIVRG------RMPTLEMINERFGRLFRIGLFNMLRRTPEVSVTGVEMM 87

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           KF   +H+       +   +     +        LV  +++N  G       ++  R  +
Sbjct: 88  KFGEYVHTLFVPTSLNIIRVPPLRGSGLFVIDPKLVFLVVDNFFGGGGHFYLKVEGREFT 147

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++ +  + Q    L +  +         E        +        E V     ++
Sbjct: 148 PTEQRVIRLMLDQAFDDLREAWNPVLGVD--FEYVNMEVNPQFANIVSPTEVVVVSKFHV 205

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            ++       + +P   +     I  +  Q+   +  +        +     V + + + 
Sbjct: 206 ELDGGGGDIHVTLPYTMVEPIREILDAGVQSDRNDVDDRWAKALREEMKTAPVTLHSTLA 265

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
             + TL+D++ LK G VIP    E+    +      ++    G    N  +RI +++   
Sbjct: 266 RSEITLRDLMHLKAGDVIPIEMPERVVVEVEE--VPVFYGTYGVCEGNAALRIDEKVQAP 323

Query: 308 QK 309
           ++
Sbjct: 324 ER 325


>gi|332140589|ref|YP_004426327.1| flagellar motor switch protein FliM [Alteromonas macleodii str.
           'Deep ecotype']
 gi|327550611|gb|AEA97329.1| flagellar motor switch protein FliM [Alteromonas macleodii str.
           'Deep ecotype']
          Length = 352

 Score =  243 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 41/300 (13%), Positives = 90/300 (30%), Gaps = 11/300 (3%)

Query: 6   IHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSC 65
              +T         R+                +   + + +       M    ++S    
Sbjct: 30  SDASTLEYDFSSQDRIVRG------RMPTLEIVNERFARHMRVSLFNMMRRSAEVSINGI 83

Query: 66  QSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNR 125
           Q  KF   IH+       +            I     LV  L++N  G       ++  R
Sbjct: 84  QMIKFGEYIHTLFVPTSLNMVRFRPLKGTGLITMEARLVFILVDNFFGGDGRYHAKIEGR 143

Query: 126 SLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTIN 185
             +  E+++ +  +  I     +  +   +   + E                 E V   +
Sbjct: 144 EFTPTERRIIQMLLKIIFEDYKEAWAPVMDV--SFEYLDSEVNPAMANIVSPTEVVVISS 201

Query: 186 MNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDT 244
            ++ ++     F + +P   L     +  +  Q+  E+           +   + V + T
Sbjct: 202 FHIELDGGGGDFHVSLPYSMLEPIRELLDAGVQSDKEDTDLRWSKALRDEIMDVKVALTT 261

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
            +      L+DV+  K G +IP          +       +  +LGR   N  ++I ++I
Sbjct: 262 HMLDVDVPLRDVMEFKPGDIIPVEMP--ETITVLIEDLPTFRAKLGRSRDNLALKIVEKI 319


>gi|167623386|ref|YP_001673680.1| flagellar motor switch protein FliM [Shewanella halifaxensis
           HAW-EB4]
 gi|167353408|gb|ABZ76021.1| flagellar motor switch protein FliM [Shewanella halifaxensis
           HAW-EB4]
          Length = 342

 Score =  243 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 46/301 (15%), Positives = 95/301 (31%), Gaps = 11/301 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +          R+                +   + + L       M    ++S    Q  
Sbjct: 31  DARSYDFSSQDRIVRG------RMPTLEIVNERFARHLRISMFNMMRRAAEVSINGVQML 84

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           KF   +H+       +    S       I     LV  L++N  G       ++  R  +
Sbjct: 85  KFGEYVHTLFVPTSLNMVRFSPLKGTALITMEARLVFILVDNFFGGDGRFHAKIEGREFT 144

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++ +  +  I        +   +     +                 E V   + ++
Sbjct: 145 PTERRIVQLLLKIIFEDYKDAWAPVMDVQ--FDYLDSEVNPAMANIVSPTEVVVVSSFHI 202

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            ++     F + +P   +     +  +  Q+ +++           +   ++V ID  I 
Sbjct: 203 EVDGGGGDFHITMPYSMIEPIRELLDAGVQSDTQDTDMRWSQALRDEIMDVDVGIDATIV 262

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
             K TLK V+  K G VIP         IL       Y C++GR  +N  ++I ++I   
Sbjct: 263 EHKVTLKQVLEFKAGDVIPVELP--EYIILKVEDLPTYRCKMGRTKENLALKICEQIPRP 320

Query: 308 Q 308
           +
Sbjct: 321 E 321


>gi|323496548|ref|ZP_08101602.1| flagellar motor switch protein FliM [Vibrio sinaloensis DSM 21326]
 gi|323318392|gb|EGA71349.1| flagellar motor switch protein FliM [Vibrio sinaloensis DSM 21326]
          Length = 349

 Score =  243 bits (619), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 34/304 (11%), Positives = 91/304 (29%), Gaps = 11/304 (3%)

Query: 6   IHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSC 65
              +          R+                +   + + +       +    ++S    
Sbjct: 30  SDTSAVDFDFSSQDRIVRG------RMPTLELINERFARHMRISLFNMLRKTAEVSINGV 83

Query: 66  QSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNR 125
           Q  KF    ++       +            I     LV  L+EN  G       ++  R
Sbjct: 84  QMMKFGEYQNTLYVPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRFHARIEGR 143

Query: 126 SLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTIN 185
             +  E+++ +  +  +     +  S         E                 E +   +
Sbjct: 144 EFTPTERRIVQLLLKIVFEDYKEAWSPVMGVE--FEYLDSEVNPSMANIVSPTEVIVVSS 201

Query: 186 MNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDT 244
            ++ ++     F +++P   +     +  +  Q+               +   + VN   
Sbjct: 202 FHIEVDGGGGDFHVVMPYSMVEPIRELLDAGVQSDKMETDVRWSTALREEIMDVPVNFRV 261

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
            +  +  +L+D++ L+ G +IP        A +       +  ++GR G+N  ++++++I
Sbjct: 262 NLLEQDISLRDLMELQPGDIIPITMP--EHATMFVEELPTFRVKMGRSGENLAVQVSEKI 319

Query: 305 NFDQ 308
               
Sbjct: 320 KRPD 323


>gi|297530595|ref|YP_003671870.1| flagellar motor switch protein FliM [Geobacillus sp. C56-T3]
 gi|297253847|gb|ADI27293.1| flagellar motor switch protein FliM [Geobacillus sp. C56-T3]
          Length = 334

 Score =  243 bits (619), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 38/289 (13%), Positives = 94/289 (32%), Gaps = 7/289 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +  + +   + + L   F  ++   V IS  S     +   + S  +  + +   
Sbjct: 50  SKDQIRSLTRIHENFARLLTTFFSAQLRTYVQISVASADQIPYEEFVRSIPKMTIINVFE 109

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +     +  +  + N+   +L+ ++G     + ++ +  L+ +E ++      +      
Sbjct: 110 VPPLGGHVLLEVNPNIAYAMLDRVMGGRGVGMDKVEH--LTEIETRIMSNLFDKAFVYWR 167

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
               +  E  P   DF      +       N+ V  I++N  I        + IP   L 
Sbjct: 168 DAWESVAEVDPLFVDFEV--NPQFLRMIAPNDTVVVISLNTQIGEARGMMNVCIPHVVLE 225

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                       Q + + +S +      ++     + I   +     T+ + + L+ G V
Sbjct: 226 PIMPRLSVHYWMQAQKKERSPEEAKRIEQRIRAAKLPIIAELGTAVITVNEFLQLEAGDV 285

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKN 313
           I          ++       +  + G+  K   ++I   I  D+     
Sbjct: 286 IQLEQSIHEPLVVKIGHIPKFIGQPGKRNKKLAVQILAMIEGDKDDHDE 334


>gi|56419765|ref|YP_147083.1| flagellar motor switch protein FliM [Geobacillus kaustophilus
           HTA426]
 gi|261419430|ref|YP_003253112.1| flagellar motor switch protein FliM [Geobacillus sp. Y412MC61]
 gi|319766245|ref|YP_004131746.1| flagellar motor switch protein FliM [Geobacillus sp. Y412MC52]
 gi|56379607|dbj|BAD75515.1| flagellar motor switch protein [Geobacillus kaustophilus HTA426]
 gi|261375887|gb|ACX78630.1| flagellar motor switch protein FliM [Geobacillus sp. Y412MC61]
 gi|317111111|gb|ADU93603.1| flagellar motor switch protein FliM [Geobacillus sp. Y412MC52]
          Length = 334

 Score =  243 bits (619), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 38/289 (13%), Positives = 94/289 (32%), Gaps = 7/289 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +  + +   + + L   F  ++   V IS  S     +   + S  +  + +   
Sbjct: 50  SKDQIRSLTRIHENFARLLTTFFSAQLRTYVQISVASADQIPYEEFVRSIPKMTIINVFE 109

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +     +  +  + N+   +L+ ++G     + ++ +  L+ +E ++      +      
Sbjct: 110 VPPLGGHVLLEVNPNIAYAMLDRVMGGRGVGMDKVEH--LTEIETRIMSNLFDKAFVHWR 167

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
               +  E  P   DF      +       N+ V  I++N  I        + IP   L 
Sbjct: 168 DAWESVAEVDPLFVDFEV--NPQFLRMIAPNDTVVVISLNTQIGEARGMMNVCIPHVVLE 225

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                       Q + + +S +      ++     + I   +     T+ + + L+ G V
Sbjct: 226 PIMPRLSVHYWMQAQKKERSPEEAKRIEQRIRAAKLPIIAELGTAVITVNEFLQLEAGDV 285

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKN 313
           I          ++       +  + G+  K   ++I   I  D+     
Sbjct: 286 IQLEQSIHEPLVVKIGHIPKFIGQPGKRNKKLAVQILAMIEGDEDDHDE 334


>gi|238920318|ref|YP_002933833.1| flagellar motor switch protein FliM [Edwardsiella ictaluri 93-146]
 gi|238869887|gb|ACR69598.1| flagellar motor switch protein FliM, putative [Edwardsiella
           ictaluri 93-146]
          Length = 337

 Score =  243 bits (619), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 39/304 (12%), Positives = 97/304 (31%), Gaps = 10/304 (3%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           ++      P  P    R+       +   +    +   + +         +    DI+  
Sbjct: 31  ETHDGEVRPYDPTTQRRVV------RERLQALEIINERFARQFRMGLFNLLRRSPDITVG 84

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
           + +   +     +       +   L        +    +LV   ++NL G       ++ 
Sbjct: 85  AVRIQPYHEFARNLPVPTNLNLVHLKPLRGTALMVFEPSLVFMAVDNLFGGDGRFPTKVD 144

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  +  E+++ +  +           S   +          I     N     N+ V T
Sbjct: 145 GREFTHTEQRVIQSMLRLALDAYRDAWSAIFKLDIEYVRSE-IQVKFTNITTSPNDIVVT 203

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNI 242
               + +  ++  F + IP   +     + ++   + S+ + +   D  +++     + +
Sbjct: 204 TPFTVEVGALSGEFNICIPFSMIEPLRELLVNPPLENSKQEDQHWRDTLSKQVQHSELEL 263

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
                     L DV+ L+IG V+P         + + +G  + +C+ G     Y +R+  
Sbjct: 264 VADFVDIPLRLSDVLKLQIGDVLPIDRP--DRLVANVDGVPVLTCQYGCYHGQYALRVEK 321

Query: 303 RINF 306
            IN 
Sbjct: 322 MINP 325


>gi|121608105|ref|YP_995912.1| flagellar motor switch protein FliM [Verminephrobacter eiseniae
           EF01-2]
 gi|121552745|gb|ABM56894.1| flagellar motor switch protein FliM [Verminephrobacter eiseniae
           EF01-2]
          Length = 334

 Score =  243 bits (619), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 43/301 (14%), Positives = 95/301 (31%), Gaps = 11/301 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +          R+                +   + + L       +    +IS       
Sbjct: 34  SVRNYDLSSQERIVRG------RMPTMEIVNERFARNLRIGLFNFIRRSPEISVGMVSVQ 87

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           ++S  +        F+  ++     +  + C  +LV  +++ L G + +   ++  R  S
Sbjct: 88  RYSAFLRELVVPTNFNIVAIRPLRGSGLVVCEPSLVFGIIDTLYGGAGKFQTRIEGRDFS 147

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++  R +  I A   +           LE        +       +E V +    +
Sbjct: 148 PTEQRVINRLVDVICAEYKKAWQGIYPLE--LEYQRSEMQPQFANIATPSEIVVSTAFQL 205

Query: 189 TIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            I ++  +  + +P  TL     +   S+Q  S       +    R+     V +   + 
Sbjct: 206 EIGDLPGAIHMCMPYATLEPIRDVLYSSTQGDSIEVDRRWVRVLTREIQAAEVVLVAELA 265

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
               T++ ++ LK G  I    +       +  G  I+ C+ G     Y IRI   +   
Sbjct: 266 RADATVEQLLALKPGDFIELERQP--RIRAAIGGVPIFECQYGTHNCRYAIRIEKCLRNA 323

Query: 308 Q 308
            
Sbjct: 324 D 324


>gi|292493590|ref|YP_003529029.1| flagellar motor switch protein FliM [Nitrosococcus halophilus Nc4]
 gi|291582185|gb|ADE16642.1| flagellar motor switch protein FliM [Nitrosococcus halophilus Nc4]
          Length = 349

 Score =  243 bits (619), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 42/307 (13%), Positives = 98/307 (31%), Gaps = 16/307 (5%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
            +   P       R+                +   + + L +         +D++ +  Q
Sbjct: 34  EEAVRPYDFSSEDRIVRA------RLPALEMINERFVRQLRRSLFNLFRRAIDVTVSGMQ 87

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASH-----ETIPQ 121
             KFS  IH+       +   +S             LV  +++N  G S       +  +
Sbjct: 88  MVKFSEYIHTLFVPTSLNMVQMSPLQGTSLFVFDPKLVFMMVDNYFGGSGRAYARRSYAR 147

Query: 122 LYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFV 181
           +  R  +  E ++ +  + ++ A L Q          + E        +  T    +E V
Sbjct: 148 IEGREFTPTEVRVVQLVLEKVFADLEQAWEPVLAV--HFEYLQAEPNPQFATIVSPSEVV 205

Query: 182 TTINMNMTIENVASSFVLIIPQETLLKTTLISL-SSQNKSENQSEDLIDPFARKTYQLNV 240
                 +  +     F + +P   L     +     Q+ S    E        K  +  V
Sbjct: 206 VVSTFFVEFDGGGGEFHITLPYAMLEPIRELLEVGRQSGSSQVDERWDQALQEKILEAEV 265

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            +   +   + +L++++ L+ G ++P      +     A+G  ++    G    NY +++
Sbjct: 266 ELSCTLAETQLSLREILALEPGDILPIELP--SILTAQADGVPVFRARYGVHNDNYALKV 323

Query: 301 TDRINFD 307
            + +   
Sbjct: 324 VEPLPHQ 330


>gi|238751773|ref|ZP_04613261.1| Flagellar motor switch protein fliM [Yersinia rohdei ATCC 43380]
 gi|238710044|gb|EEQ02274.1| Flagellar motor switch protein fliM [Yersinia rohdei ATCC 43380]
          Length = 334

 Score =  243 bits (619), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 36/301 (11%), Positives = 88/301 (29%), Gaps = 10/301 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
             +  P  P    R+       +        +   + +         +    DI+    +
Sbjct: 31  ETDVKPYDPTTQRRVV------RERLHALEIINERFARQFRMGLFNLLRRSPDITVGPIK 84

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
              +     +       +   L           + +LV   ++NL G       ++  R 
Sbjct: 85  IQPYHEFARNLPVPTNLNLIHLKPLRGTALFVFAPSLVFIAVDNLFGGDGRFPTKVEGRE 144

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E+++  R +           +   +          I     N     N+ V T   
Sbjct: 145 FTHTEQRVINRMLRLALDAYRDAWAPIYKIDVEYVRSE-IQVKFTNITTSPNDIVVTTPF 203

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNIDTR 245
           ++ I  ++  F + IP   +     +  +   + S  +     +   ++     + +   
Sbjct: 204 HVEIGTLSGEFNICIPFAMIEPLRELLTNPPLENSRQEDSHWRETLVKQVQHSELELVAN 263

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
                  L  ++ L+ G V+P         I   +G  + + + G +   Y +R+   IN
Sbjct: 264 FVDIPLRLSQILKLQPGDVLPIDKP--DRLIGHVDGVPVLTSQYGTLNGQYALRVEHLIN 321

Query: 306 F 306
            
Sbjct: 322 P 322


>gi|238788326|ref|ZP_04632120.1| Flagellar motor switch protein fliM [Yersinia frederiksenii ATCC
           33641]
 gi|238723572|gb|EEQ15218.1| Flagellar motor switch protein fliM [Yersinia frederiksenii ATCC
           33641]
          Length = 334

 Score =  243 bits (619), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 36/301 (11%), Positives = 88/301 (29%), Gaps = 10/301 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
             +  P  P    R+       +        +   + +         +    DI+    +
Sbjct: 31  ETDVKPYDPTTQRRVV------RERLHALEIINERFARQFRMGLFNLLRRSPDITVGPIK 84

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
              +     +       +   L           + +LV   ++NL G       ++  R 
Sbjct: 85  IQPYHDFARNLPVPTNLNLIHLKPLRGTALFVFAPSLVFIAVDNLFGGDGRFPTKVEGRE 144

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E+++  R +           +   +          I     N     N+ V T   
Sbjct: 145 FTHTEQRVINRMLRLALDAYRDAWAPIYKIDVEYVRSE-IQVKFTNITTSPNDIVVTTPF 203

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNIDTR 245
           ++ I  ++  F + IP   +     +  +   + S  +     +   ++     + +   
Sbjct: 204 HVEIGALSGEFNICIPFAMIEPLRELLTNPPLENSRQEDSHWRETLVKQVQHSELELVAN 263

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
                  L  ++ L+ G V+P         I   +G  + + + G +   Y +R+   IN
Sbjct: 264 FVDIPLRLSQILKLQPGDVLPIDKP--DRLIGHVDGVPVLTSQYGTLNGQYALRVEHLIN 321

Query: 306 F 306
            
Sbjct: 322 P 322


>gi|313895914|ref|ZP_07829468.1| flagellar motor switch protein FliM [Selenomonas sp. oral taxon 137
           str. F0430]
 gi|312975339|gb|EFR40800.1| flagellar motor switch protein FliM [Selenomonas sp. oral taxon 137
           str. F0430]
          Length = 334

 Score =  243 bits (619), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 47/286 (16%), Positives = 95/286 (33%), Gaps = 8/286 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +    L   + + L       +   V+I   S +   +   + S     V    +
Sbjct: 49  SKDQIRTLFMLHESFSRLLNTYLSASLRTMVNIEVLSVEQMTYQEFVQSMANPAVIGIIA 108

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           L     N  I    ++    ++ + G   +  P + +R+L+ +E  + +R I  +     
Sbjct: 109 LPPLKGNIIIEVGPDIAFAYVDRVFGGEGK--PSVKSRALTDIESAVMRRFIDTVINYFR 166

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  S   E  PN E        +       ++ V  + ++M + +V     + IP   L 
Sbjct: 167 EAWSNVVEFRPNFETMET--NPQFAQIVPPSDMVVLVTIHMKLGDVEGMMNICIPYLVLE 224

Query: 208 KTTLISLSS----QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQ 263
                  +S     +     S D +    RK  +  V     +     T+ + +TL  G 
Sbjct: 225 PVMSKLTTSFWVAASVDRESSPDQVADLQRKIERTWVPFSVELGTVDITINEFLTLGFGD 284

Query: 264 VIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
           V+      K   +        +    G  GK   ++I+  I  D+ 
Sbjct: 285 VLQLDTLAKDELVCYVGTNAKFRAYPGTAGKRMAVQISGIIEGDED 330


>gi|24374733|ref|NP_718776.1| flagellar motor switch protein FliM [Shewanella oneidensis MR-1]
 gi|24349393|gb|AAN56220.1|AE015759_12 flagellar motor switch protein FliM [Shewanella oneidensis MR-1]
          Length = 343

 Score =  243 bits (619), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 40/305 (13%), Positives = 93/305 (30%), Gaps = 11/305 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           ++ +           R+                +   + + L       M    ++S   
Sbjct: 28  AVGQEARSYDFSSQDRIVRG------RMPTLEIVNERFARHLRISMFNMMRRAAEVSING 81

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            Q  KF   +H+       +            I     LV  L++N  G       ++  
Sbjct: 82  VQMLKFGEYVHTLFVPTSLNMVRFHPLKGTALITMEARLVFILVDNFFGGDGRFHAKIEG 141

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++ +  +  I        +   +     +                 E V   
Sbjct: 142 REFTPTERRIVQLLLKIIFEDYKDAWAPVMDVE--FDYLDSEVNPAMANIVSPTEVVVIN 199

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNID 243
           + ++ ++     F + +P   +     +  +  Q+  ++           +   + V  D
Sbjct: 200 SFHIEVDGGGGDFHITMPYSMIEPIRELLDAGVQSDKQDTDMRWSQALHDEIMDVKVGFD 259

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
             +   + TLKDV+  K G +IP         ++       Y C++GR   N  ++I ++
Sbjct: 260 ATVVEHELTLKDVMNFKAGDIIPIELP--EYIMMRIEDLPTYRCKMGRSRDNLALKIYEK 317

Query: 304 INFDQ 308
           I   +
Sbjct: 318 IPRPE 322


>gi|16129892|ref|NP_416455.1| flagellar motor switching and energizing component [Escherichia
           coli str. K-12 substr. MG1655]
 gi|89108777|ref|AP_002557.1| flagellar motor switching and energizing component [Escherichia
           coli str. K-12 substr. W3110]
 gi|170081589|ref|YP_001730909.1| flagellar motor switching and energizing component [Escherichia
           coli str. K-12 substr. DH10B]
 gi|238901150|ref|YP_002926946.1| flagellar motor switching and energizing component [Escherichia
           coli BW2952]
 gi|253773106|ref|YP_003035937.1| flagellar motor switch protein FliM [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|120345|sp|P06974|FLIM_ECOLI RecName: Full=Flagellar motor switch protein FliM
 gi|145981|gb|AAA23786.1| FlaAII protein [Escherichia coli]
 gi|1736611|dbj|BAA15770.1| flagellar motor switching and energizing component [Escherichia
           coli str. K12 substr. W3110]
 gi|1788255|gb|AAC75012.1| flagellar motor switching and energizing component [Escherichia
           coli str. K-12 substr. MG1655]
 gi|169889424|gb|ACB03131.1| flagellar motor switching and energizing component [Escherichia
           coli str. K-12 substr. DH10B]
 gi|238861113|gb|ACR63111.1| flagellar motor switching and energizing component [Escherichia
           coli BW2952]
 gi|253324150|gb|ACT28752.1| flagellar motor switch protein FliM [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|260448942|gb|ACX39364.1| flagellar motor switch protein FliM [Escherichia coli DH1]
 gi|315136582|dbj|BAJ43741.1| flagellar motor switch protein FliM [Escherichia coli DH1]
          Length = 334

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 40/303 (13%), Positives = 93/303 (30%), Gaps = 10/303 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+       +   +    +   + +         +    DI+  +
Sbjct: 30  SGESDIRPYDPNTQRRVV------RERLQALEIINERFARHFRMGLFNLLRRSPDITVGA 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G       ++  
Sbjct: 84  IRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +                  +     N     N+ V   
Sbjct: 144 REFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVRSE-MQVKFTNITTSPNDIVVNT 202

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     + ++   + S N+ ++  D   R+     + + 
Sbjct: 203 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELV 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ L  G V+P         I   +G  + + + G +   Y +RI   
Sbjct: 263 ANFADISLRLSQILKLNPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRIEHL 320

Query: 304 INF 306
           IN 
Sbjct: 321 INP 323


>gi|330826724|ref|YP_004390027.1| flagellar motor switch protein FliM [Alicycliphilus denitrificans
           K601]
 gi|329312096|gb|AEB86511.1| flagellar motor switch protein FliM [Alicycliphilus denitrificans
           K601]
          Length = 334

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 37/300 (12%), Positives = 90/300 (30%), Gaps = 11/300 (3%)

Query: 10  TSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGK 69
                     R+                +   + +         +    +IS  +    +
Sbjct: 35  VRDYDISSQERIVRG------RMPTMEIVNERFARNFRIGLFNMIRRSPEISVGTVGVQR 88

Query: 70  FSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLST 129
           ++  +        F+  ++     +  I C  +L+  +++ L G   +   ++  R  S 
Sbjct: 89  YNAFLRELVVPTNFNIVAIRPLRGSGLIVCEPSLLFGIIDTLYGGVGKLQTRIEGRDFSA 148

Query: 130 VEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMT 189
            E ++ +R +  I     +           L         +       +E V +    + 
Sbjct: 149 TELRVIQRLVNLICEEYKKAWQGIYPLE--LSYQRSEMQPQFANIATPSEIVVSTAFQLE 206

Query: 190 IENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINL 248
           I +++ +  + +P  TL     +   S Q  +       +    R+     V +   +  
Sbjct: 207 IGDLSGAIHICMPYATLEPIRDVLYSSVQGDAIEVDRRWVKVLTREIQAAEVTLVAELAR 266

Query: 249 KKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
              T++ ++ +K G  I            S  G  ++ C+ G     Y IRI   +    
Sbjct: 267 ADATVEQLLAMKPGDFIELDREP--RIRASIEGVPVFECQYGTHNAKYAIRIEQCLRGAD 324


>gi|194471387|ref|ZP_03077371.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194457751|gb|EDX46590.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
          Length = 334

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 40/305 (13%), Positives = 96/305 (31%), Gaps = 10/305 (3%)

Query: 3   GQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISY 62
           G +   +  P  P    R+       +   +    +   + +         +    DI+ 
Sbjct: 28  GIASDSDIRPYDPNTQRRVV------RERLQALEIINERFARQFRMGLFNLLRRSPDITV 81

Query: 63  TSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQL 122
            + +   +     +       +   L        +  S +LV   ++NL G       ++
Sbjct: 82  GAIRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKV 141

Query: 123 YNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVT 182
             R  +  E+++  R +       +                  +     N     N+ V 
Sbjct: 142 EGREFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVRSE-MQVKFTNITTSPNDIVV 200

Query: 183 TINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVN 241
               ++ I N+   F + +P   +     + ++   + S ++ ++  D   R+     + 
Sbjct: 201 NTPFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRHEDQNWRDNLVRQVQHSELE 260

Query: 242 IDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
           +          L  ++ LK G V+P         I   +G  + + + G V   Y++R+ 
Sbjct: 261 LVANFADIPLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTVNGQYSLRVE 318

Query: 302 DRINF 306
             IN 
Sbjct: 319 HLINP 323


>gi|94500287|ref|ZP_01306820.1| flagellar motor switch protein FliM [Oceanobacter sp. RED65]
 gi|94427586|gb|EAT12563.1| flagellar motor switch protein FliM [Oceanobacter sp. RED65]
          Length = 331

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 39/301 (12%), Positives = 93/301 (30%), Gaps = 12/301 (3%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
           +           R+                +   + ++        +    D++    Q 
Sbjct: 31  EGIKSYDLSSQDRIVRG------RMPTLEMINERFARYTRISMFNFLRRSADVASGGIQI 84

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSL 127
            KF   IH+       +   +              LV  L++N  G       ++  R  
Sbjct: 85  MKFGEYIHTLYVPTSLNMVKVRPLRGTALFIFDAKLVFKLVDNFFGGDGR-HAKIEGREF 143

Query: 128 STVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMN 187
           +  E ++ +  ++Q+   + +      +     E +              +E V   + +
Sbjct: 144 TPTELRVVQMVLSQVFTDMKEAWHAVLDLD--FEYYGSEVNPAMANIVSPSEVVVISSFH 201

Query: 188 MTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRI 246
           + ++       + +P   +        +  Q+  +   +  +           V +   +
Sbjct: 202 IELDGGGGDLHVALPYSMIEPIREFLDAGVQSDVDEVDDRWVQSLQEDIQSAKVPVHGTV 261

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
             ++ +L++V   + G VIP    E    IL ANG  I+  +LG    N  ++I + I  
Sbjct: 262 VDREISLREVAAFQPGDVIPVDMPED--FILQANGTPIFRGQLGVRDDNLAVKIKEPIKR 319

Query: 307 D 307
            
Sbjct: 320 K 320


>gi|229522079|ref|ZP_04411496.1| flagellar motor switch protein FliM [Vibrio cholerae TM 11079-80]
 gi|229341004|gb|EEO06009.1| flagellar motor switch protein FliM [Vibrio cholerae TM 11079-80]
          Length = 349

 Score =  242 bits (618), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 36/302 (11%), Positives = 92/302 (30%), Gaps = 11/302 (3%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
            + +        R+                +   + + L       +    ++S    Q 
Sbjct: 32  PSATNFDFSSQDRIVRG------RMPTLELINERFARHLRISLFNMLRKTAEVSINGVQM 85

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSL 127
            KF    ++       +            +     LV  L+EN  G       ++  R  
Sbjct: 86  MKFGEYQNTLYVPTSLNMVRFRPLKGTALVTMEARLVFILVENFFGGDGRYHARIEGREF 145

Query: 128 STVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMN 187
           +  E+++ +  +  + A   +  S         E                 E +   + +
Sbjct: 146 TPTERRVIQLLLKIVFADYKEAWSPVMGVE--FEYLDSEVNPSMANIVSPTEVIVVSSFH 203

Query: 188 MTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRI 246
           + ++     F +++P   +     +  +  Q+               +   + VN    +
Sbjct: 204 VEVDGGGGDFHMVMPYSMVEPIRELLDAGVQSDKMETDVRWSTALREEIMDVPVNFRVNL 263

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                 L+D++ L++G VIP        A++       Y  ++GR G+   ++++++I  
Sbjct: 264 LEMDIALRDLMELQVGDVIPIKMP--EHAVMFVEDLPTYRVKMGRSGEKLAVQVSEKIKR 321

Query: 307 DQ 308
             
Sbjct: 322 PD 323


>gi|157961196|ref|YP_001501230.1| flagellar motor switch protein FliM [Shewanella pealeana ATCC
           700345]
 gi|157846196|gb|ABV86695.1| flagellar motor switch protein FliM [Shewanella pealeana ATCC
           700345]
          Length = 342

 Score =  242 bits (618), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 45/301 (14%), Positives = 96/301 (31%), Gaps = 11/301 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +          R+                +   + + L       M    ++S    Q  
Sbjct: 31  DARSYDFSSQDRIVRG------RMPTLEIVNERFARHLRISMFNMMRRAAEVSINGVQML 84

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           KF   +H+       +    S       I     LV  L++N  G       ++  R  +
Sbjct: 85  KFGEYVHTLFVPTSLNMVRFSPLKGTALITMEARLVFILVDNFFGGDGRFHAKIEGREFT 144

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++ +  +  I     +  +   E     +                 E V   + ++
Sbjct: 145 PTERRIVQLLLKIIFEDYKEAWAPVMEVQ--FDYLDSEVNPAMANIVSPTEVVVVSSFHI 202

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            ++     F + +P   +     +  +  Q+ +++           +   ++V ID  I 
Sbjct: 203 EVDGGGGDFHITMPYSMIEPIRELLDAGVQSDTQDTDMRWSQALRDEIMDVDVGIDATIV 262

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
             K TL++V+  K G VIP         IL       Y C++G+   N  ++I ++I   
Sbjct: 263 EHKLTLREVLEFKAGDVIPVELP--EHIILKVEDLPTYRCKMGKAKDNLALKICEKIPRP 320

Query: 308 Q 308
           +
Sbjct: 321 E 321


>gi|302392382|ref|YP_003828202.1| flagellar motor switch protein FliM [Acetohalobium arabaticum DSM
           5501]
 gi|302204459|gb|ADL13137.1| flagellar motor switch protein FliM [Acetohalobium arabaticum DSM
           5501]
          Length = 333

 Score =  242 bits (618), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 39/307 (12%), Positives = 101/307 (32%), Gaps = 13/307 (4%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           +  K+          +L       K   +    +   + + L      ++   + +   S
Sbjct: 32  TEEKSVKAYDFKHPDKL------SKDQLRTLRIIYENFARLLNTSLSTQLRTMIHVELNS 85

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +   I S  +  + S    +  +  F +  +  L   ++E L G        +  
Sbjct: 86  IEQLSYDEFIRSLPQPTIMSICDFNPLAGEFILEINPRLGYAIVERLFGGQGTPPNNI-- 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  + +E+ + K+ + Q  +   +      +  P +++       +       N+ V   
Sbjct: 144 RDFTDIEEMVLKKVLKQNLSAFVEAWENVIDLKPRIKNLE--SNPQFTQIVPGNDMVILA 201

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLIS---LSSQNKSENQSEDLIDPFARKTYQLNVN 241
             +  I        + IP   L                 ++ S + ++    +  +  + 
Sbjct: 202 TFDAKIAEAEGLINVCIPYIVLEPIVSKLNAQYWFSTSRDSASSEELNKLKDRLSKAKLP 261

Query: 242 IDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
           +   +     T+ D++ L+ G VI    +    A++    KE +  + G VG    I I+
Sbjct: 262 VIANLGTTNITVADLLDLQPGDVIRMDQKATKEAVVKVGNKEKFIGKPGVVGSKLAIEIS 321

Query: 302 DRINFDQ 308
             ++ ++
Sbjct: 322 SVLDKEE 328


>gi|333003041|gb|EGK22595.1| flagellar motor switch protein FliM [Shigella flexneri VA-6]
          Length = 334

 Score =  242 bits (618), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 40/303 (13%), Positives = 94/303 (31%), Gaps = 10/303 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+       +   +    +   + +         +    DI+  +
Sbjct: 30  SGESDIRPYDPNTQRRVV------RERLQALEIINERFARHFRMGLFNLLRRSPDITVGA 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G       ++  
Sbjct: 84  IRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +                  +     N     N+ V   
Sbjct: 144 REFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVRSE-MQVEFTNITTSPNDIVVNT 202

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     + ++   + S N+ ++  D   R+     + + 
Sbjct: 203 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELV 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK G ++P         I   +G  + + + G +   Y +RI   
Sbjct: 263 ANFADISLRLSQILKLKPGDILPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRIEHL 320

Query: 304 INF 306
           IN 
Sbjct: 321 INP 323


>gi|262404472|ref|ZP_06081027.1| flagellar motor switch protein FliM [Vibrio sp. RC586]
 gi|262349504|gb|EEY98642.1| flagellar motor switch protein FliM [Vibrio sp. RC586]
          Length = 349

 Score =  242 bits (618), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 36/302 (11%), Positives = 92/302 (30%), Gaps = 11/302 (3%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
            + +        R+                +   + + L       +    ++S    Q 
Sbjct: 32  PSATNFDFSSQDRIVRG------RMPTLELINERFARHLRISLFNMLRKTAEVSINGVQM 85

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSL 127
            KF    ++       +            +     LV  L+EN  G       ++  R  
Sbjct: 86  MKFGEYQNTLYVPTSLNMVRFRPLKGTALVTMEARLVFILVENFFGGDGRYHARIEGREF 145

Query: 128 STVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMN 187
           +  E+++ +  +  + A   +  S         E                 E +   + +
Sbjct: 146 TPTERRVIQLLLKIVFADYKEAWSPVMGVE--FEYLDSEVNPSMANIVSPTEVIVVSSFH 203

Query: 188 MTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRI 246
           + ++     F +++P   +     +  +  Q+               +   + VN    +
Sbjct: 204 VEVDGGGGDFHMVMPYSMMEPIRELLDAGVQSDKMETDVRWSTALREEIMDVPVNFRVNL 263

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                 L+D++ L++G VIP        A++       Y  ++GR G+   ++++++I  
Sbjct: 264 LEMDIALRDLMELQVGDVIPIKMP--EHAVMFVEELPTYRVKMGRSGEKLAVQVSEKIKR 321

Query: 307 DQ 308
             
Sbjct: 322 PD 323


>gi|283785715|ref|YP_003365580.1| flagellar motor switch protein FliM [Citrobacter rodentium ICC168]
 gi|282949169|emb|CBG88777.1| flagellar motor switch protein FliM [Citrobacter rodentium ICC168]
          Length = 334

 Score =  242 bits (618), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 39/305 (12%), Positives = 95/305 (31%), Gaps = 10/305 (3%)

Query: 3   GQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISY 62
           G +   +  P  P    R+       +   +    +   + +         +    DI+ 
Sbjct: 28  GIAGESDIRPYDPNTQRRVV------RERLQALEIINERFARQFRMGLFNLLRRSPDITV 81

Query: 63  TSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQL 122
            + +   +     +       +   L        +  S +LV   ++NL G       ++
Sbjct: 82  GAIRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKV 141

Query: 123 YNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVT 182
             R  +  E+++  R +       +                  +     N     N+ V 
Sbjct: 142 EGREFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVRSE-MQVKFTNITTSPNDIVV 200

Query: 183 TINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVN 241
               ++ I N+   F + +P   +     + ++   + S ++ ++  D   R+     + 
Sbjct: 201 NTPFHVEIGNLTGEFNICLPFSMIEPLREMLVNPPLENSRHEDQNWRDNLVRQVQHSELE 260

Query: 242 IDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
           +          L  ++ L+ G V+P         I   +G  + + + G V   Y +R+ 
Sbjct: 261 LVANFADIPLRLSQILKLQPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTVNGQYALRVE 318

Query: 302 DRINF 306
             IN 
Sbjct: 319 HLINP 323


>gi|319764508|ref|YP_004128445.1| flagellar motor switch protein flim [Alicycliphilus denitrificans
           BC]
 gi|317119069|gb|ADV01558.1| flagellar motor switch protein FliM [Alicycliphilus denitrificans
           BC]
          Length = 334

 Score =  242 bits (618), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 37/300 (12%), Positives = 90/300 (30%), Gaps = 11/300 (3%)

Query: 10  TSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGK 69
                     R+                +   + +         +    +IS  +    +
Sbjct: 35  VRDYDISSQERIVRG------RMPTMEIVNERFARNFRIGLFNMIRRSPEISVGTVAVQR 88

Query: 70  FSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLST 129
           ++  +        F+  ++     +  I C  +L+  +++ L G   +   ++  R  S 
Sbjct: 89  YNAFLRELVVPTNFNIVAIRPLRGSGLIVCEPSLLFGIIDTLYGGVGKLQTRIEGRDFSA 148

Query: 130 VEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMT 189
            E ++ +R +  I     +           L         +       +E V +    + 
Sbjct: 149 TELRVIQRLVNLICEEYKKAWQGIYPLE--LSYQRSEMQPQFANIATPSEIVVSTAFQLE 206

Query: 190 IENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINL 248
           I +++ +  + +P  TL     +   S Q  +       +    R+     V +   +  
Sbjct: 207 IGDLSGAIHICMPYATLEPIRDVLYSSVQGDAIEVDRRWVKVLTREIQAAEVTLVAELAR 266

Query: 249 KKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
              T++ ++ +K G  I            S  G  ++ C+ G     Y IRI   +    
Sbjct: 267 ADATVEQLLAMKPGDFIELDREP--RIRASIEGVPVFECQYGTHNAKYAIRIEQCLRGAD 324


>gi|123442771|ref|YP_001006748.1| flagellar motor switch protein FliM [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|332161335|ref|YP_004297912.1| flagellar motor switch protein FliM [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|122089732|emb|CAL12585.1| flagellar motor switch protein FliM [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|318605256|emb|CBY26754.1| flagellar motor switch protein FliM [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325665565|gb|ADZ42209.1| flagellar motor switch protein FliM [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330861091|emb|CBX71358.1| flagellar motor switch protein fliM [Yersinia enterocolitica
           W22703]
          Length = 334

 Score =  242 bits (618), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 36/301 (11%), Positives = 87/301 (28%), Gaps = 10/301 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
             +  P  P    R+       +        +   + +         +    DI+    +
Sbjct: 31  ETDVKPYDPTTQRRVV------RERLHALEIINERFARQFRMGLFNLLRRSPDITVGPIK 84

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
              +     +       +   L           + +LV   ++NL G       ++  R 
Sbjct: 85  IQPYHDFARNLPVPTNLNLIHLKPLRGTALFVFAPSLVFIAVDNLFGGDGRFPTKVEGRE 144

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E+++  R +           +   +          I     N     N+ V T   
Sbjct: 145 FTHTEQRVINRMLRLALDAYRDAWAPIYKIDVEYVRSE-IQVKFTNITTSPNDIVVTTPF 203

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNIDTR 245
            + I  ++  F + IP   +     +  +   + S  +     +   ++     + +   
Sbjct: 204 QVEIGALSGEFNICIPFAMIEPLRELLTNPPLENSRQEDSHWRETLVKQVQHSELELVAN 263

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
                  L  ++ L+ G V+P         I   +G  + + + G +   Y +R+   IN
Sbjct: 264 FVDIPLRLSQILKLQPGDVLPIDKP--DRLIAHVDGVPVLTSQYGTLNGQYALRVEHLIN 321

Query: 306 F 306
            
Sbjct: 322 P 322


>gi|33596151|ref|NP_883794.1| flagellar motor switch protein FliM [Bordetella parapertussis
           12822]
 gi|33573154|emb|CAE36805.1| flagellar motor switch protein FliM [Bordetella parapertussis]
          Length = 336

 Score =  242 bits (618), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 32/310 (10%), Positives = 92/310 (29%), Gaps = 9/310 (2%)

Query: 4   QSIHKNTSPLHPILLAR---LTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
               +           R   L+      +   +    +   + + +  +    M  + DI
Sbjct: 21  GESDEKQPAGDEAGAPRAYDLSSPERVVRRRMQTLELINERFARHMRNVLLNFMRRNADI 80

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           +  + +  K++    +       +   +             NLV  ++++L G       
Sbjct: 81  TVGAIKILKYADFERNLPVPSNLNMIQMKPLRGTALFTYDPNLVFLVIDSLFGGDGRYHT 140

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++  R  +T E+++ +R +        +                     K  +   +NE 
Sbjct: 141 RVEGRDFTTTEQRIIRRLLNLTLESYGKSWDPVYPIEFEYVRSEMHT--KFASITGNNEV 198

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKS--ENQSEDLIDPFARKTYQL 238
           V     ++          + +P   +     +       +  E   +        +    
Sbjct: 199 VVVSPFHIEFGATGGDLNICLPYSMIEPVRDLLTRPLQDTALEEVDQRWAQQLQSQVRSA 258

Query: 239 NVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTI 298
           ++++        +++ +++ +K G V+P             +G  +     G     Y +
Sbjct: 259 DIDLVAEFGHIPSSIGELMRMKTGDVLPIAVP--ETVTAHVDGVPLMEYGYGVFNGRYAL 316

Query: 299 RITDRINFDQ 308
           R+ + IN+D 
Sbjct: 317 RVQNLINYDD 326


>gi|323697919|ref|ZP_08109831.1| flagellar motor switch protein FliM [Desulfovibrio sp. ND132]
 gi|323457851|gb|EGB13716.1| flagellar motor switch protein FliM [Desulfovibrio desulfuricans
           ND132]
          Length = 325

 Score =  242 bits (617), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 44/303 (14%), Positives = 96/303 (31%), Gaps = 13/303 (4%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
                        R+            +   +   + +         M   VDI+  S  
Sbjct: 32  DTGVVAFDLANQDRIIRG------RMPVLEIVNDRFARLCTNALANTMRKRVDINPISID 85

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
             KF   + S       S   +     N  +   + LV  L+EN  G +     ++  R 
Sbjct: 86  MSKFGDFMRSLPVPTSISIFKMDPLRGNALLVVDSRLVFALVENFFGGAGSQP-KVEGRD 144

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            + +E+ + +R +    A + +      E    +         +       ++ V  +  
Sbjct: 145 FTPIEQAIVERVVKIALANMEESWKPVHEVHVEMVR--TEVNPQFAAIVPPSDVVIVVTF 202

Query: 187 NMTIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTR 245
            + +EN   S ++ +P  T+         S Q++        I+ F  +  +  V +  R
Sbjct: 203 EVELENAIGSLIVCLPYATMEPIRSKLHASFQSERLEVDHVWINRFKERLMETPVEMVVR 262

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           +     + + ++ L+ G +I     E         G   +    GRV  N + ++   I 
Sbjct: 263 LGRTSISGRQLLYLQEGDIILLDTDEDELLEAEVEGVRKFQGLPGRVKGNKSFKV---IK 319

Query: 306 FDQ 308
            ++
Sbjct: 320 EEE 322


>gi|157371194|ref|YP_001479183.1| flagellar motor switch protein FliM [Serratia proteamaculans 568]
 gi|157322958|gb|ABV42055.1| flagellar motor switch protein FliM [Serratia proteamaculans 568]
          Length = 333

 Score =  242 bits (617), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 38/303 (12%), Positives = 90/303 (29%), Gaps = 10/303 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S      P  P    R+       +        +   + +         +    DI+   
Sbjct: 29  SNESEVKPYDPTTQRRVV------RERLHALEIINERFARQFRMGLFNLLRRSPDITVGP 82

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L+          + +LV   ++NL G       ++  
Sbjct: 83  IKIQPYHEFARNLPVPTNLNLVHLNPLRGTALFVFAPSLVFIAVDNLFGGDGRFPTKVEG 142

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++ KR +           S   + +        +     N     N+ V T 
Sbjct: 143 REFTPTEQRVIKRMLRLALDAYGDAWSAIYKINVEYVRAE-MQVKFTNITTSPNDIVVTT 201

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNID 243
              + I  ++  F + IP   +     +  +   + S  +     +   ++     + + 
Sbjct: 202 PFQVEIGALSGEFNICIPFAMIEPLRELLTNPPLENSRQEDSHWRETLVKQVQHSELELI 261

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ L+ G V+P         I   +G  + + + G +   Y +R+   
Sbjct: 262 ANFVDIPMRLSKILKLQPGDVLPIDKP--DRLIAHVDGVPVLTSQYGTLNGQYALRVEHL 319

Query: 304 INF 306
           IN 
Sbjct: 320 INP 322


>gi|242238988|ref|YP_002987169.1| flagellar motor switch protein FliM [Dickeya dadantii Ech703]
 gi|242131045|gb|ACS85347.1| flagellar motor switch protein FliM [Dickeya dadantii Ech703]
          Length = 343

 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 39/302 (12%), Positives = 91/302 (30%), Gaps = 10/302 (3%)

Query: 2   RGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDIS 61
              S   +  P  P    R+  +             +   + +         +    DI+
Sbjct: 28  SAASADSDIKPYDPNTQRRVVRERLQS------LEIINERFARQFRMGLFNLLRRSPDIT 81

Query: 62  YTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQ 121
               +   +     +       +   L           S +LV   ++NL G       +
Sbjct: 82  AGPIKIQPYHDFARNLPVPTNLNLVHLKPLRGTALFVFSPSLVFIAVDNLFGGDGRFPTK 141

Query: 122 LYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFV 181
           +  R  +  E+++ KR +           +   +          +     N     N+ V
Sbjct: 142 VEGREFTHTEQRVVKRMLRLALDAYGDAWNAIYKLDVEYVRSE-MQVKFTNITTSPNDIV 200

Query: 182 TTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNV 240
            T   ++ I N+   F + IP   +     + ++   + S  + ++  +  A++     +
Sbjct: 201 VTTPFHVEIGNLTGEFNICIPFAMIEPLRELLVNPPLENSRQEDQNWRETLAKQVQHSEL 260

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            +          L  V+ LK G V+P         +   +G  + + + G     Y +R+
Sbjct: 261 ELVANFVDIPLRLSKVLKLKPGDVLPIEKP--ESLVAHVDGVPVLTGQYGTFKGQYALRV 318

Query: 301 TD 302
             
Sbjct: 319 ER 320


>gi|153834156|ref|ZP_01986823.1| flagellar motor switch protein FliM [Vibrio harveyi HY01]
 gi|156975423|ref|YP_001446330.1| flagellar motor switch protein FliM [Vibrio harveyi ATCC BAA-1116]
 gi|148869526|gb|EDL68524.1| flagellar motor switch protein FliM [Vibrio harveyi HY01]
 gi|156527017|gb|ABU72103.1| hypothetical protein VIBHAR_03154 [Vibrio harveyi ATCC BAA-1116]
          Length = 348

 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 36/301 (11%), Positives = 87/301 (28%), Gaps = 11/301 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
            ++          R+                +   + + +       +    ++S    Q
Sbjct: 31  DESAVSFDFSSQDRIVRG------RMPTLELINERFARHMRISLFNMLRKTAEVSINGVQ 84

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
             KF    ++       +            I     LV  L+EN  G       ++  R 
Sbjct: 85  MMKFGEYQNTLYVPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRFHAKIEGRE 144

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E+++ +  +  +     +  S         E                 E +   + 
Sbjct: 145 FTPTERRIIQLLLKIVFEDYKEAWSPVMGVE--FEYLDSEVNPSMANIVSPTEVIVVSSF 202

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTR 245
           ++ ++     F +++P   +     +  +  Q+               +     VN    
Sbjct: 203 HIEVDGGGGDFHVVMPYSMVEPIRELLDAGVQSDKMETDVRWSSALREEIMDCPVNFRVN 262

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           +  K  +L+D++ L+ G VIP        A +       Y  ++GR      ++I++ I 
Sbjct: 263 LLEKDISLRDLMELQPGDVIPIEMP--EHATMFIEDLPTYRVKMGRSEDKMAVQISEEIE 320

Query: 306 F 306
            
Sbjct: 321 R 321


>gi|157692311|ref|YP_001486773.1| flagellar motor switch protein FliM [Bacillus pumilus SAFR-032]
 gi|194014958|ref|ZP_03053575.1| flagellar motor switch protein FliM [Bacillus pumilus ATCC 7061]
 gi|157681069|gb|ABV62213.1| flagellar motor switch protein FliM [Bacillus pumilus SAFR-032]
 gi|194013984|gb|EDW23549.1| flagellar motor switch protein FliM [Bacillus pumilus ATCC 7061]
          Length = 332

 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 40/286 (13%), Positives = 95/286 (33%), Gaps = 8/286 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +  + +   + + L   F  ++   + I+ +S     +   I S     + +   
Sbjct: 49  SKDQIRSLTRIHDNFARLLTTHFSAQLRSYIQITVSSVDQVPYEEFIRSIPNMTLLNLFY 108

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +S       +  +  +   +++ L+G    +  +  +  L+ +E K+             
Sbjct: 109 VSPLEGRIMLEVNPTIGYAMMDRLMGGIGISHNKTES--LTEIETKIISNMFEGALENYR 166

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +   +  +  P  E        +       NE V  I++N  I  V+    L IP   L 
Sbjct: 167 EAWQSITDIEP--EMADFEVNPQFVQMVSPNETVVVISLNTQIGEVSGVINLCIPHVVLE 224

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                       Q++     +       ++     + +   +   + T+++ + L+IG  
Sbjct: 225 PIIPKLSVHYWMQSERNEPKQQETKAIEKRIMTAKIPVVAELGESEMTVEEFLNLEIGDC 284

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR-INFDQK 309
           I           +    K  +  + GRV +   I+I D  I  ++ 
Sbjct: 285 IALDKPVNAPLTVMVGNKPKFLGQAGRVNRKQAIQILDHDIRGEED 330


>gi|113969632|ref|YP_733425.1| flagellar motor switch protein FliM [Shewanella sp. MR-4]
 gi|114046862|ref|YP_737412.1| flagellar motor switch protein FliM [Shewanella sp. MR-7]
 gi|113884316|gb|ABI38368.1| flagellar motor switch protein FliM [Shewanella sp. MR-4]
 gi|113888304|gb|ABI42355.1| flagellar motor switch protein FliM [Shewanella sp. MR-7]
          Length = 343

 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 40/301 (13%), Positives = 90/301 (29%), Gaps = 11/301 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
                      R+                +   + + L       M    ++S    Q  
Sbjct: 32  EARSYDFSSQDRIVRG------RMPTLEIVNERFARHLRISMFNMMRRAAEVSINGVQML 85

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           KF   +H+       +            I     LV  L++N  G       ++  R  +
Sbjct: 86  KFGEYVHTLFVPTSLNMVRFHPLKGTALITMEARLVFILVDNFFGGDGRFHAKIEGREFT 145

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++ +  +  I        +   +     +                 E V   + ++
Sbjct: 146 PTERRIVQLLLKIIFEDYKDAWAPVMDVE--FDYLDSEVNPAMANIVSPTEVVVINSFHI 203

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            ++     F + +P   +     +  +  Q+  ++           +   + V  D  + 
Sbjct: 204 EVDGGGGDFHITMPYSMIEPIRELLDAGVQSDKQDTDMRWSQALHDEIMDVKVGFDATVV 263

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
             + TLKDV+  K G +IP         ++       Y C++GR   N  ++I ++I   
Sbjct: 264 EHELTLKDVMNFKAGDIIPIELP--EYIMMKIEDLPTYRCKMGRSRDNLALKIYEKIPRP 321

Query: 308 Q 308
           +
Sbjct: 322 E 322


>gi|238764404|ref|ZP_04625354.1| Flagellar motor switch protein fliM [Yersinia kristensenii ATCC
           33638]
 gi|238697430|gb|EEP90197.1| Flagellar motor switch protein fliM [Yersinia kristensenii ATCC
           33638]
          Length = 334

 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 36/302 (11%), Positives = 87/302 (28%), Gaps = 10/302 (3%)

Query: 6   IHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSC 65
              +  P  P    R+       +        +   + +         +    DI+    
Sbjct: 30  SETDVKPYDPTTQRRVV------RERLHALEIINERFARQFRMGLFNLLRRSPDITVGPI 83

Query: 66  QSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNR 125
           +   +     +       +   L           + +LV   ++NL G       ++  R
Sbjct: 84  KIQPYHDFARNLPVPTNLNLIHLKPLRGTALFVFAPSLVFIAVDNLFGGDGRFPTKVEGR 143

Query: 126 SLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTIN 185
             +  E+++  R +           +   +          I     N     N+ V T  
Sbjct: 144 EFTHTEQRVINRMLRLALDAYRDAWAPIYKIDVEYVRSE-IQVKFTNITTSPNDIVVTTP 202

Query: 186 MNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNIDT 244
             + I  ++  F + IP   +     +  +   + S  +     +   ++     + +  
Sbjct: 203 FQVEIGALSGEFNICIPFAMIEPLRELLTNPPLENSRQEDSHWRETLVKQVQHSELELVA 262

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
                   L  ++ L+ G V+P         I   +G  + + + G +   Y +R+   I
Sbjct: 263 NFVDIPLRLSQILKLQPGDVLPIDKP--ERLIAHVDGVPVLTSQYGTLNGQYALRVEHLI 320

Query: 305 NF 306
           N 
Sbjct: 321 NP 322


>gi|119775425|ref|YP_928165.1| flagellar motor switch protein FliM [Shewanella amazonensis SB2B]
 gi|119767925|gb|ABM00496.1| flagellar motor switch protein FliM [Shewanella amazonensis SB2B]
          Length = 342

 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 36/301 (11%), Positives = 92/301 (30%), Gaps = 11/301 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +          R+                +   + + L       M    ++S    Q  
Sbjct: 31  SARSYDFSSQDRIVRG------RMPTLEIVNERFARHLRISMFNMMRRAAEVSINGVQML 84

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           KF   +H+       +            I     LV  L++N  G       ++  R  +
Sbjct: 85  KFGEYVHTLFVPTSLNMVRFQPLKGTALITMEARLVFILVDNFFGGDGRFHAKIEGREFT 144

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++ +  +  I        +   +     +                 E V   + ++
Sbjct: 145 PTERRIVQLLLKIIFEDYKDAWAPVMDVE--FDYLDSEVNPAMANIVSPTEVVVVNSFHI 202

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            ++     F + +P   +     +  +  Q+  ++           +   + V  +  + 
Sbjct: 203 EVDGGGGDFHITMPYSMIEPIRELLDAGVQSDKQDTDMRWSQALKDEIMDVEVGFEATVV 262

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
             + +L+DV+ ++ G VIP         ++       Y C+LG+  +   ++I ++I   
Sbjct: 263 EHQISLRDVMEMQAGDVIPVELP--EYVLMKIEELPTYRCKLGKSREQLALKICEKIPRP 320

Query: 308 Q 308
           +
Sbjct: 321 E 321


>gi|307718611|ref|YP_003874143.1| hypothetical protein STHERM_c09230 [Spirochaeta thermophila DSM
           6192]
 gi|306532336|gb|ADN01870.1| hypothetical protein STHERM_c09230 [Spirochaeta thermophila DSM
           6192]
 gi|315186376|gb|EFU20136.1| flagellar motor switch protein FliM [Spirochaeta thermophila DSM
           6578]
          Length = 341

 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 39/286 (13%), Positives = 97/286 (33%), Gaps = 5/286 (1%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +  S +   + +        ++   V +   S     +   I S          +
Sbjct: 48  SKEQIRTISIMHETFARLTTTSLSAQLRSLVQVHVASVDQLTYEEFIRSIPNPTTIGIIN 107

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +     +  +     +  ++++ L G   +      +R LS +E  + +  + +I   + 
Sbjct: 108 MDPLKGSAILEIDPTITYSIIDRLFGGPGDGSVVPRDRDLSDIETTVMEGIMVRILGNMR 167

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  S   +  P L         +        E V  + +   + +V       IP  T+ 
Sbjct: 168 EAWSQVIDLRPRLGQIDT--NPQFAQIVPPTEMVVLVTLETKVGDVEGMMNFCIPYLTIE 225

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                        +  +  + + +     +   + VN+   +      ++D+++++ G V
Sbjct: 226 PIISKLSAQYWYSSVRKGGTTENLAILKERISSVEVNLVVEVGSMNLKMRDILSIQKGDV 285

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
           I    R K   +L    +  + C  GRVGK   +++ ++I   Q+ 
Sbjct: 286 IMLPTRVKEPLVLKIENRPKFYCRPGRVGKKLAVQLVEKIEESQEV 331


>gi|317048606|ref|YP_004116254.1| flagellar motor switch protein FliM [Pantoea sp. At-9b]
 gi|316950223|gb|ADU69698.1| flagellar motor switch protein FliM [Pantoea sp. At-9b]
          Length = 335

 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 39/301 (12%), Positives = 90/301 (29%), Gaps = 10/301 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
             +  P  P    R+       +   +    +   + +         +    DIS  + +
Sbjct: 32  DGDIRPYDPNTQRRVV------RERLQALEIINERFARHFRMALFNLLRRSPDISVGAIK 85

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
              +     +       +   L        +  S +LV   ++NL G       ++  R 
Sbjct: 86  IQPYHEFARNLPVPTNLNLIHLKPLRGTALVVFSPSLVFIAVDNLFGGDGRFPTKVEGRE 145

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E+++ +R +       +                  +     N     N+ V     
Sbjct: 146 FTHTEQRVIRRMLKLALEGYSDAWKAIYPLDVEYVRSE-MQVKFTNITTSPNDIVVNTPF 204

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNIDTR 245
            + I N+   F + IP   +     + ++   + S  +     D   ++     + +   
Sbjct: 205 QVEIGNLVGEFNICIPFSMIEPLRELLVNPPLENSRQEDNHWRDNLVKQVQHSELELIAH 264

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
                  L  ++ LK G V+P         I   +G  + + + G +   Y +R+   IN
Sbjct: 265 FADVSLRLSRILQLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRVEHLIN 322

Query: 306 F 306
            
Sbjct: 323 P 323


>gi|238758098|ref|ZP_04619278.1| Flagellar motor switch protein fliM [Yersinia aldovae ATCC 35236]
 gi|238703636|gb|EEP96173.1| Flagellar motor switch protein fliM [Yersinia aldovae ATCC 35236]
          Length = 334

 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 36/301 (11%), Positives = 87/301 (28%), Gaps = 10/301 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
             +  P  P    R+       +        +   + +         +    DI+    +
Sbjct: 31  ETDVKPYDPTTQRRVV------RERLHALEIINERFARQFRMGLFNLLRRSPDITVGPIK 84

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
              +     +       +   L           + +LV   ++NL G       ++  R 
Sbjct: 85  IQPYHDFARNLPVPTNLNLIHLKPLRGTALFVFAPSLVFIAVDNLFGGDGRFPTKVEGRE 144

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E+++  R +           +   +          I     N     N+ V T   
Sbjct: 145 FTHTEQRVINRMLRLALDAYRDAWAPIYKIDVEYVRSE-IQVKFTNITTSPNDIVVTTPF 203

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNIDTR 245
            + I  ++  F + IP   +     +  +   + S  +     +   ++     + +   
Sbjct: 204 QVEIGALSGEFNICIPFAMIEPLRELLTNPPLENSRQEDSHWRETLVKQVQHSELELVAN 263

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
                  L  ++ L+ G V+P         I   +G  + + + G +   Y +R+   IN
Sbjct: 264 FVDIPLRLSQILKLQPGDVLPIDKP--DRLIGHVDGVPVLTSQYGTLNGQYALRVEHLIN 321

Query: 306 F 306
            
Sbjct: 322 P 322


>gi|225620315|ref|YP_002721572.1| flagellar motor switch protein FliM [Brachyspira hyodysenteriae
           WA1]
 gi|296126963|ref|YP_003634215.1| flagellar motor switch protein FliM [Brachyspira murdochii DSM
           12563]
 gi|225215134|gb|ACN83868.1| flagellar motor switch protein FliM [Brachyspira hyodysenteriae
           WA1]
 gi|296018779|gb|ADG72016.1| flagellar motor switch protein FliM [Brachyspira murdochii DSM
           12563]
          Length = 343

 Score =  242 bits (617), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 44/319 (13%), Positives = 101/319 (31%), Gaps = 13/319 (4%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           +  H+           +        K   +    +   + +        ++   V I   
Sbjct: 32  EVEHRKIKIYDFKRPDKF------SKDQIRTLQMMHENFARVTTTSLSAQLRTLVGIHVA 85

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
           S     +   I S       +  S+     +  +    ++  T+++ L G   E+  +  
Sbjct: 86  SVDQLTYEEFIRSVSNPSTLAIVSMDPLKGSSILEIDPSITFTIIDRLFGGPGESP-KNL 144

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
           NR L+ +E  + +  I +I   L +  S   +  P L         +       N+ V  
Sbjct: 145 NRELTDIELSVMEGIIVRILGNLREAWSQVIDLRPRLGSIET--NPQFAQMVSPNDMVVL 202

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQLNV 240
           I +   + +V       IP  T+              +     + + +     K   + V
Sbjct: 203 ITLETKVADVEGMMNFCIPYITIEPILSKFSAQYWYASIRRGSTSENLKIIKEKLQNIFV 262

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPF-LHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
                +   +  L D++ L+ G V+ F   +     I     ++ + C  G  G    ++
Sbjct: 263 ETSAELGSMQLPLSDILNLQKGDVVKFTDTKITDPVIFKIGNRKKFLCRPGISGSRMAVQ 322

Query: 300 ITDRINFDQKSLKNFLHKR 318
           +T  ++ +    ++ L K 
Sbjct: 323 LTGVMDGEADITEDDLLKE 341


>gi|261407972|ref|YP_003244213.1| flagellar motor switch protein FliM [Paenibacillus sp. Y412MC10]
 gi|329929322|ref|ZP_08283075.1| flagellar motor switch protein FliM [Paenibacillus sp. HGF5]
 gi|261284435|gb|ACX66406.1| flagellar motor switch protein FliM [Paenibacillus sp. Y412MC10]
 gi|328936691|gb|EGG33134.1| flagellar motor switch protein FliM [Paenibacillus sp. HGF5]
          Length = 332

 Score =  242 bits (617), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 41/316 (12%), Positives = 103/316 (32%), Gaps = 13/316 (4%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           ++ +   K           R        K   +  + +   + ++L   F  ++   V I
Sbjct: 27  LKKEETQKKIRSYDFKRALRF------SKDHIRSLTRIHENFARYLTTYFSAQLRTFVQI 80

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           +    +   +   I S  +  V +            +    N+   +L+ LLG +     
Sbjct: 81  NVVQVEQLPYDEFIRSIPKMTVLNIFEAEPLVGRMVLEVHPNIAYAMLDRLLGGTGIAPS 140

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
            + +  ++ +E  + +R  ++    L +   T  + SP LE        +       NE 
Sbjct: 141 SISS--MTEIETIIMERIFSRAFDSLQEAWKTVLDISPRLEALET--NPQFMQIVSPNET 196

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQ 237
           +  I+++  I +      L IP   L              ++ +    + +D   ++  +
Sbjct: 197 IALISLSTKIGDTTGMINLCIPHVVLEPIMSKLSAHQWFISEKKASVPEEVDALKQRVSK 256

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             + I   + + + T+ + + L +G VI           +    K  +    G +     
Sbjct: 257 AKLPIVAELGVSQLTVSEFLGLSVGDVISLNKPMHDGLSIKVGDKLKFIGSPGTIKDRVA 316

Query: 298 IRITDRINFDQKSLKN 313
           ++I + +    +    
Sbjct: 317 VQIDEIVIEGAEEFDE 332


>gi|312172110|emb|CBX80367.1| Flagellar motor switch protein FliM [Erwinia amylovora ATCC
           BAA-2158]
          Length = 336

 Score =  242 bits (617), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 39/301 (12%), Positives = 95/301 (31%), Gaps = 10/301 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
             +  P  P    R+       +   +    +   + +         +    DI+  + +
Sbjct: 33  DSHIRPYDPNTQRRVV------RERLQALEIINERFARSYRMALFNLLRRSPDITVGAIK 86

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
              +     +       +   L        +  S +LV   ++NL G       ++  R 
Sbjct: 87  IQPYHEFARNLPVPTNLNLIHLKPLRGTALVVFSPSLVFIAVDNLFGGDGRFPTKVEGRE 146

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E+++ +R +       ++                 +     N     N+ V T   
Sbjct: 147 FTHTEQRVIRRMLKLALESYSEAWKPIYPLDVEYVRSE-MQVKFTNITTSPNDIVVTTPF 205

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSSQNKSE-NQSEDLIDPFARKTYQLNVNIDTR 245
           ++ I N+   F + IP   +       ++   ++   + E+  D   ++     + +   
Sbjct: 206 HVEIGNLTGEFNICIPFSMIEPLRETLVNPPLENSLTEDENWRDTLVKQVQHSELELVAN 265

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
                  +  ++ LK G V+P         I   +G  + + + G + K Y +R+   IN
Sbjct: 266 FADVSMRISRLLALKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNKQYALRVEHLIN 323

Query: 306 F 306
            
Sbjct: 324 P 324


>gi|261252329|ref|ZP_05944902.1| flagellar motor switch protein FliM [Vibrio orientalis CIP 102891]
 gi|260935720|gb|EEX91709.1| flagellar motor switch protein FliM [Vibrio orientalis CIP 102891]
          Length = 349

 Score =  241 bits (616), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 33/304 (10%), Positives = 91/304 (29%), Gaps = 11/304 (3%)

Query: 6   IHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSC 65
              +          R+                +   + + +       +    ++S    
Sbjct: 30  TDASAVEFDFSSQDRIVRG------RMPTLELINERFARHMRISLFNMLRKTAEVSINGV 83

Query: 66  QSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNR 125
           Q  KF    ++       +            I     LV  L+EN  G       ++  R
Sbjct: 84  QMMKFGEYQNTLYVPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRFHARIEGR 143

Query: 126 SLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTIN 185
             +  E+++ +  +  +     +  S         E                 E +   +
Sbjct: 144 EFTPTERRIVQLLLKIVFEDYKEAWSPVMGVE--FEYLDSEVNPSMANIVSPTEVIVVSS 201

Query: 186 MNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDT 244
            ++ ++     F +++P   +     +  +  Q+               +   + VN   
Sbjct: 202 FHIEVDGGGGDFHVVMPYSMVEPIRELLDAGVQSDKMETDVRWSTALREEIMDVPVNFRV 261

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
           ++  +  +L+D++ L+ G +IP        A +       +  ++GR G+   ++++++I
Sbjct: 262 QLLEQDISLRDLMELQPGDIIPINMP--EHATMFVEELPTFRTKMGRSGELLAVQVSEKI 319

Query: 305 NFDQ 308
               
Sbjct: 320 KRPD 323


>gi|325273547|ref|ZP_08139778.1| flagellar motor switch protein FliM [Pseudomonas sp. TJI-51]
 gi|324101325|gb|EGB98940.1| flagellar motor switch protein FliM [Pseudomonas sp. TJI-51]
          Length = 322

 Score =  241 bits (616), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 39/277 (14%), Positives = 88/277 (31%), Gaps = 6/277 (2%)

Query: 31  IEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSS 90
                  +   + ++        +    D++    Q  KF   +HS       +   +  
Sbjct: 50  RMPTLEMINERFARYTRISMFNLLRRSADVAVGGVQVMKFGEYVHSLYVPTSLNLVKIKP 109

Query: 91  WSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCI 150
                       LV  L++N  G       ++  R  +  E ++ +  + Q    L +  
Sbjct: 110 LRGTSLFILDAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLDQCFVDLKEAW 168

Query: 151 STTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTT 210
                   + E                +E V     ++ ++       + +P   +    
Sbjct: 169 QAIMPV--SFEYMNSEVNPAMANIVGPSEAVVVSTFHIELDGGGGDLHVTMPYSMIEPVR 226

Query: 211 LISLS-SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLH 269
            +  +  Q+  ++Q E  +         + V +   +  ++  L+D++ ++ G VIP   
Sbjct: 227 EMLDAGFQSDLDDQDERWVKALREDVLDVAVPMTATVARRQLKLRDILHMQPGDVIPVEL 286

Query: 270 REKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                 +L ANG   +   LG    N  ++I D I  
Sbjct: 287 P--EHLVLRANGVPAFKARLGSHKGNLALQIIDPIER 321


>gi|26991047|ref|NP_746472.1| flagellar motor switch protein FliM [Pseudomonas putida KT2440]
 gi|148546747|ref|YP_001266849.1| flagellar motor switch protein FliM [Pseudomonas putida F1]
 gi|24986079|gb|AAN69936.1|AE016632_7 flagellar motor switch protein FliM [Pseudomonas putida KT2440]
 gi|5921670|gb|AAD56294.1| FliM [Pseudomonas putida]
 gi|148510805|gb|ABQ77665.1| flagellar motor switch protein FliM [Pseudomonas putida F1]
 gi|313497806|gb|ADR59172.1| FliM [Pseudomonas putida BIRD-1]
          Length = 322

 Score =  241 bits (616), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 39/277 (14%), Positives = 88/277 (31%), Gaps = 6/277 (2%)

Query: 31  IEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSS 90
                  +   + ++        +    D++    Q  KF   +HS       +   +  
Sbjct: 50  RMPTLEMINERFARYTRISMFNLLRRSADVAVGGVQVMKFGEYVHSLYVPTSLNLVKIKP 109

Query: 91  WSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCI 150
                       LV  L++N  G       ++  R  +  E ++ +  + Q    L +  
Sbjct: 110 LRGTSLFILDAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLDQCFVDLKEAW 168

Query: 151 STTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTT 210
                   + E                +E V     ++ ++       + +P   +    
Sbjct: 169 QAIMPV--SFEYMNSEVNPAMANIVGPSEAVVVSTFHIELDGGGGDLHVTMPYSMIEPVR 226

Query: 211 LISLS-SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLH 269
            +  +  Q+  ++Q E  +         + V +   +  ++  L+D++ ++ G VIP   
Sbjct: 227 EMLDAGFQSDLDDQDERWVKALREDVLDVAVPMTATVARRQLKLRDILHMQPGDVIPVEL 286

Query: 270 REKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                 +L ANG   +   LG    N  ++I D I  
Sbjct: 287 P--EHLVLRANGVPAFKARLGSHKGNLALQIIDPIER 321


>gi|213053037|ref|ZP_03345915.1| flagellar motor switch protein FliM [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
          Length = 320

 Score =  241 bits (616), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 38/301 (12%), Positives = 93/301 (30%), Gaps = 10/301 (3%)

Query: 3   GQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISY 62
           G +   +  P  P    R+       +   +    +   + +         +    DI+ 
Sbjct: 28  GIASDSDIRPYDPNTQRRVV------RERLQALEIINERFARQFRMGLFNLLRRSPDITV 81

Query: 63  TSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQL 122
            + +   +     +       +   L        +  S +LV   ++NL G       ++
Sbjct: 82  GAIRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFITVDNLFGGDGRFPTKV 141

Query: 123 YNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVT 182
             R  +  E+++  R +       +                  +     N     N+ V 
Sbjct: 142 EGREFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVRSE-MQVKFTNITTSPNDIVV 200

Query: 183 TINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVN 241
               ++ I N+   F + +P   +     + ++   + S ++ ++  D   R+     + 
Sbjct: 201 NTPFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRHEDQNWRDNLVRQVQHSELE 260

Query: 242 IDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
           +          L  ++ LK G V+P         I   +G  + + + G V   Y +R+ 
Sbjct: 261 LVANFADIPLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTVNGQYALRVE 318

Query: 302 D 302
            
Sbjct: 319 H 319


>gi|327193028|gb|EGE59940.1| flagellar C-ring motor switch protein [Rhizobium etli CNPAF512]
          Length = 314

 Score =  241 bits (616), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 103/305 (33%), Positives = 168/305 (55%)

Query: 12  PLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFS 71
            + P LLA+LTG LGD+  + KI S+ G +Y +F P + K +  LDV ++Y  C+ G  +
Sbjct: 10  AMDPALLAKLTGGLGDRGRVSKICSAFGEVYSEFFPDVIKSETGLDVTVNYLGCEIGYKN 69

Query: 72  HIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVE 131
           H++     N     A+L +WS N  + C N  VITL+E+LLGA+ ETI +  +R LS +E
Sbjct: 70  HLVDDLSANVTLVDATLRNWSQNITLACGNGFVITLMEHLLGATAETIEEPADRLLSIIE 129

Query: 132 KKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIE 191
             LA     +I+ VL   ++      P+L   +  D   +      +EF   INM++T+ 
Sbjct: 130 LDLAVMVFDKIAKVLRSAVNAPGGFEPSLSAPHAHDARPRPPEDKPDEFAAAINMSLTLA 189

Query: 192 NVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
            + S F LI+PQ  LLKT + +   + ++   S +  +    +  + +V ++ RI L+  
Sbjct: 190 GIVSEFSLIVPQTALLKTKVTAPKPKRQAAGASPEWSEQLGDQVRRSHVTLEARIRLQDL 249

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSL 311
           TL+ +  L +G VIPF         +SAN KE+Y CE GR G+NY +R+ D +N D + +
Sbjct: 250 TLRTISKLMVGDVIPFRDSGDVRVEVSANSKELYVCEFGRSGENYMVRVKDTMNSDDELI 309

Query: 312 KNFLH 316
           ++ ++
Sbjct: 310 RHLMN 314


>gi|301029402|ref|ZP_07192496.1| flagellar motor switch protein FliM [Escherichia coli MS 196-1]
 gi|299877706|gb|EFI85917.1| flagellar motor switch protein FliM [Escherichia coli MS 196-1]
          Length = 334

 Score =  241 bits (616), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 41/303 (13%), Positives = 94/303 (31%), Gaps = 10/303 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +  P  P    R+       +   +    +   + +         +    DI+  +
Sbjct: 30  SGESDIRPYDPNTQRRVV------RERLQALEIINERFARHFRMGLFNLLRRSPDITVGA 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L        +  S +LV   ++NL G       ++  
Sbjct: 84  IRIQPYHEFARNLPVPTNLNLIHLKQLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +       +                  +     N     N+ V   
Sbjct: 144 REFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVRSE-MQVKFTNITTSPNDIVVNT 202

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNID 243
             ++ I N+   F + +P   +     + ++   + S N+ ++  D   R+     + + 
Sbjct: 203 PFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELV 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK G V+P         I   +G  + + + G +   Y +RI   
Sbjct: 263 ANFADISLRLSQILKLKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNGQYALRIEHL 320

Query: 304 INF 306
           IN 
Sbjct: 321 INP 323


>gi|167034915|ref|YP_001670146.1| flagellar motor switch protein FliM [Pseudomonas putida GB-1]
 gi|166861403|gb|ABY99810.1| flagellar motor switch protein FliM [Pseudomonas putida GB-1]
          Length = 322

 Score =  241 bits (616), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 39/277 (14%), Positives = 88/277 (31%), Gaps = 6/277 (2%)

Query: 31  IEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSS 90
                  +   + ++        +    D++    Q  KF   +HS       +   +  
Sbjct: 50  RMPTLEMINERFARYTRISMFNLLRRSADVAVGGVQVMKFGEYVHSLYVPTSLNLVKIKP 109

Query: 91  WSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCI 150
                       LV  L++N  G       ++  R  +  E ++ +  + Q    L +  
Sbjct: 110 LRGTSLFILDAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLDQCFVDLKEAW 168

Query: 151 STTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTT 210
                 +   E                +E V     ++ ++       + +P   +    
Sbjct: 169 QAIMPVT--FEYMNSEVNPAMANIVGPSEAVVVSTFHIELDGGGGDLHVTMPYSMIEPVR 226

Query: 211 LISLS-SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLH 269
            +  +  Q+  ++Q E  +         + V +   +  ++  L+D++ ++ G VIP   
Sbjct: 227 EMLDAGFQSDLDDQDERWVKALREDVLDVAVPMTATVARRQLKLRDILHMQPGDVIPVEL 286

Query: 270 REKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                 +L ANG   +   LG    N  ++I D I  
Sbjct: 287 P--EHLVLRANGVPAFKARLGSHKGNLALQIIDPIER 321


>gi|323491452|ref|ZP_08096636.1| flagellar motor switch protein FliM [Vibrio brasiliensis LMG 20546]
 gi|323314321|gb|EGA67401.1| flagellar motor switch protein FliM [Vibrio brasiliensis LMG 20546]
          Length = 349

 Score =  241 bits (616), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 34/303 (11%), Positives = 92/303 (30%), Gaps = 11/303 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
             +          R+                +   + + +       +    ++S    Q
Sbjct: 31  DASAVDFDFSSQDRIVRG------RMPTLELINERFARHMRISLFNMLRKTAEVSINGVQ 84

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
             KF    ++       +            I     LV  L+EN  G       ++  R 
Sbjct: 85  MMKFGEYQNTLYVPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRFHARIEGRE 144

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E+++ +  +  +     +  S         E                 E +   + 
Sbjct: 145 FTPTERRIVQLLLKIVFEDYKEAWSPVMGVE--FEYLDSEVNPSMANIVSPTEVIVVSSF 202

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTR 245
           ++ ++     F +++P   +     +  +  Q+               +   + VN    
Sbjct: 203 HIEVDGGGGDFHVVMPYSMVEPIRELLDAGVQSDKMETDVRWSTALREEIMDVPVNFRVD 262

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           +  +  +L+D++ L+ G +IP        A++       +  ++GR G+N  ++++++I 
Sbjct: 263 LLEQDISLRDLMELQPGDIIPVTMP--EHAVMFVEELPTFRVKMGRSGENLAVQVSEKIK 320

Query: 306 FDQ 308
              
Sbjct: 321 RPD 323


>gi|52080234|ref|YP_079025.1| flagellar motor switch protein FliM [Bacillus licheniformis ATCC
           14580]
 gi|52785611|ref|YP_091440.1| flagellar motor switch protein FliM [Bacillus licheniformis ATCC
           14580]
 gi|319645987|ref|ZP_08000217.1| FliM protein [Bacillus sp. BT1B_CT2]
 gi|52003445|gb|AAU23387.1| flagellar motor switch protein [Bacillus licheniformis ATCC 14580]
 gi|52348113|gb|AAU40747.1| FliM [Bacillus licheniformis ATCC 14580]
 gi|317391737|gb|EFV72534.1| FliM protein [Bacillus sp. BT1B_CT2]
          Length = 332

 Score =  241 bits (616), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 39/285 (13%), Positives = 96/285 (33%), Gaps = 7/285 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +  + +   + + L   F  ++   + IS +S     +   I S     + +   
Sbjct: 49  SKDQIRSLTRIHDNFARLLTTYFSAQLRTYIQISVSSVDQVPYEEFIRSIPNMTILNLFE 108

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +        +  +  +  T+++ ++G    +  ++ +  ++ +E K+             
Sbjct: 109 VRPLEGRIMMEINPTIAYTMMDRVMGGIGSSHNKIDS--MTEIETKIMSNLFESCLTNYK 166

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
               +  E  P + DF      +       NE V  I++N  I +++    L IP   L 
Sbjct: 167 DAWESITEIEPEMSDFEV--NPQFVQMVSPNETVVVISLNTQIGDISGVINLCIPHVVLE 224

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                       Q+       +      ++     + I   +   + T+++ + L+IG  
Sbjct: 225 PIIPKLSVHYWMQSDRIEPKPEETKSIEKRILTAQIPIVAELGSSELTIEEFLNLEIGDC 284

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
           I           +    K  +  + GR+ +   I+I D     ++
Sbjct: 285 ITLDKSVAEPLTVLVGDKPKFLAQAGRMNRKTAIQILDHDIRGEE 329


>gi|332799187|ref|YP_004460686.1| flagellar motor switch protein FliM [Tepidanaerobacter sp. Re1]
 gi|332696922|gb|AEE91379.1| flagellar motor switch protein FliM [Tepidanaerobacter sp. Re1]
          Length = 331

 Score =  241 bits (616), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 46/313 (14%), Positives = 98/313 (31%), Gaps = 13/313 (4%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           ++ + + K   P       +        K      S +   + + L      ++   V I
Sbjct: 27  IKSKELDKKVKPYDFKRPNKF------SKEQLHTLSMIHENFARLLTTYLSAQLRTVVQI 80

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           +    +   ++  I S     + +    S       +  + ++  ++++ LLG   E   
Sbjct: 81  NVFFVEQMTYNEFIFSIPNPSLIAVVDFSPLKGAAIMEINPSIAFSIIDRLLGGPGEYSG 140

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           +L  R  + +E  + ++  ++++ +L+       +    LE        +       NE 
Sbjct: 141 KL--REPTEIETGIIEKVFSKMTRILSDAWKDIADIQTTLEKLET--NSQFVQLVSPNEA 196

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQ 237
           V  I  N  + N      + IP   L                 + Q+E        K Y 
Sbjct: 197 VALITFNAKVGNSEGMINICIPHIVLEPIIPKLSTRIWLSTSKQEQAETTKQFITEKVYD 256

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
               I   +     T+ + + L  G VI      K  A +    K  +S  +G       
Sbjct: 257 TKTEIRAELGRTLITVGEFINLATGDVIALNKNIKDGADIFIKDKLKFSGSIGVHRNKMA 316

Query: 298 IRITDRINFDQKS 310
           I+I  +     + 
Sbjct: 317 IKIQKKFGEGGEF 329


>gi|304398862|ref|ZP_07380732.1| flagellar motor switch protein FliM [Pantoea sp. aB]
 gi|304353566|gb|EFM17943.1| flagellar motor switch protein FliM [Pantoea sp. aB]
          Length = 335

 Score =  241 bits (615), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 38/306 (12%), Positives = 90/306 (29%), Gaps = 10/306 (3%)

Query: 2   RGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDIS 61
           +      +  P  P    R+       +   +    +   + +         +    DIS
Sbjct: 27  KQNGPEGDIRPYDPNTQRRVV------RERLQALEIINERFARSFRMALFNLLRRSPDIS 80

Query: 62  YTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQ 121
             + +   +     +       +   L        +  S +LV   ++NL G       +
Sbjct: 81  VGAIKIQPYHEFARNLPVPTNLNLIHLKPLRGTALVVFSPSLVFIAVDNLFGGDGRFPTK 140

Query: 122 LYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFV 181
           +  R  +  E+++ +R +       +                  +     N     N+ V
Sbjct: 141 VEGREFTHTEQRVIRRMLKLALDGYSDAWKAIYPLDVEYVRSE-MQVKFTNITTSPNDIV 199

Query: 182 TTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNV 240
                 + I N+   F + IP   +     + ++   + S  +     D   ++     +
Sbjct: 200 VNTPFQVEIGNLVGEFNICIPFSMIEPLRELLVNPPLENSRQEDNHWRDNLVKQVQHSEL 259

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            +          L  ++ LK G V+P         I   +   + + + G +   Y +R+
Sbjct: 260 ELIAHFAETSLRLSRILQLKPGDVLPIEKP--ERIIAHVDSVPVLTSQYGTMNGQYALRV 317

Query: 301 TDRINF 306
              IN 
Sbjct: 318 EHLINP 323


>gi|308187297|ref|YP_003931428.1| Flagellar motor switch protein fliM [Pantoea vagans C9-1]
 gi|308057807|gb|ADO09979.1| Flagellar motor switch protein fliM [Pantoea vagans C9-1]
          Length = 335

 Score =  241 bits (615), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 38/306 (12%), Positives = 90/306 (29%), Gaps = 10/306 (3%)

Query: 2   RGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDIS 61
           +      +  P  P    R+       +   +    +   + +         +    DIS
Sbjct: 27  KQNGPEGDIRPYDPNTQRRVV------RERLQALEIINERFARSFRMTLFNLLRRSPDIS 80

Query: 62  YTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQ 121
             + +   +     +       +   L        +  S +LV   ++NL G       +
Sbjct: 81  VGAIKIQPYHEFARNLPVPTNLNLIHLKPLRGTALVVFSPSLVFIAVDNLFGGDGRFPTK 140

Query: 122 LYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFV 181
           +  R  +  E+++ +R +       +                  +     N     N+ V
Sbjct: 141 VEGREFTHTEQRVIRRMLKLALDGYSDAWKAIYPLDVEYVRSE-MQVKFTNITTSPNDIV 199

Query: 182 TTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNV 240
                 + I N+   F + IP   +     + ++   + S  +     D   ++     +
Sbjct: 200 VNTPFQVEIGNLVGEFNICIPFSMIEPLRELLVNPPLENSRQEDNHWRDNLVKQVQHSEL 259

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            +          L  ++ LK G V+P         I   +   + + + G +   Y +R+
Sbjct: 260 ELIAHFAETSLRLSRILQLKPGDVLPIEKP--ERIIAHVDSVPVLTSQYGTMNGQYALRV 317

Query: 301 TDRINF 306
              IN 
Sbjct: 318 EHLINP 323


>gi|297584047|ref|YP_003699827.1| flagellar motor switch protein FliM [Bacillus selenitireducens
           MLS10]
 gi|297142504|gb|ADH99261.1| flagellar motor switch protein FliM [Bacillus selenitireducens
           MLS10]
          Length = 333

 Score =  241 bits (615), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 44/311 (14%), Positives = 108/311 (34%), Gaps = 13/311 (4%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           ++ +   K           R        K   +  + +   + + L      ++   V I
Sbjct: 27  LKKEETQKKIKTYDFKRALRF------SKDQIRSLTRIHENFARLLTTQLSAQLRTFVQI 80

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S  S     +   I S  +  + +          F +  + N+   +L+ +LG   E   
Sbjct: 81  SVASVDQLPYDEFIRSVPKQTILNVFEPYPLDGRFVLEVNPNIAYAMLDRMLGGQGEAYN 140

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++ N  L+ +E K+  +   +      +   + +E  P ++D       +       NE 
Sbjct: 141 KVDN--LTEIEAKIMTQLFQRTLETFREAWLSVEEIDPMMDDLEV--NPQFLQLVSPNET 196

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQ 237
           V  I+ + TI   +    + +P   +             Q K + +    I+       +
Sbjct: 197 VVVISFSTTIGESSGMINICLPHVVIEPLLPKLSVHLWMQTKKKERKPGEIEALELNIKR 256

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             +++  ++   + T+++ V L +G  I           ++  G   Y  + G+V ++  
Sbjct: 257 APLDVAVQLGQSEITIEEFVHLAVGDTIELNQSIDELLRMTVGGSPKYKVQPGKVKEHLA 316

Query: 298 IRITDRINFDQ 308
           ++I + I  ++
Sbjct: 317 VQIVEDIEEEE 327


>gi|269961627|ref|ZP_06175989.1| flagellar motor switch protein [Vibrio harveyi 1DA3]
 gi|269833668|gb|EEZ87765.1| flagellar motor switch protein [Vibrio harveyi 1DA3]
          Length = 348

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 36/295 (12%), Positives = 85/295 (28%), Gaps = 11/295 (3%)

Query: 13  LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSH 72
                  R+                +   + + +       +    ++S    Q  KF  
Sbjct: 37  FDFSSQDRIVRG------RMPTLELINERFARHMRISLFNMLRKTAEVSINGVQMMKFGE 90

Query: 73  IIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEK 132
             ++       +            I     LV  L+EN  G       ++  R  +  E+
Sbjct: 91  YQNTLYVPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRFHAKIEGREFTPTER 150

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
           ++ +  +  +     +  S         E                 E +   + ++ ++ 
Sbjct: 151 RIIQLLLKIVFEDYKEAWSPVMGVE--FEYLDSEVNPSMANIVSPTEVIVVSSFHIEVDG 208

Query: 193 VASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
               F +++P   +     +  +  Q+               +     VN    +  K  
Sbjct: 209 GGGDFHVVMPYSMVEPIRELLDAGVQSDKMETDVRWSSALREEIMDCPVNFRVNLLEKDI 268

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
           +L+D++ L+ G VIP        A +       Y  ++GR      ++I++ I  
Sbjct: 269 SLRDLMELQPGDVIPIEMP--EHATMFIEDLPTYRVKMGRSEDKMAVQISEEIER 321


>gi|117919797|ref|YP_868989.1| flagellar motor switch protein FliM [Shewanella sp. ANA-3]
 gi|117612129|gb|ABK47583.1| flagellar motor switch protein FliM [Shewanella sp. ANA-3]
          Length = 343

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 40/301 (13%), Positives = 90/301 (29%), Gaps = 11/301 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
                      R+                +   + + L       M    ++S    Q  
Sbjct: 32  EARSYDFSSQDRIVRG------RMPTLEIVNERFARHLRISMFNMMRRAAEVSINGVQML 85

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           KF   +H+       +            I     LV  L++N  G       ++  R  +
Sbjct: 86  KFGEYVHTLFVPTSLNMVRFHPLKGTALITMEARLVFILVDNFFGGDGRFHAKIEGREFT 145

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++ +  +  I        +   +     +                 E V   + ++
Sbjct: 146 PTERRIVQLLLKIIFEDYKDAWAPVMDVE--FDYLDSEVNPAMANIVSPTEVVVINSFHI 203

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            ++     F + +P   +     +  +  Q+  ++           +   + V  D  + 
Sbjct: 204 EVDGGGGDFHITMPYSMIEPIRELLDAGVQSDKQDTDMRWSQALHDEIMDVKVGFDASVV 263

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
             + TLKDV+  K G +IP         ++       Y C++GR   N  ++I ++I   
Sbjct: 264 EHELTLKDVMNFKAGDIIPIELP--EYIMMKIEDLPTYRCKMGRSRDNLALKIYEKIPRP 321

Query: 308 Q 308
           +
Sbjct: 322 E 322


>gi|212634374|ref|YP_002310899.1| flagellar motor switch protein FliM [Shewanella piezotolerans WP3]
 gi|212555858|gb|ACJ28312.1| Flagellar motor switch protein FliM [Shewanella piezotolerans WP3]
          Length = 342

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 43/301 (14%), Positives = 97/301 (32%), Gaps = 11/301 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +          R+                +   + + L       M    ++S    Q  
Sbjct: 31  DARAYDFSSQDRIVRG------RMPTLEIVNERFARHLRISMFNMMRRAAEVSINGVQML 84

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           KF   +H+       +    S       I     LV  L++N  G       ++  R  +
Sbjct: 85  KFGEYVHTLFVPTSLNMVRFSPLKGTALITMEARLVFILVDNFFGGDGRFHAKIEGREFT 144

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++ +  +  I     +  +   +     +                 E V   + ++
Sbjct: 145 PTERRIVQLLLKIIFEDYKEAWAPVMDVE--FDYLDSEVNPAMANIVSPTEVVVVSSFHI 202

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            ++     F + +P   +     +  +  Q+ +++           +   ++V ID  + 
Sbjct: 203 EVDGGGGDFHITMPYSMIEPIRELLDAGVQSDTQDTDMRWSQALRDEIMDVDVGIDATVV 262

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
             + TL+DV+  K G VIP         IL       Y C++G+  +N  ++I ++I   
Sbjct: 263 EHQVTLRDVLEFKAGDVIPVELP--EHIILKVEDLPTYRCKMGKTKENLALKICEQIQRP 320

Query: 308 Q 308
           +
Sbjct: 321 E 321


>gi|322833203|ref|YP_004213230.1| flagellar motor switch protein FliM [Rahnella sp. Y9602]
 gi|321168404|gb|ADW74103.1| flagellar motor switch protein FliM [Rahnella sp. Y9602]
          Length = 340

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 43/308 (13%), Positives = 94/308 (30%), Gaps = 10/308 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
                P  P    R+       +   +    +   + +         +    DI+  + +
Sbjct: 37  DDGVKPFDPTTQRRVV------RERLQALEIINERFARHFRMGLFNLLRRSPDITVGAIK 90

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
              +     +       +   L           + +LV   ++NL G       ++  R 
Sbjct: 91  IQPYHDFARNLPVPTNLNLIHLKPLRGTALFVFAPSLVFIAVDNLFGGDGRFPTKVEGRE 150

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E+++ KR +           S   + S        +     N     N+ V T   
Sbjct: 151 FTHTEQRVIKRMLRLALDAYEDAWSGVYKLSVEYVRAE-LQIKFTNITSSPNDIVVTTPF 209

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQLNVNIDTR 245
           ++ I  ++  F + IP   +     +  +     S N+     +    +  Q  + +   
Sbjct: 210 HVEIGALSGDFNICIPFSMIEPLRELLTNPPVENSRNEESQWRENLVHQVQQSELELVAN 269

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
                  L  ++ LK G V+P         I   +G  + + + G + + Y +R+   IN
Sbjct: 270 FVEIPLRLSQILKLKPGDVLPIEKP--DRLIAHVDGVPVLTSQYGTLNEQYALRVEHLIN 327

Query: 306 FDQKSLKN 313
               SL  
Sbjct: 328 PILNSLDE 335


>gi|311030119|ref|ZP_07708209.1| flagellar motor switch protein FliM [Bacillus sp. m3-13]
          Length = 332

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 49/312 (15%), Positives = 111/312 (35%), Gaps = 13/312 (4%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           ++ ++  K           R        K   +  + +   + + L   F  ++   + I
Sbjct: 28  LKKENQEKKVKVYDFKRALRF------SKDQIRNLTRIHENFARLLTTYFSAQLRTYIQI 81

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S  S     +   I S  +  + +   ++       +  +  +   +L+  LG     + 
Sbjct: 82  SVASVDQLPYEEFIRSIPKMTILNVFEVAPLEGRVVLEINPTIAYAMLDRQLGGKGTGVN 141

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++ +  L+ +E KL             +   T  +  P L D       +       NE 
Sbjct: 142 KVDS--LTEIETKLMTTLFEGAIENFGEAWDTIADIQPFLSDLEV--NPQFLQLVSPNET 197

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQ 237
           V  I+MN+TI  V     + IP   L             + K++ + +  I    +    
Sbjct: 198 VIVISMNITIGEVTGMINICIPHVVLEPVIPKLSAHYWMEEKNKVRQDHEIATLEKAIRA 257

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             + + T +   + +  D++ + IG V+P   +     I+  + K  +  ++G+V KN  
Sbjct: 258 TALTVTTELGHSEISFSDLLNITIGDVLPLQQKIDEPIIVKVDNKPSFYGQVGQVKKNMA 317

Query: 298 IRITDRINFDQK 309
           ++I ++I    +
Sbjct: 318 VQILEKIKEGYE 329


>gi|15642125|ref|NP_231757.1| flagellar motor switch protein FliM [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121586821|ref|ZP_01676603.1| flagellar motor switch protein FliM [Vibrio cholerae 2740-80]
 gi|121727171|ref|ZP_01680338.1| flagellar motor switch protein FliM [Vibrio cholerae V52]
 gi|147675314|ref|YP_001217648.1| flagellar motor switch protein FliM [Vibrio cholerae O395]
 gi|153213269|ref|ZP_01948681.1| flagellar motor switch protein FliM [Vibrio cholerae 1587]
 gi|153803040|ref|ZP_01957626.1| flagellar motor switch protein FliM [Vibrio cholerae MZO-3]
 gi|153818973|ref|ZP_01971640.1| flagellar motor switch protein FliM [Vibrio cholerae NCTC 8457]
 gi|153822893|ref|ZP_01975560.1| flagellar motor switch protein FliM [Vibrio cholerae B33]
 gi|153825557|ref|ZP_01978224.1| flagellar motor switch protein FliM [Vibrio cholerae MZO-2]
 gi|153828607|ref|ZP_01981274.1| flagellar motor switch protein FliM [Vibrio cholerae 623-39]
 gi|227082251|ref|YP_002810802.1| flagellar motor switch protein FliM [Vibrio cholerae M66-2]
 gi|229507789|ref|ZP_04397294.1| flagellar motor switch protein FliM [Vibrio cholerae BX 330286]
 gi|229511974|ref|ZP_04401453.1| flagellar motor switch protein FliM [Vibrio cholerae B33]
 gi|229513777|ref|ZP_04403239.1| flagellar motor switch protein FliM [Vibrio cholerae TMA 21]
 gi|229519110|ref|ZP_04408553.1| flagellar motor switch protein FliM [Vibrio cholerae RC9]
 gi|229528862|ref|ZP_04418252.1| flagellar motor switch protein FliM [Vibrio cholerae 12129(1)]
 gi|229607334|ref|YP_002877982.1| flagellar motor switch protein FliM [Vibrio cholerae MJ-1236]
 gi|254226360|ref|ZP_04919949.1| flagellar motor switch protein FliM [Vibrio cholerae V51]
 gi|254291362|ref|ZP_04962155.1| flagellar motor switch protein FliM [Vibrio cholerae AM-19226]
 gi|254849211|ref|ZP_05238561.1| flagellar motor switch protein FliM [Vibrio cholerae MO10]
 gi|255745135|ref|ZP_05419084.1| flagellar motor switch protein FliM [Vibrio cholera CIRS 101]
 gi|262153475|ref|ZP_06028605.1| flagellar motor switch protein FliM [Vibrio cholerae INDRE 91/1]
 gi|262167485|ref|ZP_06035191.1| flagellar motor switch protein FliM [Vibrio cholerae RC27]
 gi|262191375|ref|ZP_06049565.1| flagellar motor switch protein FliM [Vibrio cholerae CT 5369-93]
 gi|298497852|ref|ZP_07007659.1| flagellar motor switch protein FliM [Vibrio cholerae MAK 757]
 gi|9656676|gb|AAF95271.1| flagellar motor switch protein FliM [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121548988|gb|EAX59027.1| flagellar motor switch protein FliM [Vibrio cholerae 2740-80]
 gi|121630416|gb|EAX62809.1| flagellar motor switch protein FliM [Vibrio cholerae V52]
 gi|124116069|gb|EAY34889.1| flagellar motor switch protein FliM [Vibrio cholerae 1587]
 gi|124121438|gb|EAY40181.1| flagellar motor switch protein FliM [Vibrio cholerae MZO-3]
 gi|125621110|gb|EAZ49455.1| flagellar motor switch protein FliM [Vibrio cholerae V51]
 gi|126510468|gb|EAZ73062.1| flagellar motor switch protein FliM [Vibrio cholerae NCTC 8457]
 gi|126519589|gb|EAZ76812.1| flagellar motor switch protein FliM [Vibrio cholerae B33]
 gi|146317197|gb|ABQ21736.1| flagellar motor switch protein FliM [Vibrio cholerae O395]
 gi|148875878|gb|EDL74013.1| flagellar motor switch protein FliM [Vibrio cholerae 623-39]
 gi|149740708|gb|EDM54807.1| flagellar motor switch protein FliM [Vibrio cholerae MZO-2]
 gi|150422692|gb|EDN14646.1| flagellar motor switch protein FliM [Vibrio cholerae AM-19226]
 gi|227010139|gb|ACP06351.1| flagellar motor switch protein FliM [Vibrio cholerae M66-2]
 gi|227014022|gb|ACP10232.1| flagellar motor switch protein FliM [Vibrio cholerae O395]
 gi|229332636|gb|EEN98122.1| flagellar motor switch protein FliM [Vibrio cholerae 12129(1)]
 gi|229343799|gb|EEO08774.1| flagellar motor switch protein FliM [Vibrio cholerae RC9]
 gi|229348958|gb|EEO13915.1| flagellar motor switch protein FliM [Vibrio cholerae TMA 21]
 gi|229351939|gb|EEO16880.1| flagellar motor switch protein FliM [Vibrio cholerae B33]
 gi|229355294|gb|EEO20215.1| flagellar motor switch protein FliM [Vibrio cholerae BX 330286]
 gi|229369989|gb|ACQ60412.1| flagellar motor switch protein FliM [Vibrio cholerae MJ-1236]
 gi|254844916|gb|EET23330.1| flagellar motor switch protein FliM [Vibrio cholerae MO10]
 gi|255736965|gb|EET92361.1| flagellar motor switch protein FliM [Vibrio cholera CIRS 101]
 gi|262024057|gb|EEY42752.1| flagellar motor switch protein FliM [Vibrio cholerae RC27]
 gi|262030712|gb|EEY49346.1| flagellar motor switch protein FliM [Vibrio cholerae INDRE 91/1]
 gi|262032750|gb|EEY51298.1| flagellar motor switch protein FliM [Vibrio cholerae CT 5369-93]
 gi|297542185|gb|EFH78235.1| flagellar motor switch protein FliM [Vibrio cholerae MAK 757]
 gi|327484654|gb|AEA79061.1| Flagellar motor switch protein FliM [Vibrio cholerae LMA3894-4]
          Length = 349

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 36/302 (11%), Positives = 92/302 (30%), Gaps = 11/302 (3%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
            + +        R+                +   + + L       +    ++S    Q 
Sbjct: 32  PSATNFDFSSQDRIVRG------RMPTLELINERFARHLRISLFNMLRKTAEVSINGVQM 85

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSL 127
            KF    ++       +            +     LV  L+EN  G       ++  R  
Sbjct: 86  MKFGEYQNTLYVPTSLNMVRFRPLKGTALVTMEARLVFILVENFFGGDGRYHARIEGREF 145

Query: 128 STVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMN 187
           +  E+++ +  +  + A   +  S         E                 E +   + +
Sbjct: 146 TPTERRVIQLLLKIVFADYKEAWSPVMGVE--FEYLDSEVNPSMANIVSPTEVIVVSSFH 203

Query: 188 MTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRI 246
           + ++     F +++P   +     +  +  Q+               +   + VN    +
Sbjct: 204 VEVDGGGGDFHMVMPYSMVEPIRELLDAGVQSDKMETDVRWSTALREEIMDVPVNFRVNL 263

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                 L+D++ L++G VIP        A++       Y  ++GR G+   ++++++I  
Sbjct: 264 LEMDIALRDLMELQVGDVIPIKMP--EHAVMFVEELPTYRVKMGRSGEKLAVQVSEKIKR 321

Query: 307 DQ 308
             
Sbjct: 322 PD 323


>gi|15615009|ref|NP_243312.1| flagellar motor switch protein FliM [Bacillus halodurans C-125]
 gi|10175066|dbj|BAB06165.1| flagellar motor switch protein [Bacillus halodurans C-125]
          Length = 330

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 50/285 (17%), Positives = 104/285 (36%), Gaps = 7/285 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +  S +   + + L   F  ++   V IS  S     +   I S  +  + +   
Sbjct: 48  SKDQIRSISRIHENFARLLTTYFSAQLRTFVQISVASVDQLPYEEFIRSIPKMTILNVFE 107

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
            +     F I  + N+   +L+ LLG    ++ ++ N  L+ +E ++  +   +      
Sbjct: 108 PAPLDGRFLIEVNPNVAYAMLDRLLGGQGVSVNKVDN--LTEIETRIMSQLFQRTLDSFQ 165

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  ST  E  P ++        +       NE V  I+++ TI   +    + +P   L 
Sbjct: 166 EAWSTVIELEPEMDAVEV--NPQFLQMVSPNETVVVISLSTTIAETSGMINICLPHVVLE 223

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
           +           Q K + +    +D    +  Q  + I T +   + T+ + + L IG V
Sbjct: 224 EVLPKLSVHYWMQEKKKQRQPGELDSIEHRVRQAPLLIQTELGRSEITIHEFLHLGIGDV 283

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
           I           +   G   Y  + G+   +  +++TD I    +
Sbjct: 284 IELDQSIHEPLNVRVGGHLKYLAQPGKKKNHLAVQVTDVIEEAAE 328


>gi|310767337|gb|ADP12287.1| flagellar motor switch protein [Erwinia sp. Ejp617]
          Length = 336

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 40/301 (13%), Positives = 94/301 (31%), Gaps = 10/301 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
             +  P  P    R+       +   +    +   + +         +    DI+  + +
Sbjct: 33  DSHIRPYDPNTQRRVV------RERLQALEIINERFARSYRMALFNLLRRSPDITVGAIK 86

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
              +     +       +   L        +  S +LV   ++NL G       ++  R 
Sbjct: 87  IQPYHEFARNLPVPTNLNLIHLKPLRGTALVVFSPSLVFIAVDNLFGGDGRFPTKVEGRE 146

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E+++ +R +       ++                 +     N     N+ V T   
Sbjct: 147 FTHTEQRVIRRMLKLALEGYSEAWKPIYPLDVEYVRSE-MQVKFTNITTSPNDIVVTTPF 205

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQLNVNIDTR 245
           ++ I N+   F + IP   +       ++     S  + E+  D   ++     + +   
Sbjct: 206 HVEIGNLTGEFNICIPFSMIEPLRETLVNPPIENSLTEDENWRDTLVKQVQHSELELVAN 265

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
                  +  ++ LK G V+P         I   +G  + + + G + K Y +R+   IN
Sbjct: 266 FADVSMRISRLLALKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNKQYALRVEHLIN 323

Query: 306 F 306
            
Sbjct: 324 P 324


>gi|170722847|ref|YP_001750535.1| flagellar motor switch protein FliM [Pseudomonas putida W619]
 gi|169760850|gb|ACA74166.1| flagellar motor switch protein FliM [Pseudomonas putida W619]
          Length = 322

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 40/277 (14%), Positives = 89/277 (32%), Gaps = 6/277 (2%)

Query: 31  IEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSS 90
                  +   + ++        +    D++    Q  KF   +HS       +   +  
Sbjct: 50  RMPTLEMINERFARYTRISMFNLLRRSADVAVGGVQVMKFGEYVHSLYVPTSLNLVKIKP 109

Query: 91  WSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCI 150
                       LV  L++N  G       ++  R  +  E ++ +  + Q    L +  
Sbjct: 110 LRGTSLFILDAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLDQCFIDLKEAW 168

Query: 151 STTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTT 210
                 +   E                +E V     ++ ++       + +P   +    
Sbjct: 169 QAIMPVN--FEYMNSEVNPAMANIVGPSEAVVVSTFHIELDGGGGDLHVTMPYSMIEPVR 226

Query: 211 LISLS-SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLH 269
            +  +  Q+  ++Q E  +         ++V +   +  ++  L+DV+ ++ G VIP   
Sbjct: 227 EMLDAGFQSDLDDQDERWVKALREDVLDVSVPLSATVARRQLKLRDVLHMQPGDVIPVEL 286

Query: 270 REKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                 +L ANG   +   LG    N  ++I D I  
Sbjct: 287 P--EHLVLRANGVPSFKARLGSHKGNLALQIIDPIER 321


>gi|91223552|ref|ZP_01258817.1| flagellar motor switch protein M [Vibrio alginolyticus 12G01]
 gi|269965696|ref|ZP_06179809.1| flagellar motor switch protein [Vibrio alginolyticus 40B]
 gi|91191638|gb|EAS77902.1| flagellar motor switch protein M [Vibrio alginolyticus 12G01]
 gi|269829764|gb|EEZ84000.1| flagellar motor switch protein [Vibrio alginolyticus 40B]
          Length = 348

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 35/295 (11%), Positives = 85/295 (28%), Gaps = 11/295 (3%)

Query: 13  LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSH 72
                  R+                +   + + +       +    ++S    Q  KF  
Sbjct: 37  FDFSSQDRIVRG------RMPTLELINERFARHMRISLFNMLRKTAEVSINGVQMMKFGE 90

Query: 73  IIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEK 132
             ++       +            I     LV  L+EN  G       ++  R  +  E+
Sbjct: 91  YQNTLYVPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRFHAKIEGREFTPTER 150

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
           ++ +  +  +     +  S         E                 E +   + ++ ++ 
Sbjct: 151 RIIQLLLKIVFEDYKEAWSPVMGVE--FEYLDSEVNPSMANIVSPTEVIVVSSFHIEVDG 208

Query: 193 VASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
               F +++P   +     +  +  Q+               +     VN    +  K  
Sbjct: 209 GGGDFHVVMPYSMVEPIRELLDAGVQSDKMETDVRWSSALREEIMDCPVNFRVNLLEKDI 268

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
           +L+D++ L+ G +IP        A +       Y  ++GR      ++I++ I  
Sbjct: 269 SLRDLMELQPGDIIPIEMP--EHATMFVEDLPTYRVKMGRSEDKLAVQISEEIER 321


>gi|42524697|ref|NP_970077.1| flagellar motor switch protein FliM [Bdellovibrio bacteriovorus
           HD100]
 gi|39576907|emb|CAE78136.1| flagellar motor switch protein FliM [Bdellovibrio bacteriovorus
           HD100]
          Length = 333

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 33/306 (10%), Positives = 95/306 (31%), Gaps = 10/306 (3%)

Query: 3   GQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISY 62
           G+   +           R+                +   + +         +     I+ 
Sbjct: 36  GKVDERKIVSYDLTSQDRIIRG------RLPQLEVIYEKFMRAFRVSLSSALRKIASITL 89

Query: 63  TSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQL 122
           TS +  KF   I++       S     +   +      + L   L+++  G +     ++
Sbjct: 90  TSTEFLKFGEFINTLPMPTCMSVLRFGNLRGSALFVIESKLAYALVDSFFGGADRPYTKI 149

Query: 123 YNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVT 182
             +  + +E  + ++ +      +    ++ ++   +          +        + V 
Sbjct: 150 DGKDFTPIELSIVQKVVGLAINDMEMAWASIEKIGCSFVR--TEVNPQFVGIVPPTDVVI 207

Query: 183 TINMNMTIENVASSFVLIIPQETLLKTTLISL-SSQNKSENQSED-LIDPFARKTYQLNV 240
               ++ +EN   +  ++IP  T+           Q +++   +         +  + ++
Sbjct: 208 ASTFDVELENATGTISIVIPYATIEPIKQKLQTGFQVETDQTDKKLWTAIIQEQLLETDM 267

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            I   +   +  LKD++ LK+G VIP          ++  G   +    G       +++
Sbjct: 268 EIKVNLGETEIKLKDLMNLKVGDVIPLDQDASGEFDVAVEGVRKFKGYYGIHHGTVAVQV 327

Query: 301 TDRINF 306
           T  +  
Sbjct: 328 TRPVEK 333


>gi|288553053|ref|YP_003424988.1| flagellar motor switch protein FliM [Bacillus pseudofirmus OF4]
 gi|288544213|gb|ADC48096.1| flagellar motor switch protein FliM [Bacillus pseudofirmus OF4]
          Length = 330

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 44/285 (15%), Positives = 104/285 (36%), Gaps = 7/285 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +  + +   + + L   F  ++   V IS  S     +   I S  +  + +   
Sbjct: 48  SKDQVRSLTRIHENFARLLTTYFSAQLRTFVQISVASVDQLPYEEFIRSIPKMTILNVFE 107

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
                    +  + N+   +L+ LLG    +I ++ N  L+ +E ++  +   +      
Sbjct: 108 PYPLEGRLLMEVNPNVAYAMLDRLLGGKGISINKIEN--LTEIETRIMSQLFQRTLDSFE 165

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  S+  E  P +E+       +       NE V  I+++ TI   +    + +P   L 
Sbjct: 166 EAWSSVVEMDPVMEEIEV--NPQFLQMVSPNETVVVISLSTTIAETSGMINICLPHVVLE 223

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
           +           Q K +       +    K  +  + I + +   + T+ + + L  G V
Sbjct: 224 EVLPKLSVHYWMQEKKKQHQPGEKEAIEAKIKKAPLLIQSELGRSEITINEFLQLGEGDV 283

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
           I          +++  G++ +  + G++     +++TD I   + 
Sbjct: 284 IELDQLINEPLLVTVEGEKKFYAQPGKMKNKMAVQVTDVIEEAED 328


>gi|304438436|ref|ZP_07398376.1| flagellar motor switch protein FliM [Selenomonas sp. oral taxon 149
           str. 67H29BP]
 gi|304368519|gb|EFM22204.1| flagellar motor switch protein FliM [Selenomonas sp. oral taxon 149
           str. 67H29BP]
          Length = 333

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 45/286 (15%), Positives = 94/286 (32%), Gaps = 8/286 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +    L   + + L       +   +DI   S +   +   + S     V    +
Sbjct: 49  SKDQMRTLFMLHESFSRLLNTYLSASLRTMIDIEVLSVEQMTYQEFVQSMANPSVIGILA 108

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           L     N  I  S ++ +  ++ + G       +   R L+ +E  + +R I  ++    
Sbjct: 109 LPPLKGNIIIELSTDISLAYIDRIFGGEGRPGVKP--RVLTDIEAAVMRRFIDTVTNYFR 166

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  S   E  PN E        +       ++ V  I +++ +  V     + IP   L 
Sbjct: 167 EAWSNVVEFRPNFETMET--NPQFAQIVPPSDMVVLITIHIKMGEVEGMMNICIPYLVLE 224

Query: 208 KTTLISLSS----QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQ 263
                  +S     +     S + +    RK  + +V    ++     T+ + +TL  G 
Sbjct: 225 PVMSKLTTSFWVASSMDRESSPEQVAELQRKIERTSVPFTVQLGEIHVTINEFLTLGFGD 284

Query: 264 VIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
           V+      K   +        +    G  GK   ++I+  I  +  
Sbjct: 285 VLQLDTLTKDELVCYVGSNPKFLARPGTAGKRMAVQISGIIEGEDD 330


>gi|251797432|ref|YP_003012163.1| flagellar motor switch protein FliM [Paenibacillus sp. JDR-2]
 gi|247545058|gb|ACT02077.1| flagellar motor switch protein FliM [Paenibacillus sp. JDR-2]
          Length = 333

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 40/312 (12%), Positives = 104/312 (33%), Gaps = 13/312 (4%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           ++ + + +           R        K   +  + +   + ++L   F  ++   V I
Sbjct: 27  LKKEEVTRKVRVYDFKRATRF------SKDHIRSLTRIHENFARYLTTYFSAQLRTFVQI 80

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           +    +   +   I S  +  + +            +    N+   +L+ +LG       
Sbjct: 81  NVVQVEQLPYDEFIRSIPKMTILNIFEAEPLEGRMVLEVHPNVAYAMLDRMLGGQGMAPS 140

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++ N  L+ +E  + +R  A+    L +   T  + SP LE        +       NE 
Sbjct: 141 KINN--LTEIETIIMERIFARAFESLQEAWKTVIDISPRLEALET--NPQFMQIVSPNET 196

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQ 237
           +  I+++  I +      L IP   +              ++ + +  + ++   ++  +
Sbjct: 197 IALISLSTKIGDTTGMINLCIPHVVIEPIMPRLSAHHWFVSQKKERIPEEVEMLEQRVSK 256

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             + I   +     T+K+ + L +G VI           +    K  +    G V     
Sbjct: 257 AKLPIVAELGESVITIKEFLGLAVGDVISLNKPIDDGLRIKVGEKLKFIGSPGSVKDRIA 316

Query: 298 IRITDRINFDQK 309
           +++   ++   +
Sbjct: 317 VQVDLVVSEGAE 328


>gi|254228441|ref|ZP_04921867.1| flagellar motor switch protein FliM [Vibrio sp. Ex25]
 gi|262393595|ref|YP_003285449.1| flagellar motor switch protein FliM [Vibrio sp. Ex25]
 gi|151939029|gb|EDN57861.1| flagellar motor switch protein FliM [Vibrio sp. Ex25]
 gi|262337189|gb|ACY50984.1| flagellar motor switch protein FliM [Vibrio sp. Ex25]
          Length = 348

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 35/295 (11%), Positives = 85/295 (28%), Gaps = 11/295 (3%)

Query: 13  LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSH 72
                  R+                +   + + +       +    ++S    Q  KF  
Sbjct: 37  FDFSSQDRIVRG------RMPTLELINERFARHMRISLFNMLRKTAEVSINGVQMMKFGE 90

Query: 73  IIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEK 132
             ++       +            I     LV  L+EN  G       ++  R  +  E+
Sbjct: 91  YQNTLYVPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRFHAKIEGREFTPTER 150

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
           ++ +  +  +     +  S         E                 E +   + ++ ++ 
Sbjct: 151 RIIQLLLKIVFEDYKEAWSPVMGVE--FEYLDSEVNPSMANIVSPTEVIVVSSFHIEVDG 208

Query: 193 VASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
               F +++P   +     +  +  Q+               +     VN    +  K  
Sbjct: 209 GGGDFHVVMPYSMVEPIRELLDAGVQSDKMETDVRWSSALREEIMDCPVNFRVNLLEKDI 268

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
           +L+D++ L+ G +IP        A +       Y  ++GR      ++I++ I  
Sbjct: 269 SLRDLMELQPGDIIPIEMP--EHATMFVEDLPTYRVKMGRSEDKLAVQISEEIER 321


>gi|157376191|ref|YP_001474791.1| flagellar motor switch protein FliM [Shewanella sediminis HAW-EB3]
 gi|157318565|gb|ABV37663.1| flagellar motor switch protein FliM [Shewanella sediminis HAW-EB3]
          Length = 341

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 44/301 (14%), Positives = 92/301 (30%), Gaps = 11/301 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +          R+                +   + + L       M    ++S    Q  
Sbjct: 30  DARSYDFSSQDRIVRG------RMPTLEIVNERFARHLRISMFNMMRRAAEVSINGVQML 83

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           KF   +H+       +    S       I     LV  L++N  G       ++  R  +
Sbjct: 84  KFGEYVHTLFVPTSLNMVRFSPLKGTALITMEARLVFILVDNFFGGDGRFHAKIEGREFT 143

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E+++ +  +  I        +   +     +                 E V   + ++
Sbjct: 144 PTERRIVQLLLKIIFEDYKDAWAPVMDVE--FDYLDSEVNPAMANIVSPTEVVVVSSFHI 201

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            ++     F + +P   +     +  +  Q+ +++           +   ++V ID  I 
Sbjct: 202 EVDGGGGDFHITMPYSMIEPIRELLDAGVQSDTQDTDMRWSQALKDEIMDVDVGIDATIV 261

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
             + TLKDV+  K G VI          ++       Y C+LG    N  +RI + I   
Sbjct: 262 EHQVTLKDVMEFKQGDVITVELP--EHIVMRVEDLPTYRCKLGTARDNLALRICETIPRP 319

Query: 308 Q 308
           +
Sbjct: 320 E 320


>gi|292487985|ref|YP_003530862.1| flagellar motor switch protein FliM [Erwinia amylovora CFBP1430]
 gi|292899205|ref|YP_003538574.1| flagellar motor switch protein [Erwinia amylovora ATCC 49946]
 gi|291199053|emb|CBJ46164.1| flagellar motor switch protein [Erwinia amylovora ATCC 49946]
 gi|291553409|emb|CBA20454.1| Flagellar motor switch protein FliM [Erwinia amylovora CFBP1430]
          Length = 336

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 39/301 (12%), Positives = 95/301 (31%), Gaps = 10/301 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
             +  P  P    R+       +   +    +   + +         +    DI+  + +
Sbjct: 33  DSHIRPYDPNTQRRVV------RERLQALEIINERFARSYRMALFNLLRRSPDITVGAIK 86

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
              +     +       +   L        +  S +LV   ++NL G       ++  R 
Sbjct: 87  IQPYHEFARNLPVPTNLNLIHLKPLRGTALVVFSPSLVFIAVDNLFGGDGRFPTKVEGRE 146

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E+++ +R +       ++                 +     N     N+ V T   
Sbjct: 147 FTHTEQRVIRRMLKLALEGYSEAWKPIYPLDVEYVRSE-MQVKFTNITTSPNDIVVTTPF 205

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSSQNKSE-NQSEDLIDPFARKTYQLNVNIDTR 245
           ++ I N+   F + IP   +       ++   ++   + E+  D   ++     + +   
Sbjct: 206 HVEIGNLTGEFNICIPFSMIEPLRETLVNPPLENSLTEDENWRDTLVKQVQHSELELVAN 265

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
                  +  ++ LK G V+P         I   +G  + + + G + K Y +R+   IN
Sbjct: 266 FADVSMRISRLLALKPGDVLPIEKP--DRIIAHVDGVPVLTSQYGTLNKQYALRVEHLIN 323

Query: 306 F 306
            
Sbjct: 324 P 324


>gi|326389471|ref|ZP_08211038.1| flagellar motor switch protein FliM [Thermoanaerobacter ethanolicus
           JW 200]
 gi|325994476|gb|EGD52901.1| flagellar motor switch protein FliM [Thermoanaerobacter ethanolicus
           JW 200]
          Length = 332

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 42/284 (14%), Positives = 98/284 (34%), Gaps = 6/284 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +    +     + L       +   V+++  S     +    +S       +   
Sbjct: 50  SKEQLRTLQMIFENLSRSLTSFLSGYLRTIVNVTVVSVDQLTYYEFSNSLNNPVFIAIID 109

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
            +     F +  +NN    +L+ +LG   +   +L +R  + +E  L  + + QI  +  
Sbjct: 110 AAPLEGPFLLEFNNNTTYAILDRILGGMGK--GELLDRDYTEIEISLLTKIVKQILPLFK 167

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  S   + +P+L         +       NE V    +++ I          +P  TL 
Sbjct: 168 EPWSNILDINPSLIRVET--NSQFAQIISPNETVALCTLSIKINETEGIMNFCMPHLTLE 225

Query: 208 KTTLISLSSQ--NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVI 265
                  +    +  + + +   +    K  +  + +  ++     T+K+ + L+IG +I
Sbjct: 226 PIVPKLTTKFWFSSMKKEDKVNPELIKSKISKTYIPLTAQLGSTTITVKEFLELEIGDII 285

Query: 266 PFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
                 K    +  + K  +    G     Y++RIT+ I    +
Sbjct: 286 MLDKHFKEPVDIIIDKKVKFRGIPGIKNNKYSVRITEVIYKGDE 329


>gi|302670733|ref|YP_003830693.1| flagellar motor switch protein FliM [Butyrivibrio proteoclasticus
           B316]
 gi|302395206|gb|ADL34111.1| flagellar motor switch protein FliM [Butyrivibrio proteoclasticus
           B316]
          Length = 327

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 39/310 (12%), Positives = 100/310 (32%), Gaps = 13/310 (4%)

Query: 3   GQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISY 62
             +  K          A+        K   +    +   Y + L       +  +V +S 
Sbjct: 28  QAADEKKVKDYDFKRPAKF------SKEHLRTLEMIYEHYGRLLSTTLPLYLRKNVQVSV 81

Query: 63  TSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQL 122
            + ++  +S   ++     +    +         +    N+  + ++ +LG    T+ + 
Sbjct: 82  ANSETVTYSEFSNALSNPVILGVINFLPLQGTIILELQANIGFSFIDRMLGGEGGTLDKP 141

Query: 123 YNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVT 182
             R  + +E  L ++ +     ++ +        +P +E        +        + + 
Sbjct: 142 --RPFTDIEMPLIEKLVTICMQLMVEPWQNVVAINPVMERIET--NPQFAQVISPTDMIA 197

Query: 183 TINMNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQLN 239
            + +N+ I +      + +P  TL                 +N  ED  D       +++
Sbjct: 198 IVTLNIKIGDTEGLMNVCLPYFTLESVMDKLNTKFWFSTMQKNADEDYEDTLESMVKRVD 257

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           V +   +     ++ D V L+ G +I   +R  T   +       ++   G     Y +R
Sbjct: 258 VPVKAILGKCNVSVSDFVHLQAGDIIRLDNRVNTDMQVYVGNIFKFTALPGTAKDKYAVR 317

Query: 300 ITDRINFDQK 309
           IT  +  + +
Sbjct: 318 ITSVVREEDE 327


>gi|317153224|ref|YP_004121272.1| flagellar motor switch protein FliM [Desulfovibrio aespoeensis
           Aspo-2]
 gi|316943475|gb|ADU62526.1| flagellar motor switch protein FliM [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 325

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 45/303 (14%), Positives = 96/303 (31%), Gaps = 13/303 (4%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
                        R+            +   +   + +         M   VDI+  S  
Sbjct: 32  DSGVVSFDLANQDRIIRG------RMPVLEIVNDRFARLCTNALANTMRKRVDINPISID 85

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
             KF   + S       S   +     N  +   + LV  L+EN  G +     ++  R 
Sbjct: 86  MSKFGDFMRSLPVPTSISIFKMDPLRGNALLVVDSRLVFALVENFFGGAGSQP-KVEGRD 144

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            + +E+ + +R +    A + +      E    L         +       ++ V  +  
Sbjct: 145 FTPIEQAIVERVVKIALANMEESWKPVHEVHVELVR--TEVNPQFAAIVPPSDVVIVVTF 202

Query: 187 NMTIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTR 245
            + +EN   S ++ +P  T+         S Q++        I+ F  +  +  V +  R
Sbjct: 203 EVELENAIGSLIVCLPYATMEPIRSKLHASFQSERLEVDHVWINRFKERLMETPVEMVIR 262

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           +     + + ++ L+ G +I     E         G   +    GRV  N + ++   I 
Sbjct: 263 MGRTTISGRQLLYLQEGDIILLDTDEDELLEAEVEGVRKFQGLPGRVKGNKSFQV---IK 319

Query: 306 FDQ 308
            ++
Sbjct: 320 EEE 322


>gi|20807877|ref|NP_623048.1| flagellar motor switch protein [Thermoanaerobacter tengcongensis
           MB4]
 gi|20516441|gb|AAM24652.1| Flagellar motor switch protein [Thermoanaerobacter tengcongensis
           MB4]
          Length = 330

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 43/284 (15%), Positives = 99/284 (34%), Gaps = 6/284 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +    +   + + L       +   V+++  S     +    +S       +   
Sbjct: 48  SKEQLRTLQMIFENFSRSLTSFLSGYLRTIVNVAVVSVDQLTYYEFSNSLNNPVFIAIID 107

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
            S     F +  +NN    +L+ LLG   +   +  +R  + +E  L  + + QI  +L 
Sbjct: 108 ASPLEGPFLLELNNNTTYAILDRLLGGMGK--GEFLDRDYTEIEVNLLTKIVKQILPLLE 165

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  S   + +P+L         +       NE V    +++ I          +P  TL 
Sbjct: 166 EPWSNIIDLTPSLMRVET--NSQFAQIISPNETVALCTLSIKINETEGMMNFCMPHLTLE 223

Query: 208 KTTLISLSS--QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVI 265
                  +    +  + + +   +    K  +  + +  ++     T+ D++  ++G VI
Sbjct: 224 PIVPKLTTKFWFSSMKKEEKVNPELIKEKIDKTYIPLTVQLGSTTVTVGDLLKFEVGDVI 283

Query: 266 PFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
               R      +  + K  +    G   K Y+++IT+ I    +
Sbjct: 284 MLDKRYNEPVEVIIDKKVKFKGIPGIKSKRYSVKITEVIYKGDE 327


>gi|120554904|ref|YP_959255.1| flagellar motor switch protein FliM [Marinobacter aquaeolei VT8]
 gi|120324753|gb|ABM19068.1| flagellar motor switch protein FliM [Marinobacter aquaeolei VT8]
          Length = 332

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 44/301 (14%), Positives = 97/301 (32%), Gaps = 12/301 (3%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           ++              R+                +   + ++        +  + D+S  
Sbjct: 27  ETDDTGVKNYDLASQDRIVRG------RMPTLEMINERFARYTRISLFNLLRRNADVSTG 80

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
             Q  KF   IH+       +   +              LV  L++N  G       ++ 
Sbjct: 81  GVQIMKFGEYIHTLYVPTSLNLCKVRPLRGTSLFVLDAKLVFKLVDNFFGGEGR-HAKIE 139

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  +  E ++ +  + Q+   + +      +     E                +E V  
Sbjct: 140 GREFTPTETRIVQMVLNQVFHDMKEAWHAVLQVE--FEYLSSEVNPAMANIVSPSEVVVV 197

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNI 242
              ++ ++         +P   +     +  +  Q+  ++  E  ++       ++NV I
Sbjct: 198 STFHIELDGGGGELHFALPYSMIEPIRDVLDAGVQSDIDDVDERWVNALQEDIKEVNVPI 257

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
           +T +  ++ +L+D+  +K G VIP          ++ANG  IY   LG       +RI D
Sbjct: 258 NTTVCRRRISLRDIARMKAGDVIPVEIP--EHLTVTANGIPIYKATLGTRDGKLALRIHD 315

Query: 303 R 303
           R
Sbjct: 316 R 316


>gi|307264879|ref|ZP_07546441.1| flagellar motor switch protein FliM [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|306920137|gb|EFN50349.1| flagellar motor switch protein FliM [Thermoanaerobacter wiegelii
           Rt8.B1]
          Length = 332

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 41/284 (14%), Positives = 97/284 (34%), Gaps = 6/284 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +    +     + L       +   V+++  S     +    +S       +   
Sbjct: 50  SKEQLRTLQMIFENLSRSLTSFLSGYLRTIVNVTVVSVDQLTYYEFSNSLNNPVFIAIID 109

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
            +     F +  +NN    +L+ +LG   +   +L +R  + +E  L  + + QI  +  
Sbjct: 110 AAPLEGPFLLEFNNNTTYAILDRILGGMGK--GELLDRDYTEIEISLLTKIVKQILPLFK 167

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  S   + +P+L         +       NE V    +++ I          +P  TL 
Sbjct: 168 EPWSNILDINPSLIRVET--NSQFAQIISPNETVALCTLSIKINETEGMMNFCMPHLTLE 225

Query: 208 KTTLISLSS--QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVI 265
                  +    +  + + +   +    K  +  + +  ++     T+K+ +  +IG +I
Sbjct: 226 PIVPKLTTKFWFSSMKKEDKVNPELIKSKISKTYIPLTAQLGSTTITVKEFLEFEIGDII 285

Query: 266 PFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
                 K    +  + K  +    G     Y++RIT+ I    +
Sbjct: 286 MLDKHFKEPVDIIIDKKVKFRGIPGIKNNKYSVRITEVIYKGDE 329


>gi|260886644|ref|ZP_05897907.1| flagellar motor switch protein FliM [Selenomonas sputigena ATCC
           35185]
 gi|330839524|ref|YP_004414104.1| flagellar motor switch protein FliM [Selenomonas sputigena ATCC
           35185]
 gi|260863787|gb|EEX78287.1| flagellar motor switch protein FliM [Selenomonas sputigena ATCC
           35185]
 gi|329747288|gb|AEC00645.1| flagellar motor switch protein FliM [Selenomonas sputigena ATCC
           35185]
          Length = 334

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 47/290 (16%), Positives = 102/290 (35%), Gaps = 8/290 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +  + L   + + L       +   V++   S +   +   + S     V    +
Sbjct: 49  SKDQIRTLNMLYENFARLLNTHLSTHLRTMVNVEVVSVEQLTYQEFLQSLSNPSVIGVMA 108

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           L     N  +  +  +    ++ + G   E   +   R L+ +E+ + ++ IA+ S  L 
Sbjct: 109 LPPLKGNIIMEVNTGIAFAYIDRVFGGLGENTLKP--RILTEIEEAVMRKFIAKASEFLK 166

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  S   E +P LE                ++ V  + + + I  V     L IP   L 
Sbjct: 167 ESWSNVIEINPILEAIEA--NPGFVQIVPPSDMVIIVTVQVKIGEVEGFMTLCIPYLVLE 224

Query: 208 KTTLISLSS----QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQ 263
                  +S     + +++ + D I    +K ++  + +   +     T+++ +TL  G 
Sbjct: 225 PVMSKLSTSFWVAASVAKDNNPDKIRALEKKIHKSPIPLIVELGTIDMTIREFLTLGFGD 284

Query: 264 VIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKN 313
           V+    + K    +    K  + C  G  GK   ++IT       +    
Sbjct: 285 VLQLDTKVKDELKILVGQKPKFLCRPGTQGKRSAVQITQVAFEGDEDTDE 334


>gi|270262388|ref|ZP_06190659.1| flagellar motor switch protein FliM [Serratia odorifera 4Rx13]
 gi|270043072|gb|EFA16165.1| flagellar motor switch protein FliM [Serratia odorifera 4Rx13]
          Length = 333

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 38/303 (12%), Positives = 90/303 (29%), Gaps = 10/303 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S      P  P    R+       +        +   + +         +    DI+   
Sbjct: 29  SNESEVKPYDPTTQRRVV------RERLHALEIINERFARQFRMGLFNLLRRSPDITVGP 82

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L+          + +LV   ++NL G       ++  
Sbjct: 83  IRIQPYHEFARNLPVPTNLNLVHLNPLRGTALFVFAPSLVFIAVDNLFGGDGRFPTKVEG 142

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++ KR +           S   + +        +     N     N+ V T 
Sbjct: 143 REFTPTEQRVIKRMLRLALDAYGDAWSAIYKINVEYVRAE-MQVKFTNITTSPNDIVVTT 201

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNID 243
              + I  ++  F + IP   +     +  +   + S  +     +   ++     + + 
Sbjct: 202 PFQVEIGALSGEFNICIPFAMIEPLRELLTNPPLENSRQEDSQWRETLVKQVQHSELELI 261

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ L+ G V+P         I   +G  + + + G +   Y +R+   
Sbjct: 262 ANFVDIPMRLSKILKLQPGDVLPIDKP--ERLIAHVDGVPVLTSQYGTLNGQYALRVEHL 319

Query: 304 INF 306
           IN 
Sbjct: 320 INP 322


>gi|258621111|ref|ZP_05716145.1| flagellar motor switch protein [Vibrio mimicus VM573]
 gi|262170887|ref|ZP_06038565.1| flagellar motor switch protein FliM [Vibrio mimicus MB-451]
 gi|258586499|gb|EEW11214.1| flagellar motor switch protein [Vibrio mimicus VM573]
 gi|261891963|gb|EEY37949.1| flagellar motor switch protein FliM [Vibrio mimicus MB-451]
          Length = 349

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 36/297 (12%), Positives = 90/297 (30%), Gaps = 11/297 (3%)

Query: 13  LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSH 72
                  R+                +   + + L       +    ++S    Q  KF  
Sbjct: 37  FDFSSQDRIVRG------RMPTLELINERFARHLRISLFNMLRKTAEVSINGVQMMKFGE 90

Query: 73  IIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEK 132
             ++       +            +     LV  L+EN  G       ++  R  +  E+
Sbjct: 91  YQNTLYVPTSLNMVRFRPLKGTALVTMEARLVFILVENFFGGDGRYHARIEGREFTPTER 150

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
           ++ +  +  + A   +  S         E                 E +   + ++ ++ 
Sbjct: 151 RVIQLLLKIVFADYKEAWSPVMGVE--FEYLDSEVNPSMANIVSPTEVIVVSSFHVEVDG 208

Query: 193 VASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
               F +++P   +     +  +  Q+               +   + VN    +     
Sbjct: 209 GGGDFHMVMPYSMMEPIRELLDAGVQSDKMETDVRWSTALREEIMDVPVNFRVNLLEMDI 268

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
            L+D++ L++G VIP        A++       Y  ++GR G+   ++++++I    
Sbjct: 269 ALRDLMELQVGDVIPIKMP--EHAVMFVEELPTYRVKMGRSGEKLAVQVSEKIKRPD 323


>gi|86356304|ref|YP_468196.1| flagellar C-ring protein [Rhizobium etli CFN 42]
 gi|86280406|gb|ABC89469.1| flagellar C-ring protein [Rhizobium etli CFN 42]
          Length = 316

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 105/305 (34%), Positives = 166/305 (54%)

Query: 12  PLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFS 71
            + P LLA+LTG LGD+  + KI S+ G +Y +FLP I K +  LDV +SY  C+ G  +
Sbjct: 12  AMDPALLAKLTGGLGDRGRVAKICSAFGDVYGEFLPDIIKSETGLDVTVSYLGCEIGYKN 71

Query: 72  HIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVE 131
           H++     N     A+L +WS N  + C N  VITL+E+LLGA+ +TI +   R LS +E
Sbjct: 72  HLVDDLSHNVTLVDATLRNWSQNVTLACGNGFVITLMEHLLGATADTIEEPAERLLSVIE 131

Query: 132 KKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIE 191
             LA     +I+ VL   ++      P+L   +  D   +      +EF   INM++T+ 
Sbjct: 132 LDLAVMVFDKIAKVLRSAVNAPGGFEPSLSAPHAHDARPRPAEDKPDEFAAAINMSITLA 191

Query: 192 NVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
            + S F LIIPQ  LLKT +     + ++   S +  +    +  + +V ++ +I L+  
Sbjct: 192 GIVSEFSLIIPQTALLKTKVTPPKPKRQTGGNSPEWTEQLGDQVRRSHVTLEAKIRLQDL 251

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSL 311
           TL+ +  L  G VIPF         +SAN KE+Y CE GR G+NY +R+ D +N D + +
Sbjct: 252 TLRTISKLMAGDVIPFHDSGDVRVEVSANSKELYICEFGRSGENYMVRVKDTMNSDDELI 311

Query: 312 KNFLH 316
           ++ ++
Sbjct: 312 RHLMN 316


>gi|104782811|ref|YP_609309.1| flagellar motor switch protein FliM [Pseudomonas entomophila L48]
 gi|95111798|emb|CAK16522.1| flagellar motor switch protein FliM [Pseudomonas entomophila L48]
          Length = 322

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 38/277 (13%), Positives = 87/277 (31%), Gaps = 6/277 (2%)

Query: 31  IEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSS 90
                  +   + ++        +    D++    Q  KF   +HS       +   +  
Sbjct: 50  RMPTLEMINERFARYTRISMFNLLRRSADVAVGGVQVMKFGEYVHSLYVPTSLNLVKIKP 109

Query: 91  WSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCI 150
                       LV  L++N  G       ++  R  +  E ++ +  + Q    L +  
Sbjct: 110 LRGTALFILDAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLDQCFVDLKEAW 168

Query: 151 STTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTT 210
                 +   E                +E V     ++ ++       + +P   +    
Sbjct: 169 QAIMPVN--FEYINSEVNPAMANIVGPSEAVVVSTFHIELDGGGGDLHVTMPYSMIEPVR 226

Query: 211 LISLS-SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLH 269
            +  +  Q+  ++Q E  +         + V +   +  ++  L+D++ ++ G VIP   
Sbjct: 227 EMLDAGFQSDLDDQDERWVKALREDVLDVAVPMSATVARRQLKLRDILHMQPGDVIPVEL 286

Query: 270 REKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                 +L ANG   +   LG       ++I D I  
Sbjct: 287 P--EHLVLRANGVPAFKARLGSHKGTLALQIIDPIER 321


>gi|254780687|ref|YP_003065100.1| flagellar C-ring protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040364|gb|ACT57160.1| flagellar C-ring protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 318

 Score =  240 bits (612), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 318/318 (100%), Positives = 318/318 (100%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI
Sbjct: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP
Sbjct: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF
Sbjct: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNV 240
           VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNV
Sbjct: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNV 240

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
           NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI
Sbjct: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300

Query: 301 TDRINFDQKSLKNFLHKR 318
           TDRINFDQKSLKNFLHKR
Sbjct: 301 TDRINFDQKSLKNFLHKR 318


>gi|229524128|ref|ZP_04413533.1| flagellar motor switch protein FliM [Vibrio cholerae bv. albensis
           VL426]
 gi|297582024|ref|ZP_06943943.1| flagellar motor switch protein FliM [Vibrio cholerae RC385]
 gi|229337709|gb|EEO02726.1| flagellar motor switch protein FliM [Vibrio cholerae bv. albensis
           VL426]
 gi|297533719|gb|EFH72561.1| flagellar motor switch protein FliM [Vibrio cholerae RC385]
          Length = 349

 Score =  240 bits (612), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 36/297 (12%), Positives = 90/297 (30%), Gaps = 11/297 (3%)

Query: 13  LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSH 72
                  R+                +   + + L       +    ++S    Q  KF  
Sbjct: 37  FDFSSQDRIVRG------RMPTLELINERFARHLRISLFNMLRKTAEVSINGVQMMKFGE 90

Query: 73  IIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEK 132
             ++       +            +     LV  L+EN  G       ++  R  +  E+
Sbjct: 91  YQNTLYVPTSLNMVRFRPLKGTALVTMEARLVFILVENFFGGDGRYHARIEGREFTPTER 150

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
           ++ +  +  + A   +  S         E                 E +   + ++ ++ 
Sbjct: 151 RVIQLLLKIVFADYKEAWSPVMGVE--FEYLDSEVNPSMANIVSPTEVIVVSSFHVEVDG 208

Query: 193 VASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
               F +++P   +     +  +  Q+               +   + VN    +     
Sbjct: 209 GGGDFHMVMPYSMVEPIRELLDAGVQSDKMETDVRWSTALREEIMDVPVNFRVNLLEMDI 268

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
            L+D++ L++G VIP        A++       Y  ++GR G+   ++++++I    
Sbjct: 269 ALRDLMELQVGDVIPIKMP--EHAVMFIEELPTYRVKMGRSGEKLAVQVSEKIKRPD 323


>gi|293395596|ref|ZP_06639879.1| flagellar motor switch protein FliM [Serratia odorifera DSM 4582]
 gi|291421915|gb|EFE95161.1| flagellar motor switch protein FliM [Serratia odorifera DSM 4582]
          Length = 334

 Score =  240 bits (612), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 38/301 (12%), Positives = 89/301 (29%), Gaps = 10/301 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
             +  P  P    R+       +        +   + +         +    DI+    +
Sbjct: 31  DSDVKPYDPTTQRRVV------RERLHALEIINERFARQFRMGLFNLLRRSPDITVGPIR 84

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
              +     +       +   L+          + +LV   ++NL G       ++  R 
Sbjct: 85  IQPYHEFARNLPVPTNLNLVHLNPLRGTALFVFAPSLVFIAVDNLFGGDGRFPTKVEGRE 144

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E+++ KR +           S   +          +     N     N+ V T   
Sbjct: 145 FTPTEQRVIKRMLRLALDAYGDAWSAIYQIDVEYVRAE-MQVKFTNITTSPNDIVVTTPF 203

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNIDTR 245
            + I  ++  F + IP   +     +  +   + S  +     +   ++     + +   
Sbjct: 204 QVEIGALSGEFNICIPFAMIEPLRELLTNPPLENSRQEDSRWRETLVKQVQHSELELIAN 263

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
                  L  V+ L+ G V+P         I   +G  + + + G +   Y +R+   IN
Sbjct: 264 FVDIPMRLSKVLKLQPGDVLPIDKP--ERLIAHVDGVPVLTSQYGTLNGQYALRVEHLIN 321

Query: 306 F 306
            
Sbjct: 322 P 322


>gi|258626185|ref|ZP_05721033.1| flagellar motor switch protein [Vibrio mimicus VM603]
 gi|258581540|gb|EEW06441.1| flagellar motor switch protein [Vibrio mimicus VM603]
          Length = 349

 Score =  240 bits (612), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 36/297 (12%), Positives = 90/297 (30%), Gaps = 11/297 (3%)

Query: 13  LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSH 72
                  R+                +   + + L       +    ++S    Q  KF  
Sbjct: 37  FDFSSQDRIVRG------RMPTLELINERFARHLRISLFNMLRKTAEVSINGVQMMKFGE 90

Query: 73  IIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEK 132
             ++       +            +     LV  L+EN  G       ++  R  +  E+
Sbjct: 91  YQNTLYVPTSLNMVRFRPLKGTALVTMEARLVFILVENFFGGDGRYHARIEGREFTPTER 150

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
           ++ +  +  + A   +  S         E                 E +   + ++ ++ 
Sbjct: 151 RVIQLLLKIVFADYKEAWSPVMGVE--FEYLDSEVNPSMANIVSPTEVIVVSSFHVEVDG 208

Query: 193 VASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
               F +++P   +     +  +  Q+               +   + VN    +     
Sbjct: 209 GGGDFHMVMPYSMMEPIRELLDAGVQSDKMETDVRWSTALREEIMDVPVNFRVNLLEMDI 268

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
            L+D++ L++G VIP        A++       Y  ++GR G+   ++++++I    
Sbjct: 269 ALRDLMELQVGDVIPIKMP--EHAVMFVEELPTYRVKMGRSGEKLAVQVSEKIKRPD 323


>gi|89094448|ref|ZP_01167388.1| flagellar motor switch protein [Oceanospirillum sp. MED92]
 gi|89081340|gb|EAR60572.1| flagellar motor switch protein [Oceanospirillum sp. MED92]
          Length = 325

 Score =  239 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 43/303 (14%), Positives = 97/303 (32%), Gaps = 12/303 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
             +          R+                +   + ++        +    D++    Q
Sbjct: 34  EGDVRTYDLASHERIVRG------RMPTLEMVNERFARYTRISLFNLLRRAADVTVGGVQ 87

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
             K+   IH+       +   ++             LV  L++N  G       ++  R 
Sbjct: 88  VMKYGDYIHTLYVPTSMNLIRVNPLRGTALFIMDAKLVFKLVDNFFGGDGR-HAKIEGRE 146

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E +L  + + Q    L +  +  +E   + +                 E V     
Sbjct: 147 FTPTETRLIHKALEQFFLDLEEAWNPVKEL--SFDHLGHEMNPAMANVINPTEVVVVSTF 204

Query: 187 NMTIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTR 245
            + +E  +  F + +P   L     +     Q+  + + E       R      + ++  
Sbjct: 205 QVDLEGGSGEFHVAMPYSMLEPIRDLLVSGFQSGEDEKDERWQVALQRDILMAGLPLEMT 264

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           +  ++ TL+DVV L+ G +IP          L AN   +Y+C +G    N  +++ ++I 
Sbjct: 265 LAQQEMTLRDVVDLQAGDIIPIELP--ETFELKANKVPVYNCTMGVSRGNLAVKVVNQIE 322

Query: 306 FDQ 308
             +
Sbjct: 323 RPK 325


>gi|190890355|ref|YP_001976897.1| flagellar C-ring motor switch protein [Rhizobium etli CIAT 652]
 gi|190695634|gb|ACE89719.1| flagellar C-ring motor switch protein [Rhizobium etli CIAT 652]
          Length = 316

 Score =  239 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 102/305 (33%), Positives = 167/305 (54%)

Query: 12  PLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFS 71
            + P LLA+LTG LGD+  + KI S+ G +Y +F P + K +  LDV ++Y  C+ G  +
Sbjct: 12  AMDPALLAKLTGGLGDRGRVSKICSAFGEVYSEFFPDVIKSETGLDVTVNYLGCEIGYKN 71

Query: 72  HIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVE 131
           H++     N     A+L +WS N  + C N  VITL+E+LLGA+ +TI +  +R LS +E
Sbjct: 72  HLVDDLSANVTLVDATLRNWSQNITLACGNGFVITLMEHLLGATADTIEEPADRLLSIIE 131

Query: 132 KKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIE 191
             LA     +I+ VL   ++      P+L   +  D   +      +EF   INM++T+ 
Sbjct: 132 LDLAVMVFDKIAKVLRSAVNAPGGFEPSLSAPHAHDARARPPEDKPDEFAAAINMSLTLA 191

Query: 192 NVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
            + S F LI+PQ  LLKT +     + ++   S +  +    +  + +V ++ RI L+  
Sbjct: 192 GIVSEFSLIVPQTALLKTKVTPPKPKRQAAGASPEWTEQLGDQVRRSHVTLEARIRLQDL 251

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSL 311
           TL+ +  L +G VIPF         +SAN KE+Y CE GR G+NY +R+ D +N D + +
Sbjct: 252 TLRTISKLMVGDVIPFRDSGDVRVEVSANSKELYVCEFGRSGENYMVRVKDTMNSDDELI 311

Query: 312 KNFLH 316
           ++ ++
Sbjct: 312 RHLMN 316


>gi|300871253|ref|YP_003786126.1| flagellar motor switch protein FliM [Brachyspira pilosicoli
           95/1000]
 gi|300688954|gb|ADK31625.1| flagellar motor switch protein, FliM [Brachyspira pilosicoli
           95/1000]
          Length = 343

 Score =  239 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 44/319 (13%), Positives = 102/319 (31%), Gaps = 13/319 (4%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           +  H+           +        K   +    +   + +        ++   V I   
Sbjct: 32  EVEHRKIKIYDFKRPDKF------SKDQIRTLQMMHENFARVTTTSLSAQLRTLVGIHVA 85

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
           S     +   I S       +  S+     +  +    ++  T+++ L G + E+  +  
Sbjct: 86  SVDQLTYEEFIRSVSNPSTLAIVSMDPLKGSSILEIDPSITFTIIDRLFGGAGESP-KNL 144

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
           NR L+ +E  + +  I +I   L +  S   +  P L         +       N+ V  
Sbjct: 145 NRELTDIELSVMEGIIVRILGNLREAWSQVIDLRPRLGSIET--NPQFAQMVSPNDMVVL 202

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQLNV 240
           I +   + +V       IP  T+              +     + + +     K   + V
Sbjct: 203 ITLETKVADVEGMMNFCIPYITIEPILSKFSAQYWYASVRRGSTSENLKIIKEKLQNIYV 262

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPF-LHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
                +   +  L D++ L+ G V+ F   +     I     ++ + C  G  G    ++
Sbjct: 263 ETSAELGSMQLPLSDILNLQKGDVVKFTETKITDPVIFKIGTRKKFLCRPGISGSRMAVQ 322

Query: 300 ITDRINFDQKSLKNFLHKR 318
           +T  ++ +    ++ L K 
Sbjct: 323 LTGVMDGETDITEDDLLKE 341


>gi|209547920|ref|YP_002279837.1| hypothetical protein Rleg2_0312 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533676|gb|ACI53611.1| surface presentation of antigens (SPOA) protein [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 316

 Score =  239 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 101/305 (33%), Positives = 167/305 (54%)

Query: 12  PLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFS 71
            + P LLA+LTG LGDK  + KI SS G +Y +F P + K +  L+V ++Y  C+ G  +
Sbjct: 12  AMDPALLAKLTGGLGDKGRVAKICSSFGEIYSEFFPDVIKSETGLEVTVNYLGCEIGYKN 71

Query: 72  HIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVE 131
           H+I     N      +L +WS N  I C N  VITL+E+LLGA+ +TI +  +R LS +E
Sbjct: 72  HLIDDLSSNVTLVDVTLRNWSQNITIACGNGFVITLMEHLLGATADTIEEPADRLLSIIE 131

Query: 132 KKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIE 191
             LA     +I+ VL   ++      P+L   + ++   +      +EF   INM++T+ 
Sbjct: 132 MDLAVMVFDKIAKVLRSAVNAPGGFEPSLSVPHALEMRARPPEDRPDEFAAAINMSITLA 191

Query: 192 NVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
            + S F L++PQ  LLKT +     + ++   S +  +    +  + +V ++ +I L+  
Sbjct: 192 GIVSEFSLMVPQTALLKTKVTPPKPKRQAGGSSAEWTEQLGDQVRRSHVTLEAKIRLQDL 251

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSL 311
           TL+ +  L +G VIPF         +SAN KE+Y CE GR G+NY +R+ D +N D + +
Sbjct: 252 TLRTISKLMVGDVIPFRDHGDVRVEVSANSKELYVCEFGRSGENYMVRVKDTMNSDDELI 311

Query: 312 KNFLH 316
           ++ ++
Sbjct: 312 RHLMN 316


>gi|332981445|ref|YP_004462886.1| flagellar motor switch protein FliM [Mahella australiensis 50-1
           BON]
 gi|332699123|gb|AEE96064.1| flagellar motor switch protein FliM [Mahella australiensis 50-1
           BON]
          Length = 335

 Score =  239 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 40/315 (12%), Positives = 101/315 (32%), Gaps = 16/315 (5%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           M   +  K           +        K   +    L   + ++L       + +   +
Sbjct: 28  MEQTAEEKKIRVYDFRRPNKF------SKEQLRTLEILHENFCRYLSSYLAGFLRIYCQV 81

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           +  S +   +   ++S  E  V              +  + N+   +++ +LG S     
Sbjct: 82  NIVSVEELTYYEFMNSLPEPVVLGIMDFQPMDGKIVVEIAPNISYAMIDRVLGGSGRAAE 141

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++   + S +E  L +R + QI  +L +  +     +P LE        +       NE 
Sbjct: 142 EMT--AFSEIELALIERILRQIGTLLQESWANVAAITPKLERIET--NAQFAQIIAPNET 197

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKT------TLISLSSQNKSENQSEDLIDPFARK 234
              + + + + +V     + IP  T+              + + +   + E   +   ++
Sbjct: 198 AALVTLMLKVGDVEGMVNICIPHVTIEPISDELTTRFWFSNEKKEKAERDEVSFNTLRKR 257

Query: 235 TYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGK 294
              + + I   +     ++ D + L  G +I           +       +  + G    
Sbjct: 258 IENVQIPIRAILGESTISIGDFMQLSPGDIIQLDESVDNHIKVMVGDITKFYGKPGLRHN 317

Query: 295 NYTIRITDRINFDQK 309
           +  ++ITD I  ++ 
Sbjct: 318 HMAVKITDVIYQEED 332


>gi|260767699|ref|ZP_05876634.1| flagellar motor switch protein FliM [Vibrio furnissii CIP 102972]
 gi|260617208|gb|EEX42392.1| flagellar motor switch protein FliM [Vibrio furnissii CIP 102972]
 gi|315179469|gb|ADT86383.1| flagellar motor switch protein FliM [Vibrio furnissii NCTC 11218]
          Length = 352

 Score =  239 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 32/297 (10%), Positives = 88/297 (29%), Gaps = 11/297 (3%)

Query: 13  LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSH 72
                  R+                +   + + +       +    ++S    Q  KF  
Sbjct: 37  FDFSSQDRIVRG------RMPTLELINERFARHMRISLFNMLRKTAEVSINGVQMMKFGE 90

Query: 73  IIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEK 132
             ++       +            +     LV  L+EN  G       ++  R  +  E+
Sbjct: 91  YQNTLYVPTSLNMVRFRPLKGTALVTMEARLVFILVENFFGGDGRYHARIEGREFTPTER 150

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
           ++ +  +  +        +         E                 E +   + ++ ++ 
Sbjct: 151 RVIQLLLKIVFGDYKDAWAPVMGVE--FEYLDSEVNPSMANIVSPTEVIVVSSFHIEVDG 208

Query: 193 VASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
               F +++P   +     +  +  Q+               +   + VN    +  +  
Sbjct: 209 GGGDFHIVMPYSMVEPIRELLDAGVQSDKMETDVRWSSALREEIMDVPVNFRVNLLEQDL 268

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
            L+D++ L++G +IP        A +       Y  ++GR G+   ++++++I    
Sbjct: 269 ALRDLMELQVGDIIPIKMP--EHATMFVEELPTYRVKMGRSGEKLAVQVSEKIRRPD 323


>gi|116250474|ref|YP_766312.1| flagella motor switch protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115255122|emb|CAK06196.1| putative flagella motor switch protein [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 316

 Score =  239 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 104/305 (34%), Positives = 168/305 (55%)

Query: 12  PLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFS 71
            + P LLA+LTG LGD+  + KI SS G +Y +F P + K +  LDV ++Y  C+ G  +
Sbjct: 12  AMDPALLAKLTGGLGDRGRVAKICSSFGEIYSEFFPDVIKSETGLDVTVNYLGCEIGYKN 71

Query: 72  HIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVE 131
           H+I     N     A+L +WS N  + C N  VITL+E+LLGA+ +TI +  +R LS +E
Sbjct: 72  HLIEDLSANVTLVDATLRNWSQNITLACGNGFVITLMEHLLGATADTIEEPADRLLSIIE 131

Query: 132 KKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIE 191
             LA     +I+ VL   ++      P+L   Y  D   +      +EF   INM++T+ 
Sbjct: 132 LDLAVMVFDKIAKVLRSAVNAPGGFEPSLSAPYAHDMRARPQEDRPDEFAAAINMSITLA 191

Query: 192 NVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
            + S F LI+PQ  LLKT +     + ++ + S +  +    +  + +V ++ +I L+  
Sbjct: 192 GIVSEFSLIVPQTALLKTKVTPPKPKRQASSNSAEWTEQLGDQVRRSHVTLEAKIRLQDL 251

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSL 311
           TL+ +  L +G VIPF         +SAN KE+Y CE GR G+NY +R+ D +N D + +
Sbjct: 252 TLRTISKLMVGDVIPFRDHGDVRVEVSANSKELYVCEFGRSGENYMVRVKDTMNSDDELI 311

Query: 312 KNFLH 316
           ++ ++
Sbjct: 312 RHLMN 316


>gi|37525864|ref|NP_929208.1| flagellar motor switch protein FliM [Photorhabdus luminescens
           subsp. laumondii TTO1]
 gi|36785293|emb|CAE14234.1| Flagellar motor switch protein FliM [Photorhabdus luminescens
           subsp. laumondii TTO1]
          Length = 334

 Score =  239 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 36/313 (11%), Positives = 91/313 (29%), Gaps = 10/313 (3%)

Query: 2   RGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDIS 61
              S      P  P    R+       +   +    +   + +         +    DI+
Sbjct: 26  NTSSGENEIRPYDPNTQRRVI------RERLQALEIINERFARHFRMGLFNMLRRSPDIT 79

Query: 62  YTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQ 121
             + +   +     +       +   L           + +LV   ++NL G       +
Sbjct: 80  VGAIKIQPYHEFARNLAVPTNLNLVHLKPLRGTALFAFAPSLVYIAVDNLFGGDGRFPTK 139

Query: 122 LYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFV 181
           +  R  +  E+++  R +           S   +          +     N     N+ V
Sbjct: 140 VEGREFTHTEQRVINRMLRMALDSYRDAWSAIFKIEVEYIRSE-MQVKFTNITTSPNDIV 198

Query: 182 TTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNV 240
            T    + I  ++  F + IP   +        +   + +  +     +   ++     +
Sbjct: 199 VTTPFQVEIGALSGEFNICIPFAMIEPLRERLTNPPLENARQEDSLWRESLVKQVQHSEL 258

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            +          L  ++ L+ G ++P         I+  +G  + + + G +   Y +R+
Sbjct: 259 ELVANFADIPLRLSKILQLQPGDILPIDKP--ERLIVHVDGVPVLTSQYGTLNGQYALRV 316

Query: 301 TDRINFDQKSLKN 313
              IN    +L  
Sbjct: 317 EHLINPVLNALDE 329


>gi|297617150|ref|YP_003702309.1| flagellar motor switch protein FliM [Syntrophothermus lipocalidus
           DSM 12680]
 gi|297144987|gb|ADI01744.1| flagellar motor switch protein FliM [Syntrophothermus lipocalidus
           DSM 12680]
          Length = 330

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 52/312 (16%), Positives = 104/312 (33%), Gaps = 13/312 (4%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           +R +   K           +        K        +   Y + +      ++   V I
Sbjct: 27  LRQEQTKKKIRLYDFRRPNKF------SKDQLHTLQVIFENYSRSVSTYLSAQLRAAVQI 80

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
              S +   +   + S     +    SL     +  +  + NL   +L+ +LG       
Sbjct: 81  DVLSVEQLTYDEFMRSLPNPTIMCVFSLQPLEGSAIMEINPNLGFAMLDRILGGPGLPPE 140

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++  R L+ +E  L +R   ++ + L +  S   E  P ++        +       +E 
Sbjct: 141 RI--RPLTEIEITLIERLAQRMLSYLEEPWSGIIELQPVMDRIE--SNPQFTQIVSPSEM 196

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDP---FARKTYQ 237
           V  I++   I +V S   + IP   L   T     +   S +  E   D       +   
Sbjct: 197 VVIISLESKIGDVLSLINICIPFLVLESITGKLNVNYYYSSSVKERSKDSALVLKNRIEN 256

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             V +   I     T+++++ L  G VIP   R      +    K  +  + G VG    
Sbjct: 257 AMVPVKILIGSTVITVRELLELAPGDVIPLERRLDEDLEVVIGQKPKFRGKPGVVGNRLA 316

Query: 298 IRITDRINFDQK 309
           ++IT+ ++    
Sbjct: 317 LKITEIVSEVDD 328


>gi|94986472|ref|YP_594405.1| flagellar motor switch protein [Lawsonia intracellularis
           PHE/MN1-00]
 gi|94730721|emb|CAJ54083.1| Flagellar motor switch protein [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 325

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 45/303 (14%), Positives = 93/303 (30%), Gaps = 13/303 (4%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
                P       R+            +   +   + +         +   V+++  S  
Sbjct: 32  DSGIVPFDLANQDRIIRG------RMPVLEIVNDRFARLCTNALSNAIRKRVELNPISID 85

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
             KF   + S       +   +     N  I   + LV  L+EN+ G       ++  R 
Sbjct: 86  MTKFGDFMRSLPVPTSINIFKMDPLRGNAIIVVDSRLVFALVENVFGGIGSQP-KIEGRE 144

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            + +E+ +  R I      + +      +    LE        +       ++ V  IN 
Sbjct: 145 FTRIEQVIVDRIIKIALDNMEESWRPVHDVK--LELIRSEINPQFAAIVPPSDVVIVINF 202

Query: 187 NMTIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTR 245
            + +++   S  + IP  T+         S Q +        +     +  +  V +  R
Sbjct: 203 EVELDSSIGSMTICIPYATIEPIRSKLHASFQTERLEIDHAWVGRLKERLLETPVELKVR 262

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           +   + T   ++ LKIG V+      +     +  G   Y    G V  N   +I   I 
Sbjct: 263 MGNTQITGNQLLRLKIGDVLVLDTDVEDLLECTVAGVTKYWGIAGTVKSNKAYQI---IK 319

Query: 306 FDQ 308
            ++
Sbjct: 320 EEE 322


>gi|253682358|ref|ZP_04863155.1| flagellar motor switch protein FliM [Clostridium botulinum D str.
           1873]
 gi|253562070|gb|EES91522.1| flagellar motor switch protein FliM [Clostridium botulinum D str.
           1873]
          Length = 331

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 42/285 (14%), Positives = 100/285 (35%), Gaps = 7/285 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +    +   + + +      ++  +V I   + Q   +   IHS     + +   
Sbjct: 48  SKDHIRTLELIHDNFARIISNYLTAQVRTNVKIKIETVQQITYEEFIHSVPNPTILTIFK 107

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +   S +     +      +++ LLG       +   R  + ++K + K+    + A L 
Sbjct: 108 MPPLSGSILFETNPQFAYKVIDVLLGGPGVGQYKT--REFTDIDKNIIKQINKGLIANLK 165

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
                  +  P +E          N     NE V  I  ++ +   ++   + IP  ++ 
Sbjct: 166 LAWEDVIQVEPEIEGLET--NPALNQTLAPNEPVALITFSVEMGGNSTFINICIPYLSIE 223

Query: 208 KTTLIS---LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
           K           +    +  E   +   ++   + + +   +   K T+ + +TL +G V
Sbjct: 224 KVLDKLVVQYWFRENDTDTLEQSKEKLRKRMNIVELPMTAVLGSTKLTVGEFLTLSVGDV 283

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
           +   +   +   +    K     + G +GKN  ++I D I+ D +
Sbjct: 284 VTLDNLTSSPVKMMVGDKPYLLGKPGIIGKNRGVQILDIIDKDVE 328


>gi|188534127|ref|YP_001907924.1| flagellar motor switch protein FliM [Erwinia tasmaniensis Et1/99]
 gi|188029169|emb|CAO97041.1| Flagellar motor switch protein [Erwinia tasmaniensis Et1/99]
          Length = 336

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 39/306 (12%), Positives = 94/306 (30%), Gaps = 10/306 (3%)

Query: 2   RGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDIS 61
             +    +  P  P    R+       +   +    +   + +         +    DI+
Sbjct: 28  NKKEGEDHIRPYDPNTQRRVV------RERLQALEIINERFARAYRMALFNLLRRSPDIT 81

Query: 62  YTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQ 121
             + +   +     +       +   L        +  S +LV   ++NL G       +
Sbjct: 82  VGAIKIQPYHEFARNLPVPTNLNLIHLKPLRGTALVVFSPSLVFIAVDNLFGGDGRFPTK 141

Query: 122 LYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFV 181
           +  R  +  E+++  R +       ++                 +     N     N+ V
Sbjct: 142 VEGREFTHTEQRVIGRMLKLALEGYSEAWKPIYPLDVEYVRSE-MQVKFTNITTSPNDIV 200

Query: 182 TTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSE-NQSEDLIDPFARKTYQLNV 240
            T    + I N+   F + IP   +       ++   ++  +Q E   D   ++     +
Sbjct: 201 VTTPFQVEIGNLTGEFNICIPFSMIEPLRETLVNPPLENSLSQDETWRDTLVKQVQHSEL 260

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            +          +  ++ LK G V+P         I   +G  + + + G + K + +R+
Sbjct: 261 ELVANFADVSMRISRLLALKPGDVLPIDKP--DRIIAHVDGVPVLTSQYGTLNKQFALRV 318

Query: 301 TDRINF 306
              IN 
Sbjct: 319 EHLINP 324


>gi|332994114|gb|AEF04169.1| flagellar motor switch protein FliM [Alteromonas sp. SN2]
          Length = 352

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 40/300 (13%), Positives = 91/300 (30%), Gaps = 11/300 (3%)

Query: 6   IHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSC 65
              +T         R+                +   + + +       M    ++S    
Sbjct: 30  SDASTLEYDFSSQDRIVRG------RMPTLEIVNERFARHMRVSLFNMMRRSAEVSINGI 83

Query: 66  QSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNR 125
           Q  KF   IH+       +            I     LV  L++N  G       ++  R
Sbjct: 84  QMIKFGEYIHTLFVPTSLNMVRFRPLKGTGLITMEARLVFILVDNFFGGDGRYHAKIEGR 143

Query: 126 SLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTIN 185
             +  E+++ +  +  I     +  +   +   + E                 E V   +
Sbjct: 144 EFTPTERRIIQMLLKIIFEDYKEAWAPVMDV--SFEYLDSEVNPAMANIVSPTEVVVISS 201

Query: 186 MNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDT 244
            ++ ++     F + +P   L     +  +  Q+  E+           +   + V + T
Sbjct: 202 FHIELDGGGGDFHVSLPYSMLEPIRELLDAGVQSDKEDTDLRWSKALRDEIMDVKVALTT 261

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
            +     +L+ V+  K G++IP          +       +  +LGR   N  ++I ++I
Sbjct: 262 HMLDVDVSLRQVMEFKPGEIIPVEMP--ETITVLIEDLPTFRAKLGRSRDNLALKIVEKI 319


>gi|304311107|ref|YP_003810705.1| Flagellar motor switch protein [gamma proteobacterium HdN1]
 gi|301796840|emb|CBL45052.1| Flagellar motor switch protein [gamma proteobacterium HdN1]
          Length = 354

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 41/308 (13%), Positives = 92/308 (29%), Gaps = 12/308 (3%)

Query: 2   RGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDIS 61
            G                R+                +   + ++        +    D++
Sbjct: 27  SGDDSADGIKNYDLSTQDRIVRG------RMPTLEMINERFARYTRISMFNLLRRSADVA 80

Query: 62  YTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQ 121
               Q  KF   +HS       +   +              LV  L++N  G       +
Sbjct: 81  VGGVQVIKFGEYVHSLYVPTSLNMVRIKPLRGTALFILDAKLVFKLVDNFFGGDGR-HVK 139

Query: 122 LYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFV 181
           +  R  +  E ++ +  + Q    + +            E                +E V
Sbjct: 140 IEGREFTPTENRVVQLVLKQAFKDMEEAWKAVLPVK--FEYLSSEVNPALANIVSPSEVV 197

Query: 182 TTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNV 240
                ++ ++       L +P   +     +  S  Q+   NQ E  +     +    NV
Sbjct: 198 VVNTFHIELDGGGGDLQLTVPYSMIEPLREVLDSGVQSDVGNQDERWMSSLREEIMGANV 257

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
           ++  ++  +K  L ++  LK G V+          ++ AN    Y  +LG   + Y ++I
Sbjct: 258 HLRCKLLDRKIKLSELAALKTGDVLQVEMP--EHVMIYANEVPTYRGKLGTSREKYAVKI 315

Query: 301 TDRINFDQ 308
            +++   +
Sbjct: 316 AEKVQRPE 323


>gi|27365287|ref|NP_760815.1| flagellar motor switch protein FliM [Vibrio vulnificus CMCP6]
 gi|37680658|ref|NP_935267.1| flagellar motor switch protein FliM [Vibrio vulnificus YJ016]
 gi|320155671|ref|YP_004188050.1| flagellar motor switch protein FliM [Vibrio vulnificus MO6-24/O]
 gi|27361434|gb|AAO10342.1| flagellar motor switch protein FliM [Vibrio vulnificus CMCP6]
 gi|37199407|dbj|BAC95238.1| flagellar motor switch protein FliM [Vibrio vulnificus YJ016]
 gi|319930983|gb|ADV85847.1| flagellar motor switch protein FliM [Vibrio vulnificus MO6-24/O]
          Length = 347

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 35/295 (11%), Positives = 88/295 (29%), Gaps = 11/295 (3%)

Query: 13  LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSH 72
                  R+                +   + + +       +    ++S    Q  KF  
Sbjct: 37  FDFSSQDRIVRG------RMPTLELINERFARHMRISLFNMLRKTAEVSINGVQMMKFGE 90

Query: 73  IIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEK 132
             ++       +            I     LV  L+EN  G       ++  R  +  E+
Sbjct: 91  YQNTLYVPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRFHAKIEGREFTPTER 150

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
           ++ +  +  +     +  S         E                 E +   + ++ ++ 
Sbjct: 151 RIIQLLLKIVFEDYKEAWSPVMGVE--FEYLDSEVNPSMANIVSPTEVIVVSSFHIEVDG 208

Query: 193 VASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
               F +++P   +     +  +  Q+               +     VN    +  K  
Sbjct: 209 GGGDFHVVMPYSMVEPIRELLDAGVQSDKMETDVRWSSALREEIMDCPVNFRVNLLEKDI 268

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
           +L+D++ L+ G VIP    +   A++       Y  ++G+  +   ++I++ I  
Sbjct: 269 SLRDLMELRPGDVIPIEMPKH--AVMFVEELPTYRVKMGQSNEKLAVQISEEIER 321


>gi|238782828|ref|ZP_04626857.1| Flagellar motor switch protein fliM [Yersinia bercovieri ATCC
           43970]
 gi|238716251|gb|EEQ08234.1| Flagellar motor switch protein fliM [Yersinia bercovieri ATCC
           43970]
          Length = 332

 Score =  239 bits (609), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 42/306 (13%), Positives = 99/306 (32%), Gaps = 10/306 (3%)

Query: 2   RGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDIS 61
             +++ +   P  P    R+       +        +   + +         +    DI+
Sbjct: 28  NNRTLDEGIKPYDPNTQRRVV------RERLHSLEIINERFARQFRIGLFNLLRRSPDIT 81

Query: 62  YTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQ 121
             + +   +     +       +   ++          S NLV   ++NL G       +
Sbjct: 82  AGNIKIQPYHDFARNLPVPTNLNLVHMNPLRGTALFVFSPNLVFMAVDNLFGGDGRFPTK 141

Query: 122 LYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFV 181
              R  +  E+++  R +A      +   S+  +          I     N     N+ V
Sbjct: 142 ADGREFTPTEQRVINRMLAMALEAYDFAWSSIFKLKTEYVRAE-IQVKFTNITSSPNDIV 200

Query: 182 TTINMNMTIENVASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQLNV 240
            T    + I      F + IP   +     +  S     S  + +   +  A +  +  +
Sbjct: 201 VTTPFYVEIGPHRGEFDICIPFSIIEPLRELLTSPPMESSRQEEKQWRNTLASQVRETEL 260

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            +  +     T L +++++K G VIP   +         +G  ++S + G + K Y +++
Sbjct: 261 ELVAKFADISTRLSNIMSMKEGDVIPIDKK--ESIEACVDGVPVFSGKYGYMNKQYALKV 318

Query: 301 TDRINF 306
              +N 
Sbjct: 319 EKILNP 324


>gi|241203098|ref|YP_002974194.1| surface presentation of antigens (SPOA) protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240856988|gb|ACS54655.1| surface presentation of antigens (SPOA) protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 316

 Score =  239 bits (609), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 103/305 (33%), Positives = 169/305 (55%)

Query: 12  PLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFS 71
            + P LLA+LTG LGD+  + KI SS G +Y +F P + K +  LDV ++Y  C+ G  +
Sbjct: 12  AMDPALLAKLTGGLGDRGGVAKICSSFGEIYSEFFPDVIKSETGLDVTVNYLGCEIGYKN 71

Query: 72  HIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVE 131
           H+I     N     A+L +WS N  + C N  VITL+E+LLGA+ +TI +  +R LS +E
Sbjct: 72  HLIEDLSANVTLVDATLRNWSQNITLACGNGFVITLMEHLLGATADTIEEPADRLLSIIE 131

Query: 132 KKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIE 191
             LA     +I+ VL   ++      P+L   + +D   +      +EF   INM++T+ 
Sbjct: 132 LDLAVMVFDKIAKVLRSAVNAPGGFEPSLSAPHALDARARPPEDRPDEFAAAINMSITLA 191

Query: 192 NVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
            + S F LI+PQ  LLKT +     + ++  +S +  +    +  + +V ++ +I L+  
Sbjct: 192 GIVSEFALIVPQTALLKTKVTPPKPKRQATGKSPEWTEQLGDQVRRSHVTLEAKIRLQDL 251

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSL 311
           TL+ +  L +G VIPF         +SAN KE+Y CE GR G+NY +R+ D +N D + +
Sbjct: 252 TLRTISKLMVGDVIPFRDHGDVRVEVSANSKELYVCEFGRSGENYMVRVKDTMNSDDELI 311

Query: 312 KNFLH 316
           ++ ++
Sbjct: 312 RHLMN 316


>gi|303240276|ref|ZP_07326795.1| flagellar motor switch protein FliM [Acetivibrio cellulolyticus
           CD2]
 gi|302592186|gb|EFL61915.1| flagellar motor switch protein FliM [Acetivibrio cellulolyticus
           CD2]
          Length = 329

 Score =  239 bits (609), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 45/307 (14%), Positives = 98/307 (31%), Gaps = 8/307 (2%)

Query: 7   HKNTSPLHPILL-ARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSC 65
           H  T+P    +            K   K  + +   Y + L       +   V ++  S 
Sbjct: 26  HMTTTPEEKKIRNHDFRRPSKFAKDHMKTLNIIHDNYARLLTNFLSGYLRTLVQVAVISV 85

Query: 66  QSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNR 125
           ++  +    +S     V +    S  S +     +  +   L++ +LG     + ++  R
Sbjct: 86  EAIAYYEFNNSISNPAVLAIVDFSPLSGSIIFEMAPPIAYALIDRILGGKGSPMEKI--R 143

Query: 126 SLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTIN 185
             + VE  + +R I Q+  ++ +         P LE        +      +NE V  I 
Sbjct: 144 EFTEVELAIIERIIIQVLNLMREPWENVIAIRPRLEKIET--NAQFAQIISANEMVALIT 201

Query: 186 MNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNI 242
           +   I +V     + IP   +              N  + ++ +  D    K     V +
Sbjct: 202 LGAKIGDVEGMINICIPHMVVEPIVSKLSTKFWFSNSEKEKTNESKDTIELKIENTKVPV 261

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
              +      + D + L+ G VIP          +       +    G       I++ +
Sbjct: 262 RAVLGRSTILVNDFLELQPGDVIPLDSSVSGNLEILVGDLLKFYGTPGVKKNRVAIKVNE 321

Query: 303 RINFDQK 309
            +  +++
Sbjct: 322 VVRGEEE 328


>gi|259908765|ref|YP_002649121.1| flagellar motor switch protein FliM [Erwinia pyrifoliae Ep1/96]
 gi|224964387|emb|CAX55896.1| Flagellar motor switch protein [Erwinia pyrifoliae Ep1/96]
 gi|283478741|emb|CAY74657.1| Flagellar motor switch protein FliM [Erwinia pyrifoliae DSM 12163]
          Length = 336

 Score =  239 bits (609), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 40/301 (13%), Positives = 94/301 (31%), Gaps = 10/301 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
             +  P  P    R+       +   +    +   + +         +    DI+  + +
Sbjct: 33  DSHIRPYDPNTQRRVV------RERLQALEIINERFARSYRMALFNLLRRSPDITVGAIK 86

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
              +     +       +   L        +  S +LV   ++NL G       ++  R 
Sbjct: 87  IQPYHEFARNLPVPTNLNLIHLKPLRGTALVVFSPSLVFIAVDNLFGGDGRFPTKVEGRE 146

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E+++ +R +       ++                 +     N     N+ V T   
Sbjct: 147 FTHTEQRVIRRMLKLALEGYSEAWKPIYPLDVEYVRSE-MQVKFTNITTSPNDIVVTTPF 205

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQLNVNIDTR 245
           ++ I N+   F + IP   +       ++     S  + E+  D   ++     + +   
Sbjct: 206 HVEIGNLTGEFNICIPFSMIEPLRETLVNPPIENSLTEDENWRDTLVKQVQHSELELVAN 265

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
                  +  ++ LK G V+P         I   +G  + + + G + K Y +R+   IN
Sbjct: 266 FADVSMRISRLLALKPGDVLPIEKL--DRIIAHVDGVPVLTSQYGTLNKQYALRVEHLIN 323

Query: 306 F 306
            
Sbjct: 324 P 324


>gi|254478863|ref|ZP_05092227.1| flagellar motor switch protein FliM [Carboxydibrachium pacificum
           DSM 12653]
 gi|214035176|gb|EEB75886.1| flagellar motor switch protein FliM [Carboxydibrachium pacificum
           DSM 12653]
          Length = 330

 Score =  239 bits (609), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 43/284 (15%), Positives = 99/284 (34%), Gaps = 6/284 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +    +   + + L       +   V+++  S     +    +S       +   
Sbjct: 48  SKEQLRTLQMIFENFSRSLTSFLSGYLRTIVNVAVVSVDQLTYYEFSNSLNNPVFIAIID 107

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
            S     F +  +NN    +L+ LLG   +   +  +R  + +E  L  + + QI  +L 
Sbjct: 108 ASPLEGLFLLELNNNTTYAILDRLLGGMGK--GEFLDRDYTEIEVNLLTKIVKQILPLLE 165

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  S   + +P+L         +       NE V    +++ I          +P  TL 
Sbjct: 166 EPWSNIIDLTPSLMRVET--NSQFAQIISPNETVALCTLSIKINETEGMMNFCMPHLTLE 223

Query: 208 KTTLISLSS--QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVI 265
                  +    +  + + +   +    K  +  + +  ++     T+ D++  ++G VI
Sbjct: 224 PIVPKLTTKFWFSSMKKEEKVNPELIKEKIDKTYIPLTVQLGSTTVTVGDLLKFEVGDVI 283

Query: 266 PFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
               R      +  + K  +    G   K Y+++IT+ I    +
Sbjct: 284 MLDKRYNEPVEVIIDKKVKFKGIPGIKSKRYSVKITEVIYKGDE 327


>gi|312884904|ref|ZP_07744594.1| flagellar motor switch protein FliM [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309367381|gb|EFP94943.1| flagellar motor switch protein FliM [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 348

 Score =  238 bits (608), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 35/302 (11%), Positives = 86/302 (28%), Gaps = 11/302 (3%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
           + +         R+                +   + + L       +    ++S    Q 
Sbjct: 31  EGSVDFDFSSQDRIVRG------RMPTLELINERFARHLRISLFNMLRKTAEVSINGVQM 84

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSL 127
            KF    ++       +            +     LV  L+EN  G       ++  R  
Sbjct: 85  MKFGEYQNTLYVPTSLNMVRFRPLKGTGLVTMEARLVFILVENFFGGEGRYHSRIEGREF 144

Query: 128 STVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMN 187
           +  E+++ +  +  I     +  S         E                 E +   + +
Sbjct: 145 TPTERRIVQLLLKIIFEDYKEAWSPVMGVE--FEYLDSEVNPSMANIVSPTEVIVVSSFH 202

Query: 188 MTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRI 246
           + ++     F ++ P   +     +  +  Q+               +   + +N    +
Sbjct: 203 VEVDGGGGDFHVVFPYSMVEPIRELLDAGVQSDKMEADVRWSSALKEEIMDVPINFRVNL 262

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                 L+D++ L+ G +IP        A++       Y  ++GR      I+I++ I  
Sbjct: 263 LEHDIALRDLMELQPGDIIPVEMPPH--AVMFVEELPTYRVKMGRSSDKLAIQISEEIKR 320

Query: 307 DQ 308
             
Sbjct: 321 PD 322


>gi|73532540|dbj|BAE19828.1| flagellar motor switch protein [Edwardsiella tarda]
          Length = 337

 Score =  238 bits (608), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 39/304 (12%), Positives = 98/304 (32%), Gaps = 10/304 (3%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           ++   +  P  P    R+       +   +    +   + +         +    DI+  
Sbjct: 31  ENHDGDVRPYDPTTQRRVV------RERLQALEIVNERFARQFRMGLFNLVRRSPDITVG 84

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
           + +   +     +       +   L        +    +LV   ++NL G       ++ 
Sbjct: 85  AVRIQPYHEFARNLPVPTNLNLVHLKPLRGTALMVFEPSLVFMAVDNLFGGDGRFPTKVD 144

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  +  E+++ +R +               +          I     N     N+ V T
Sbjct: 145 GREFTHTEQRVIQRMLRLALDAYRDAWGAIFKLDVKYVR-SKIQVKFTNITTSPNDIVVT 203

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNI 242
               + +  ++  F + IP   +     + ++   + S+ + +   D  +++     + +
Sbjct: 204 TPFTVEVGALSGEFNICIPFSMIGTLRELLVNPPLENSKQEDQHWRDTLSKQVQHSELEL 263

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
                     L DV+ L+IG V+P         + + +G  + +C+ G     Y +R+  
Sbjct: 264 VANFVDVPLRLSDVLKLQIGDVLPIDRP--DRLVANVDGVPVLTCQYGCYHGQYALRVEK 321

Query: 303 RINF 306
            IN 
Sbjct: 322 MINP 325


>gi|302185372|ref|ZP_07262045.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           syringae 642]
          Length = 322

 Score =  238 bits (608), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 44/306 (14%), Positives = 98/306 (32%), Gaps = 17/306 (5%)

Query: 5   SIHKNTSP-----LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVD 59
               N+ P            R+                +   + ++        +    D
Sbjct: 25  QTDNNSEPGSVKSYDLTSQDRIVRG------RMPTLEMINERFARYTRISMFNLLRRSAD 78

Query: 60  ISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETI 119
           ++    Q  KF   +HS       + A +              LV  L++N  G      
Sbjct: 79  VAVGGVQVMKFGEYVHSLYVPTSLNLAKIKPLRGTALFILDAKLVFKLVDNFFGGDGR-H 137

Query: 120 PQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNE 179
            ++  R  +  E ++ +  + Q    L +      E +   E                +E
Sbjct: 138 AKIEGREFTPTELRVVRMVLDQAFVDLKEAWQAIMEVN--FEYINSEVNPAMANIVGPSE 195

Query: 180 FVTTINMNMTIENVASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQL 238
            V     ++ ++       + +P   +     +  +  Q+  ++Q E  ++        +
Sbjct: 196 AVVISTFHIELDGGGGDLHVTMPYSMIEPIREMLDAGFQSDLDDQDERWVNALKEDVLDV 255

Query: 239 NVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTI 298
           NV + T I  ++  L+D++ ++ G VIP         +L ANG   +  +LG       +
Sbjct: 256 NVPLTTTIAQRQLPLRDILHMRPGDVIPVEL--SDSLVLRANGVPSFKVKLGSHKGKMAL 313

Query: 299 RITDRI 304
           ++ + I
Sbjct: 314 QVIEPI 319


>gi|238916760|ref|YP_002930277.1| flagellar motor switch protein FliM [Eubacterium eligens ATCC
           27750]
 gi|238872120|gb|ACR71830.1| flagellar motor switch protein FliM [Eubacterium eligens ATCC
           27750]
          Length = 327

 Score =  238 bits (608), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 40/308 (12%), Positives = 101/308 (32%), Gaps = 13/308 (4%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           +  K          ++        K   +    +   + + L       +   V +   +
Sbjct: 30  TEEKQVKNYDFARPSKF------SKEHLRTLEIIFEHFGRLLATNLPAYLRKSVSVDVVN 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +S   ++     +     +   S N  +  ++NL   +++ LLG +  ++ +   
Sbjct: 84  SEVVIYSEFSNALSNPVLLGVVGMQPLSGNIIMEMASNLGFAIVDRLLGGAGNSLDK--E 141

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  S +E  + +R       ++ +      + +P LE        +       +E +  +
Sbjct: 142 RDFSEIELSILERIFTVCVNLMQEPWENVVKVNPRLERIET--NSQFAQIISPSETIAIV 199

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLIS---LSSQNKSENQSEDLIDPFARKTYQLNVN 241
            +N+ I +V     + +P  TL              N  E  +    D       +  + 
Sbjct: 200 TINLKIGDVEGLVNICLPFATLEPVMDKLNTKYWFSNMQEKDTNTYEDAIETVIDKAMIP 259

Query: 242 IDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
           +   +   K ++ D   L+IG +I    +      +     + +    G     Y +R+T
Sbjct: 260 VKAVLGTSKISVSDFANLQIGDIIRIDKKVDQELEVFVGNIKKFKALPGYYEDKYAVRVT 319

Query: 302 DRINFDQK 309
           + I  + +
Sbjct: 320 EVIRKESE 327


>gi|256830498|ref|YP_003159226.1| flagellar motor switch protein FliM [Desulfomicrobium baculatum DSM
           4028]
 gi|256579674|gb|ACU90810.1| flagellar motor switch protein FliM [Desulfomicrobium baculatum DSM
           4028]
          Length = 325

 Score =  238 bits (608), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 45/292 (15%), Positives = 95/292 (32%), Gaps = 10/292 (3%)

Query: 12  PLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFS 71
                   R+            +   +   + +         M   VD++  S    KF 
Sbjct: 37  AFDLANQDRIIRG------RMPVLEIINDRFSRLCTSALANTMRKRVDVNPISIDMSKFG 90

Query: 72  HIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVE 131
             + S       +   +     N  +     LV +L+EN  G +     ++  R  + +E
Sbjct: 91  DFMRSLPVPTSINIFKIDPLRGNALLVVDTRLVFSLVENFFGGAGSQP-KIEGRDFTPIE 149

Query: 132 KKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIE 191
           + +  + +  I A L        E   ++E        +  T    ++ V  I+  + +E
Sbjct: 150 QSIIVKVVKIILANLEDAWRPVHEV--SIELLRSEINPQFATIVPPSDVVVVISFEVELE 207

Query: 192 NVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKK 250
           N   S VL +P  T+         + Q +        I  F  +  +  V+++      +
Sbjct: 208 NALGSMVLALPYATIEPIRSKLYAAFQTERLEIDHAWISRFRDRLMETPVDMNVTFGTTQ 267

Query: 251 TTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
            T + ++ +K+G ++     E        +G   +    G V  N   +I  
Sbjct: 268 ITGRQLLDMKVGDILMLDQDEDDMLSGRIHGILKFFGLPGFVKGNKAFKIIK 319


>gi|114566396|ref|YP_753550.1| hypothetical protein Swol_0861 [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
 gi|114337331|gb|ABI68179.1| conserved hypothetical protein [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
          Length = 328

 Score =  238 bits (608), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 41/285 (14%), Positives = 96/285 (33%), Gaps = 7/285 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K        +   Y + L      ++ + + +   S +   +   I S     + +  S
Sbjct: 48  SKDQIHTLQVIYENYARTLGTYLSGQLRVPLQVELLSVEQLTYEEFIRSIPNPTILNIFS 107

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           L     +  +  + NL    L+ LLG       +   R+L+ +E+ + +R   ++   L 
Sbjct: 108 LYPLHGSAIMEINPNLGFAFLDRLLGGPGYAPSK--ARALTEIEQTVIERLSQRMLDYLE 165

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +   +  +  P+LE        +        E +  +++   + +V     + IP   L 
Sbjct: 166 EPWGSIIQIEPSLERVET--NPQFTQLVQPTEIMIIVSLETRMGDVMGMINICIPFLVLE 223

Query: 208 KTTLIS---LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                          ++ +S   I     K     + I   +     T++D++ L +G V
Sbjct: 224 PILDKLNVHYYYSTAAQERSPANIAAIRTKLENTTIPIKVVMGKTVITVRDLLALSVGDV 283

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
           IP          +    +  +  + G       I++T  +  + +
Sbjct: 284 IPLNRNISQELDIVIGNRAKFLGKPGVFANRMAIQVTGIVEEESE 328


>gi|262166227|ref|ZP_06033964.1| flagellar motor switch protein FliM [Vibrio mimicus VM223]
 gi|262025943|gb|EEY44611.1| flagellar motor switch protein FliM [Vibrio mimicus VM223]
          Length = 300

 Score =  238 bits (607), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 35/278 (12%), Positives = 88/278 (31%), Gaps = 5/278 (1%)

Query: 32  EKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSW 91
                 +   + + L       +    ++S    Q  KF    ++       +       
Sbjct: 1   MPTLELINERFARHLRISLFNMLRKTAEVSINGVQMMKFGEYQNTLYVPTSLNMVRFRPL 60

Query: 92  SSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCIS 151
                +     LV  L+EN  G       ++  R  +  E+++ +  +  + A   +  S
Sbjct: 61  KGTALVTMEARLVFILVENFFGGDGRYHARIEGREFTPTERRVIQLLLKIVFADYKEAWS 120

Query: 152 TTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTL 211
                    E                 E +   + ++ ++     F +++P   +     
Sbjct: 121 PVMGVE--FEYLDSEVNPSMANIVSPTEVIVVSSFHVEVDGGGGDFHMVMPYSMVEPIRE 178

Query: 212 ISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHR 270
           +  +  Q+               +   + VN    +      L+D++ L++G VIP    
Sbjct: 179 LLDAGVQSDKMETDVRWSTALREEIMDVPVNFRVNLLEMDIALRDLMELQVGDVIPIKMP 238

Query: 271 EKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
               A++       Y  ++GR G+   ++++++I    
Sbjct: 239 --EHAVMFVEELPTYRVKMGRSGEKLAVQVSEKIKRPD 274


>gi|261209862|ref|ZP_05924163.1| flagellar motor switch protein FliM [Vibrio sp. RC341]
 gi|260841048|gb|EEX67573.1| flagellar motor switch protein FliM [Vibrio sp. RC341]
          Length = 349

 Score =  238 bits (607), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 36/297 (12%), Positives = 90/297 (30%), Gaps = 11/297 (3%)

Query: 13  LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSH 72
                  R+                +   + + L       +    ++S    Q  KF  
Sbjct: 37  FDFSSQDRIVRG------RMPTLELINERFARHLRISLFNMLRKTAEVSINGVQMMKFGE 90

Query: 73  IIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEK 132
             ++       +            +     LV  L+EN  G       ++  R  +  E+
Sbjct: 91  YQNTLYVPTSLNMVRFRPLKGTALVTMEARLVFILVENFFGGDGRYHARIEGREFTPTER 150

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
           ++ +  +  + A   +  S         E                 E +   + ++ ++ 
Sbjct: 151 RVIQLLLKIVFADYKEAWSPVMGVE--FEYLDSEVNPSMANIVSPTEVIVVSSFHVEVDG 208

Query: 193 VASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
               F +++P   +     +  +  Q+               +   + VN    +     
Sbjct: 209 GGGDFHMVMPYSMVEPIRELLDAGVQSDKMETDVRWSTALREEIMDVPVNFRVNLLEMDI 268

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
            L+D++ L++G VIP        A++       Y  ++GR G+   ++++++I    
Sbjct: 269 ALRDLMELQVGDVIPIKMP--EHAVMFVEELPTYRVKMGRSGEKLAVQVSEKIKRPD 323


>gi|149377878|ref|ZP_01895607.1| flagellar motor switch protein M [Marinobacter algicola DG893]
 gi|149357820|gb|EDM46313.1| flagellar motor switch protein M [Marinobacter algicola DG893]
          Length = 332

 Score =  238 bits (607), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 43/301 (14%), Positives = 96/301 (31%), Gaps = 12/301 (3%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           ++              R+                +   + ++        +  + D+S  
Sbjct: 27  ETDEAGIKSYDLASQDRIVRG------RMPTLEMINERFARYTRISLFNLLRRNADVSTG 80

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
             Q  KF   IH+       +   +              LV  L++N  G       ++ 
Sbjct: 81  GVQIMKFGEYIHTLYVPTSLNLCKVRPLRGTSLFVLDAKLVFKLVDNFFGGEGR-HAKIE 139

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  +  E ++ +  + Q+   + +      +     E                +E V  
Sbjct: 140 GREFTPTETRIVQMVLDQVFHDMREAWHAVLKVD--FEYLSSEVNPAMANIVSPSEVVVV 197

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNI 242
              ++ ++       + +P   +     +  +  Q+  ++  E  +         +NV I
Sbjct: 198 STFHIELDGGGGELHMALPYSMIEPIRDVLDAGVQSDIDDVDERWVSALQEDIKDVNVPI 257

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
           +T +  ++ +L+D+  LK G +IP          L+ANG  +Y   +G       +RI D
Sbjct: 258 NTTVCRRRISLRDIAKLKEGDIIPVEIP--ELLTLTANGIPVYKATMGTRDGKLALRIHD 315

Query: 303 R 303
           R
Sbjct: 316 R 316


>gi|317129197|ref|YP_004095479.1| flagellar motor switch protein FliM [Bacillus cellulosilyticus DSM
           2522]
 gi|315474145|gb|ADU30748.1| flagellar motor switch protein FliM [Bacillus cellulosilyticus DSM
           2522]
          Length = 332

 Score =  238 bits (607), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 42/316 (13%), Positives = 108/316 (34%), Gaps = 13/316 (4%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           ++ +   K           R        K   +  + +   Y + L      ++   V +
Sbjct: 27  LKKEETQKKIKVYDFKRALRF------SKDQIRSLTRIHENYARLLTTQLSAQLRTYVQV 80

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           +  S     +   I S  +  + +          F I  + N+   +L+ +LG   E + 
Sbjct: 81  AVASVDQLPYDEFIRSVPKMTILNVFEPFPLDGRFVIEVNPNIAYAMLDRMLGGQGEALN 140

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++ +  L+ +E K+  +   +    L +   +  +  P +++       +       NE 
Sbjct: 141 KVES--LTEIETKILSQLFQRSLETLREAWESVVDLDPVMDEIEV--NPQFLQLVSPNET 196

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQ 237
           V  I+++ TI   +    + +P   +             Q K +++    +    +   Q
Sbjct: 197 VVVISLSTTIGEASGMMNICLPHVVIESILPKLSIHLWMQQKKKDRQPGELSALEKNLKQ 256

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             +++   +   + ++ + + L    VI          ++    +  Y  + G+V     
Sbjct: 257 APLDVIVELGQSQISIAEFLQLGENDVIELNQTIDDPLLVKLGNEPKYYSQPGKVKGKLA 316

Query: 298 IRITDRINFDQKSLKN 313
           ++ITD I  + +S   
Sbjct: 317 VQITDSIVKEGESDDE 332


>gi|118443285|ref|YP_877941.1| flagellar motor switch protein FliM [Clostridium novyi NT]
 gi|118133741|gb|ABK60785.1| flagellar motor switch protein FliM [Clostridium novyi NT]
          Length = 331

 Score =  238 bits (607), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 43/285 (15%), Positives = 97/285 (34%), Gaps = 7/285 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +    +   + + +      ++  +V I+  + Q   +   IHS     + +   
Sbjct: 48  SKDHIRTLELIHDNFARTISNYLTAQVRTNVKINIETVQQITYEEFIHSVPNPTILTIFK 107

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +   S +     +      +++ LLG S     +   R  + ++K + K+    + A L 
Sbjct: 108 MPPLSGSILFETNPQFAYQIIDVLLGGSGT--GKYKTREFTDIDKNIIKQINKGLIANLK 165

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
                  E  P +E          N     NE V  I  ++ +    +   + IP  ++ 
Sbjct: 166 LAWEDVMEVEPEIEGLET--NPALNQTLAPNEPVALITFSVEMGGNNTFINICIPYLSIE 223

Query: 208 KTTLIS---LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
           K           +  +    E   +   ++   + + +   +     T+   +TL +G V
Sbjct: 224 KVLDKLVVQYWFRENNTETLEGSKEKLRKRMNVVELPMTVVLGSTNLTIGQFLTLSVGDV 283

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
           I       +   +    +       G +GKN  ++I D I+ D +
Sbjct: 284 ITLDSLTSSPVKVVVGNEPYLLGRPGTIGKNRGVQILDIIDKDVE 328


>gi|51596032|ref|YP_070223.1| flagellar motor switch protein FliM [Yersinia pseudotuberculosis IP
           32953]
 gi|153949279|ref|YP_001401268.1| flagellar motor switch protein FliM [Yersinia pseudotuberculosis IP
           31758]
 gi|51589314|emb|CAH20935.1| flagellar motor switch protein FliM [Yersinia pseudotuberculosis IP
           32953]
 gi|152960774|gb|ABS48235.1| flagellar motor switch protein FliM [Yersinia pseudotuberculosis IP
           31758]
          Length = 333

 Score =  238 bits (607), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 35/303 (11%), Positives = 88/303 (29%), Gaps = 10/303 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           +   +  P  P    R+       +        +   + +         +    DI+   
Sbjct: 29  ANETDVKPYDPTTQRRVV------RERLHALEIINERFARQFRMGLFNLLRRSPDITVGP 82

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L           + +LV   ++NL G       ++  
Sbjct: 83  IKIQPYHDFARNLPVPTNLNLVHLKPLRGTALFVFAPSLVFIAVDNLFGGDGRFPTKVEG 142

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +           +   +          I     N     N+ V + 
Sbjct: 143 REFTHTEQRVITRMLRLALDAYRDAWAAIYKIDVEYVRSE-IQVKFTNITTSPNDIVVST 201

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNID 243
              + I  ++  F + IP   +     +  +   + S  +     +   ++     + + 
Sbjct: 202 PFQVEIGTLSGEFNICIPFAMIEPLRELLTNPPLENSRQEDNYWRETLVKQVQHSELELV 261

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ L+ G V+P         I   +G  + + + G +   Y +R+   
Sbjct: 262 ANFVDIPLRLSQILKLQPGDVLPIEKP--DRLIGHVDGVPVLTSQYGTLNGQYALRVEHL 319

Query: 304 INF 306
           IN 
Sbjct: 320 INP 322


>gi|311695206|gb|ADP98079.1| flagellar motor switch protein FliM-like protein [marine bacterium
           HP15]
          Length = 332

 Score =  238 bits (606), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 42/301 (13%), Positives = 97/301 (32%), Gaps = 12/301 (3%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           ++              R+                +   + ++        M  + D+S  
Sbjct: 27  ETDDTGIKSYDLASQDRIVRG------RMPTLEMINERFARYTRISLFNLMRRNADVSTG 80

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
             Q  KF   IH+       +   +              LV  L++N  G       ++ 
Sbjct: 81  GVQIMKFGEYIHTLYVPTSLNLCKVRPLRGTSLFVLDAKLVFKLVDNFFGGEGR-HAKIE 139

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  +  E ++ +  + Q+   + +      +     E                +E V  
Sbjct: 140 GREFTPTETRIVQMVLDQVFHDMKEAWHAVLKVD--FEYLSSEVNPAMANIVSPSEVVVV 197

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNI 242
              ++ ++         +P   +     +  +  Q+  ++  E  ++       +++V I
Sbjct: 198 STFHIELDGGGGELHFALPYSMIEPIRDVLDAGVQSDIDDVDERWVNALQEDIKEVSVPI 257

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
           +T +  ++ +L+D+  +K G +IP          ++ANG  IY   LG       +RI +
Sbjct: 258 NTTVCRRRISLRDIAKMKAGDIIPVEIP--EHLTVTANGIPIYKATLGTRDGKLALRIHE 315

Query: 303 R 303
           R
Sbjct: 316 R 316


>gi|22126366|ref|NP_669789.1| flagellar motor switch protein FliM [Yersinia pestis KIM 10]
 gi|45441387|ref|NP_992926.1| flagellar motor switch protein FliM [Yersinia pestis biovar
           Microtus str. 91001]
 gi|108807195|ref|YP_651111.1| flagellar motor switch protein FliM [Yersinia pestis Antiqua]
 gi|108812461|ref|YP_648228.1| flagellar motor switch protein FliM [Yersinia pestis Nepal516]
 gi|145598589|ref|YP_001162665.1| flagellar motor switch protein FliM [Yersinia pestis Pestoides F]
 gi|149366229|ref|ZP_01888264.1| flagellar motor switch protein FliM [Yersinia pestis CA88-4125]
 gi|165925921|ref|ZP_02221753.1| flagellar motor switch protein FliM [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165938773|ref|ZP_02227328.1| flagellar motor switch protein FliM [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166010886|ref|ZP_02231784.1| flagellar motor switch protein FliM [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166210779|ref|ZP_02236814.1| flagellar motor switch protein FliM [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|167401189|ref|ZP_02306692.1| flagellar motor switch protein FliM [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|167420157|ref|ZP_02311910.1| flagellar motor switch protein FliM [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167425859|ref|ZP_02317612.1| flagellar motor switch protein FliM [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|167467512|ref|ZP_02332216.1| flagellar motor switch protein FliM [Yersinia pestis FV-1]
 gi|170024624|ref|YP_001721129.1| flagellar motor switch protein FliM [Yersinia pseudotuberculosis
           YPIII]
 gi|186895137|ref|YP_001872249.1| flagellar motor switch protein FliM [Yersinia pseudotuberculosis
           PB1/+]
 gi|218928944|ref|YP_002346819.1| flagellar motor switch protein FliM [Yersinia pestis CO92]
 gi|229896268|ref|ZP_04511438.1| flagellar motor switch protein FliM [Yersinia pestis Pestoides A]
 gi|229897205|ref|ZP_04512361.1| flagellar motor switch protein FliM [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229897932|ref|ZP_04513083.1| flagellar motor switch protein FliM [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229902837|ref|ZP_04517954.1| flagellar motor switch protein FliM [Yersinia pestis Nepal516]
 gi|270486623|ref|ZP_06203697.1| flagellar motor switch protein FliM [Yersinia pestis KIM D27]
 gi|294504010|ref|YP_003568072.1| flagellar motor switch protein [Yersinia pestis Z176003]
 gi|21959351|gb|AAM86040.1|AE013852_2 flagellar motor switch protein [Yersinia pestis KIM 10]
 gi|45436247|gb|AAS61803.1| flagellar motor switch protein FliM [Yersinia pestis biovar
           Microtus str. 91001]
 gi|108776109|gb|ABG18628.1| flagellar motor switch protein FliM [Yersinia pestis Nepal516]
 gi|108779108|gb|ABG13166.1| flagellar motor switch protein FliM [Yersinia pestis Antiqua]
 gi|115347555|emb|CAL20464.1| flagellar motor switch protein FliM [Yersinia pestis CO92]
 gi|145210285|gb|ABP39692.1| flagellar motor switch protein FliM [Yersinia pestis Pestoides F]
 gi|149292642|gb|EDM42716.1| flagellar motor switch protein FliM [Yersinia pestis CA88-4125]
 gi|165913387|gb|EDR32009.1| flagellar motor switch protein FliM [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165922125|gb|EDR39302.1| flagellar motor switch protein FliM [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165990230|gb|EDR42531.1| flagellar motor switch protein FliM [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166207959|gb|EDR52439.1| flagellar motor switch protein FliM [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|166961852|gb|EDR57873.1| flagellar motor switch protein FliM [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167049578|gb|EDR60986.1| flagellar motor switch protein FliM [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|167055258|gb|EDR65055.1| flagellar motor switch protein FliM [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|169751158|gb|ACA68676.1| flagellar motor switch protein FliM [Yersinia pseudotuberculosis
           YPIII]
 gi|186698163|gb|ACC88792.1| flagellar motor switch protein FliM [Yersinia pseudotuberculosis
           PB1/+]
 gi|229680284|gb|EEO76383.1| flagellar motor switch protein FliM [Yersinia pestis Nepal516]
 gi|229688973|gb|EEO81038.1| flagellar motor switch protein FliM [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229693542|gb|EEO83591.1| flagellar motor switch protein FliM [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229701191|gb|EEO89220.1| flagellar motor switch protein FliM [Yersinia pestis Pestoides A]
 gi|262361804|gb|ACY58525.1| flagellar motor switch protein [Yersinia pestis D106004]
 gi|262366060|gb|ACY62617.1| flagellar motor switch protein [Yersinia pestis D182038]
 gi|270335127|gb|EFA45904.1| flagellar motor switch protein FliM [Yersinia pestis KIM D27]
 gi|294354469|gb|ADE64810.1| flagellar motor switch protein [Yersinia pestis Z176003]
 gi|320015439|gb|ADV99010.1| flagellar motor switch protein FliM [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 333

 Score =  238 bits (606), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 35/303 (11%), Positives = 88/303 (29%), Gaps = 10/303 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           +   +  P  P    R+       +        +   + +         +    DI+   
Sbjct: 29  ANETDVKPYDPTTQRRVV------RERLHALEIINERFARQFRMGLFNLLRRSPDITVGP 82

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L           + +LV   ++NL G       ++  
Sbjct: 83  IKIQPYHDFARNLPVPTNLNLVHLKPLRGTALFVFAPSLVFIAVDNLFGGDGRFPTKVEG 142

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +           +   +          I     N     N+ V + 
Sbjct: 143 REFTHTEQRVITRMLRLALDAYRDAWAAIYKIDVEYVRSE-IQVKFTNITTSPNDIVVST 201

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDLIDPFARKTYQLNVNID 243
              + I  ++  F + IP   +     +  +   + S  +     +   ++     + + 
Sbjct: 202 PFQVEIGTLSGEFNICIPFAMIEPLRELLTNPPLENSRQEDNYWRETLVKQVQHSELELV 261

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ L+ G V+P         I   +G  + + + G +   Y +R+   
Sbjct: 262 ANFVDIPLRLSQILKLQPGDVLPIEKP--DRLIGHVDGVPVLTSQYGTLNGQYALRVEHL 319

Query: 304 INF 306
           IN 
Sbjct: 320 INP 322


>gi|28899016|ref|NP_798621.1| flagellar motor switch protein FliM [Vibrio parahaemolyticus RIMD
           2210633]
 gi|153837001|ref|ZP_01989668.1| flagellar motor switch protein FliM [Vibrio parahaemolyticus
           AQ3810]
 gi|260365238|ref|ZP_05777795.1| flagellar motor switch protein FliM [Vibrio parahaemolyticus K5030]
 gi|260878788|ref|ZP_05891143.1| flagellar motor switch protein FliM [Vibrio parahaemolyticus
           AN-5034]
 gi|260897383|ref|ZP_05905879.1| flagellar motor switch protein FliM [Vibrio parahaemolyticus
           Peru-466]
 gi|260899942|ref|ZP_05908337.1| flagellar motor switch protein FliM [Vibrio parahaemolyticus
           AQ4037]
 gi|4322004|gb|AAD15907.1| polar flagellar switch protein FliM [Vibrio parahaemolyticus]
 gi|28807235|dbj|BAC60505.1| flagellar motor switch protein FliM [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149749774|gb|EDM60519.1| flagellar motor switch protein FliM [Vibrio parahaemolyticus
           AQ3810]
 gi|308088268|gb|EFO37963.1| flagellar motor switch protein FliM [Vibrio parahaemolyticus
           Peru-466]
 gi|308094184|gb|EFO43879.1| flagellar motor switch protein FliM [Vibrio parahaemolyticus
           AN-5034]
 gi|308107409|gb|EFO44949.1| flagellar motor switch protein FliM [Vibrio parahaemolyticus
           AQ4037]
 gi|308115479|gb|EFO53019.1| flagellar motor switch protein FliM [Vibrio parahaemolyticus K5030]
 gi|328474447|gb|EGF45252.1| flagellar motor switch protein FliM [Vibrio parahaemolyticus 10329]
          Length = 348

 Score =  238 bits (606), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 34/295 (11%), Positives = 84/295 (28%), Gaps = 11/295 (3%)

Query: 13  LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSH 72
                  R+                +   + + +       +    ++S    Q  KF  
Sbjct: 37  FDFSSQDRIVRG------RMPTLELINERFARHMRISLFNMLRKTAEVSINGVQMMKFGE 90

Query: 73  IIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEK 132
             ++       +            I     LV  L+EN  G       ++  R  +  E+
Sbjct: 91  YQNTLYVPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRFHAKIEGREFTPTER 150

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
           ++ +  +  +     +  S         E                 E +   + ++ ++ 
Sbjct: 151 RIIQLLLKIVFEDYKEAWSPVMGVE--FEYLDSEVNPSMANIVSPTEVIVVSSFHIEVDG 208

Query: 193 VASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
               F +++P   +     +  +  Q+               +     VN    +  K  
Sbjct: 209 GGGDFHVVMPYSMVEPIRELLDAGVQSDKMETDVRWSSALREEIMDCPVNFRVNLLEKDI 268

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
           +L+D++ L+ G +IP        A +       Y  ++GR      ++++  I  
Sbjct: 269 SLRDLMELQPGDIIPIEMP--EHATMFIEDLPTYRVKMGRSEDKLAVQVSQEIER 321


>gi|70729040|ref|YP_258774.1| flagellar motor switch protein FliM [Pseudomonas fluorescens Pf-5]
 gi|68343339|gb|AAY90945.1| flagellar motor switch protein FliM [Pseudomonas fluorescens Pf-5]
          Length = 322

 Score =  238 bits (606), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 38/299 (12%), Positives = 92/299 (30%), Gaps = 12/299 (4%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +          R+                +   + ++        +    D++    Q  
Sbjct: 34  SVKSYDLTSQDRIVRG------RMPTLEMINERFARYTRISMFNMLRRSADVAVGGVQVM 87

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           KF   +HS       +   +              LV  L++N  G       ++  R  +
Sbjct: 88  KFGEYVHSLYVPTSLNLVKIKPLRGTALFILDAKLVFKLVDNFFGGDGR-HAKIEGREFT 146

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E ++ +  + Q    L +        +   E                +E +     ++
Sbjct: 147 PTELRVVRMVLEQAFVDLKEAWQAIMPVN--FEYINSEVNPAMANIVGPSEAIVVSTFHI 204

Query: 189 TIENVASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            ++       + +P   +     +  +  Q+  ++Q E            + V +   + 
Sbjct: 205 ELDGGGGDLHVTMPYSMIEPIREMLDAGFQSDLDDQDERWSKALREDVLDVAVPLSATVA 264

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
            ++  L+D++ ++ G VIP    E    I+ ANG   +  +LG    N  +++ + I  
Sbjct: 265 RRQLRLRDILHMQPGDVIPVELPED--MIMRANGVPSFKVKLGSHKGNLALQVIEPIER 321


>gi|253990101|ref|YP_003041457.1| flagellar motor switch protein FliM [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|253781551|emb|CAQ84714.1| flagellar motor switch protein flim [Photorhabdus asymbiotica]
          Length = 334

 Score =  238 bits (606), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 35/313 (11%), Positives = 91/313 (29%), Gaps = 10/313 (3%)

Query: 2   RGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDIS 61
              S      P  P    R+       +   +    +   + +         +    DI+
Sbjct: 26  NTASRENEVRPYDPNTQRRVV------RERLQALEIINERFARHFRMGLFNMLRRSPDIT 79

Query: 62  YTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQ 121
             + +   +     +       +   L           + +LV   ++NL G       +
Sbjct: 80  VGAIKIQPYHEFARNLAVPTNLNLVHLKPLRGTALFAFAPSLVYIAVDNLFGGDGRFPTK 139

Query: 122 LYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFV 181
           +  R  +  E+++  R +            +  +          +     N     N+ V
Sbjct: 140 VEGREFTNTEQRVINRMLRMALDSYRDAWDSIFKIEVEYVRSE-MQVKFTNITTSPNDIV 198

Query: 182 TTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKS-ENQSEDLIDPFARKTYQLNV 240
            T    + I  ++  F + IP   +        +   ++   +     +   ++     +
Sbjct: 199 VTTPFQVEIGALSGEFNICIPFAMIEPLRERLTNPPLENVRQEDSLWRESLVKQVQHSEL 258

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            +          L  ++ L+ G ++P         I+  +G  + + + G +   Y +R+
Sbjct: 259 ELVANFVDIPLRLSKILQLQPGDILPIDKP--ERLIVHVDGVPVLTSQYGTLNGQYALRV 316

Query: 301 TDRINFDQKSLKN 313
              IN    +L  
Sbjct: 317 EHLINPVLNALDE 329


>gi|209963533|ref|YP_002296448.1| flagellar motor switch protein FliM [Rhodospirillum centenum SW]
 gi|7025355|gb|AAF35846.1|AF220002_3 lateral flagellar motor switch protein FliM [Rhodospirillum
           centenum]
 gi|209956999|gb|ACI97635.1| flagellar motor switch protein FliM [Rhodospirillum centenum SW]
          Length = 352

 Score =  238 bits (606), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 43/313 (13%), Positives = 105/313 (33%), Gaps = 3/313 (0%)

Query: 6   IHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSC 65
           +  + S     ++ ++            +   +     + L   F+      V+++    
Sbjct: 42  VDDSKSVRTRSVIDQIVNSSFVNYDRLPMLDVVFDRLVRLLNTSFRNLTSGTVEVTVQQI 101

Query: 66  QSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNR 125
            S +F   +       + +      W ++  +   + L+ ++++ LLG        +  R
Sbjct: 102 ASVRFGDYLSGIPLPSLIAVVRAEEWDNHCLLTVDSELIYSIVDILLGGRRSDPAPIDGR 161

Query: 126 SLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTIN 185
             + +E+ LA+R I  +   L    S         E        +      SN    +  
Sbjct: 162 PYTVIERALAERLIRTVLKDLGTAFSPLSAVGFACERVET--TPQFAVITRSNNACISAR 219

Query: 186 MNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDT 244
             + ++       L+IP  TL     + L     +   +          +  + +V++  
Sbjct: 220 FQVALDGRGGCVSLLIPYATLEPIRDLLLQMFMGEKFGRDSMWETHLKNELRRTSVDLSA 279

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
            +   + +L D++  K G  +    R    A+L+     ++  E+G+   N  IRI   +
Sbjct: 280 VLGQAQVSLTDLLAWKEGTQLVLDMRPDAQALLTCGHVPMFVGEMGQRNGNVAIRIDADL 339

Query: 305 NFDQKSLKNFLHK 317
               + +   L +
Sbjct: 340 GAQDEVIHGLLQR 352


>gi|28869173|ref|NP_791792.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213967550|ref|ZP_03395698.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           tomato T1]
 gi|301382887|ref|ZP_07231305.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           tomato Max13]
 gi|302061097|ref|ZP_07252638.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           tomato K40]
 gi|302131287|ref|ZP_07257277.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|28852413|gb|AAO55487.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213927851|gb|EEB61398.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           tomato T1]
 gi|330964686|gb|EGH64946.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           actinidiae str. M302091]
 gi|331016994|gb|EGH97050.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 322

 Score =  238 bits (606), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 43/301 (14%), Positives = 97/301 (32%), Gaps = 12/301 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +          R+                +   + ++        +    D++   
Sbjct: 30  SEPGSVKSYDLTSQDRIVRG------RMPTLEMINERFARYTRISMFNLLRRSADVAVGG 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            Q  KF   +HS       + A +              LV  L++N  G       ++  
Sbjct: 84  VQVMKFGEYVHSLYVPTSLNLAKIKPLRGTALFILDAKLVFKLVDNFFGGDGR-HAKIEG 142

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E ++ +  + Q    L +      E +   E                +E V   
Sbjct: 143 REFTPTELRVVRMVLDQAFIDLKEAWQAIMEVN--FEYINSEVNPAMANIVGPSEAVVIS 200

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQLNVNID 243
             ++ ++       + +P   +     +  +  Q+  ++Q E  ++        +NV + 
Sbjct: 201 TFHIELDGGGGDLHVTMPYSMIEPIREMLDAGFQSDLDDQDERWVNALKEDVLDVNVPLT 260

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
           T I  ++  L+D++ ++ G VIP         +L ANG   +  +LG       +++ + 
Sbjct: 261 TTIAQRQLPLRDILHMRPGDVIPVEL--SDTLVLRANGVPSFKVKLGSHKGKMALQVIEP 318

Query: 304 I 304
           I
Sbjct: 319 I 319


>gi|224534350|ref|ZP_03674928.1| flagellar motor switch protein FliM [Borrelia spielmanii A14S]
 gi|224514452|gb|EEF84768.1| flagellar motor switch protein FliM [Borrelia spielmanii A14S]
          Length = 352

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 42/293 (14%), Positives = 97/293 (33%), Gaps = 9/293 (3%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +  SS    + ++        +   V +   S     +   I S       +  +
Sbjct: 58  SKEQVRTVSSFHEAFARYTTTSLSALLRKMVHVHVASVDQLTYEEFIRSIPNPTTLAIIN 117

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +     +        +   +++ L G   +TI +  +R L+ +E+ + +  I +I A + 
Sbjct: 118 MDPLKGSAIFEVDPTIAFAIVDRLFGGDGDTI-KDKSRDLTEIEQSVMESVIIRILANMR 176

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  S   +  P           +        E +  + + + I  V       +P  T+ 
Sbjct: 177 EAWSQVVDLRPRFGHIEV--NPQFAQIVPPTEMIILVTLEVKIGKVEGLMNFCLPYITIE 234

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                              + + +D    K     + +   I   K  ++++++L  G V
Sbjct: 235 PIVSKLSTRYWHSLIGVGTTSENLDALREKLENTAMPLVAEIGEVKLKVREILSLNKGDV 294

Query: 265 IPFLHR-EKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ--KSLKNF 314
           +            L    KE + C +G +G   +++IT++I   +    LK  
Sbjct: 295 LNLESSLINKDLTLKVGTKEKFKCRMGLMGNKVSVQITEKIGDIKGFDLLKEL 347


>gi|66046676|ref|YP_236517.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           syringae B728a]
 gi|289678975|ref|ZP_06499865.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           syringae FF5]
 gi|63257383|gb|AAY38479.1| Flagellar motor switch protein FliM [Pseudomonas syringae pv.
           syringae B728a]
 gi|330972446|gb|EGH72512.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 322

 Score =  237 bits (605), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 43/306 (14%), Positives = 98/306 (32%), Gaps = 17/306 (5%)

Query: 5   SIHKNTSP-----LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVD 59
               N+ P            R+                +   + ++        +    D
Sbjct: 25  QTDNNSEPGSVKSYDLTSQDRIVRG------RMPTLEMINERFARYTRISMFNLLRRSAD 78

Query: 60  ISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETI 119
           ++    Q  KF   +HS       + A +              LV  L++N  G      
Sbjct: 79  VAVGGVQVMKFGEYVHSLYVPTSLNLAKIKPLRGTALFILDAKLVFKLVDNFFGGDGR-H 137

Query: 120 PQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNE 179
            ++  R  +  E ++ +  + Q    L +      E +   E                +E
Sbjct: 138 AKIEGREFTPTELRVVRMVLDQAFVDLKEAWQAIMEVN--FEYINSEVNPAMANIVGPSE 195

Query: 180 FVTTINMNMTIENVASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQL 238
            V     ++ ++       + +P   +     +  +  Q+  ++Q E  ++        +
Sbjct: 196 AVVISTFHIELDGGGGDLHVTMPYSMIEPIREMLDAGFQSDLDDQDERWVNALKEDVLDV 255

Query: 239 NVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTI 298
           NV + T I  ++  L+D++ ++ G VIP         ++ ANG   +  +LG       +
Sbjct: 256 NVPLTTTIAQRQLPLRDILHMRPGDVIPVEL--SDSLVMRANGVPSFKVKLGSHKGKMAL 313

Query: 299 RITDRI 304
           ++ + I
Sbjct: 314 QVIEPI 319


>gi|222084857|ref|YP_002543386.1| flagellar C-ring protein [Agrobacterium radiobacter K84]
 gi|221722305|gb|ACM25461.1| flagellar C-ring protein [Agrobacterium radiobacter K84]
          Length = 314

 Score =  237 bits (605), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 106/316 (33%), Positives = 170/316 (53%), Gaps = 2/316 (0%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           M  QS H   + + P+L A+LTG LGD  T+ K+ ++ G +Y +FLP I K +  LDV +
Sbjct: 1   MSQQSTHPKQT-MDPVLFAKLTGGLGDPATLAKLGTAFGQVYAEFLPDIIKSETGLDVSV 59

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
            Y  C+SG  S ++     N      SL +WS NF +GC    V+TL+E+LLGA  ETI 
Sbjct: 60  GYAGCRSGLMSELVAGIGSNCALVNGSLRNWSQNFLLGCGTGFVMTLMEHLLGAQPETID 119

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
               R LS +E  L+     +I+ VL   ++ T    P L+  Y+I+         +++F
Sbjct: 120 SPAARPLSVIELDLSVMVFDKIANVLRSAVNATGGFEPYLDPPYNIEDRPTPVAGQTDDF 179

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNV 240
              I M +++    S  V+I+PQ  LL+T + +  ++N S +      +    +  +  V
Sbjct: 180 AAAIAMTISLGKTVSEIVVIVPQYELLRTVVSAPRAKNPSAST-GAWAEQLNEQVRRSQV 238

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            ++ RI L+  TL  +  L +G VIPF+        +SAN K++Y CE GR G+NYT+R+
Sbjct: 239 TLEARIRLQSLTLDTISRLAVGDVIPFMDTSDVQVEVSANSKDLYVCEFGRSGENYTVRV 298

Query: 301 TDRINFDQKSLKNFLH 316
            D +N D + L++ ++
Sbjct: 299 KDTVNSDDELLRHLMN 314


>gi|238796938|ref|ZP_04640442.1| Flagellar motor switch protein fliM [Yersinia mollaretii ATCC
           43969]
 gi|238719198|gb|EEQ11010.1| Flagellar motor switch protein fliM [Yersinia mollaretii ATCC
           43969]
          Length = 332

 Score =  237 bits (604), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 44/306 (14%), Positives = 94/306 (30%), Gaps = 10/306 (3%)

Query: 2   RGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDIS 61
              ++     P  P    R+       +        +   + +         +    DI+
Sbjct: 28  NNPALDVGIKPYDPNTQRRVV------RERLHSLEIINERFARQFRMGLFNLLRRSPDIT 81

Query: 62  YTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQ 121
             + +   +     +       +   ++          S NLV   ++NL G       +
Sbjct: 82  AGNIKIQPYHEFARNLPVPTNLNLVHMNPLRGTALFVFSPNLVFMAVDNLFGGDGRFPTK 141

Query: 122 LYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFV 181
              R  +  E+++ KR +       +   S+  +          I     N     N+ V
Sbjct: 142 ADGREFTPTEQRVIKRMLTMALEAYDFAWSSIFKLHTEYVRAE-IQVKFTNITSSPNDIV 200

Query: 182 TTINMNMTIENVASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQLNV 240
            T    + I      F + IP   +     +  S     S  + +   +  A +  +  +
Sbjct: 201 VTTPFYVEIGPHRGEFDICIPFSIIEPLRELLTSPPMENSRQEEKQWRNTLASQVRETEL 260

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            +        T L  V+ +K G VIP     +       +G  ++S + G V K Y +++
Sbjct: 261 ELVASFADIPTRLSQVMKMKEGDVIPIDK--QESIEACVDGVPVFSGKYGCVNKQYALKV 318

Query: 301 TDRINF 306
              +N 
Sbjct: 319 EKMMNP 324


>gi|203284199|ref|YP_002221939.1| flagellar motor switch protein [Borrelia duttonii Ly]
 gi|203287738|ref|YP_002222753.1| flagellar motor switch protein [Borrelia recurrentis A1]
 gi|201083642|gb|ACH93233.1| flagellar motor switch protein [Borrelia duttonii Ly]
 gi|201084958|gb|ACH94532.1| flagellar motor switch protein [Borrelia recurrentis A1]
          Length = 352

 Score =  237 bits (604), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 46/293 (15%), Positives = 100/293 (34%), Gaps = 9/293 (3%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +  SS    + ++        +   V +   S     +   I S       +  +
Sbjct: 58  SKEQVRTVSSFHEAFARYTTTSLSALLRKMVHVHVASVDQLTYEEFIRSIPNPTTLAIIN 117

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +     +        +   +++ L G   +TI +  +R L+ +E+ + +  I +I A + 
Sbjct: 118 MDPLKGSAIFEVDPTIAFAIVDRLFGGDGDTI-KDKSRDLTEIEQSVMESVIIRILANMR 176

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  S   +  P           +        E V  + + + I  V       +P  T+ 
Sbjct: 177 EAWSQVVDLRPRFGHIEV--NPQFAQIVPPTEMVILVTLEVKIGKVEGLMNFCLPYITIE 234

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                              + + +D    K    N+ +   I   K  ++++++L+ G V
Sbjct: 235 PIVSKLSTRYWHSLIGVGTTSENLDVLREKLEYTNMPLVAEIGEVKLKVREILSLEKGDV 294

Query: 265 IPFLH-REKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKS--LKNF 314
           I   +       IL    KE + C +G VG   +++IT ++   +    LK  
Sbjct: 295 INLENSSIDQDLILKVGTKEKFKCRMGLVGNKISVQITRKVGEVEDFDLLKEL 347


>gi|92114085|ref|YP_574013.1| flagellar motor switch protein FliM [Chromohalobacter salexigens
           DSM 3043]
 gi|91797175|gb|ABE59314.1| flagellar motor switch protein FliM [Chromohalobacter salexigens
           DSM 3043]
          Length = 338

 Score =  237 bits (604), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 44/304 (14%), Positives = 99/304 (32%), Gaps = 12/304 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S      P  P    R+       +        +   + +         M    DI+  S
Sbjct: 32  SREGKVRPFDPAKQHRII------RERLHALDIINERFARQFRVALFNLMRRSADITVES 85

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +S    +       +  ++     +  +    +LV  +++NL G     + +   
Sbjct: 86  VRYQSYSEFSRNLPVPTNLNLITMKPLRGSALVVFPPSLVFMVVDNLFGGDGRFLTKSEG 145

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNR-LSNEFVTT 183
           R  +  E+++  R +       ++   +       +E       +K        NE V  
Sbjct: 146 REFTRTEQRIIHRMLKMALEGYSESWKSVYPLD--IEYTRSELQVKFANITNSPNEIVVN 203

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKS-ENQSEDLIDPFARKTYQLNVNI 242
              ++ + N++S F + IP   +     I  S  + +  ++ +      A +    +V +
Sbjct: 204 STFHVEVGNLSSEFNICIPYSMIEPIRDILASPLHDTHPDEEQQWEARMAHEIRHSSVEL 263

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
                     L+DV  L +G +IP          +S +G  + +C+ G       +R+  
Sbjct: 264 TADFVDIPLRLRDVTQLSVGDIIPIELP--EAVNVSVDGIPVMTCDYGSQKSQRALRVRH 321

Query: 303 RINF 306
            I  
Sbjct: 322 LIEH 325


>gi|224531918|ref|ZP_03672550.1| flagellar motor switch protein FliM [Borrelia valaisiana VS116]
 gi|224511383|gb|EEF81789.1| flagellar motor switch protein FliM [Borrelia valaisiana VS116]
          Length = 352

 Score =  236 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 42/293 (14%), Positives = 97/293 (33%), Gaps = 9/293 (3%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +  SS    + ++        +   V +   S     +   I S       +  +
Sbjct: 58  SKEQVRTVSSFHEAFARYTTTSLSALLRKMVHVHVASVDQLTYEEFIRSIPNPTTLAIIN 117

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +     +        +   +++ L G   +TI +  +R L+ +E+ + +  I +I A + 
Sbjct: 118 MDPLKGSAIFEVDPTIAFAIVDRLFGGDGDTI-KDKSRDLTEIEQSVMESVIIRILANMR 176

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  S   +  P           +        E +  + + + I  V       +P  T+ 
Sbjct: 177 EAWSQVVDLRPRFGHIEV--NPQFAQIVPPTEMIILVTLEVKIGKVEGLMNFCLPYITIE 234

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                              + + +D    K     + +   I   K  ++++++L  G V
Sbjct: 235 PIVSKLSTRYWHSLIGVGTTSENLDALREKLENTAMPLVAEIGEVKLKVREILSLDKGDV 294

Query: 265 IPFLHR-EKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ--KSLKNF 314
           +            L    KE + C +G +G   +++IT++I   +    LK  
Sbjct: 295 LNLESSLINKDLTLKVGTKEKFKCRMGLMGNKISVQITEKIGDIKGFDLLKEL 347


>gi|187918152|ref|YP_001883715.1| flagellar motor switch protein FliM [Borrelia hermsii DAH]
 gi|119861000|gb|AAX16795.1| flagellar motor switch protein FliM [Borrelia hermsii DAH]
          Length = 352

 Score =  236 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 43/293 (14%), Positives = 100/293 (34%), Gaps = 9/293 (3%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +  SS    + ++        +   V +   S     +   I S       +  +
Sbjct: 58  SKEQVRTVSSFHEAFARYTTTSLSALLRKMVHVHVASVDQLTYEEFIRSIPNPTTLAIIN 117

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +     +        +   +++ L G   +TI +  +R L+ +E+ + +  I +I + + 
Sbjct: 118 MDPLKGSAIFEVDPTIAFAIVDRLFGGDGDTI-KDKSRDLTEIEQSVMESVIIRILSNMR 176

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  S   +  P           +        E V  + + + I  V       +P  T+ 
Sbjct: 177 EAWSQVVDLRPRFGHIEV--NPQFAQIVPPTEMVILVTLEVKIGKVEGLMNFCLPYITIE 234

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                              + + +D    K    ++ +   I   K  ++++++L+ G V
Sbjct: 235 PIVSKLSTRYWHSLIGVGTTSENLDVLREKLENTDMLLVAEIGEVKLKVREILSLEKGDV 294

Query: 265 IPF-LHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKS--LKNF 314
           I           IL    K+ + C +G VG   +++IT+++   +    LK  
Sbjct: 295 INLEDSPIDKDLILKVGTKQKFKCRMGLVGSKISVQITEKVGEVEDFDLLKEL 347


>gi|15594623|ref|NP_212412.1| flagellar motor switch protein FliM [Borrelia burgdorferi B31]
 gi|111115103|ref|YP_709721.1| flagellar motor switch protein FliM [Borrelia afzelii PKo]
 gi|195941368|ref|ZP_03086750.1| flagellar motor switch protein FliM [Borrelia burgdorferi 80a]
 gi|216263834|ref|ZP_03435828.1| flagellar motor switch protein FliM [Borrelia afzelii ACA-1]
 gi|216264557|ref|ZP_03436549.1| flagellar motor switch protein FliM [Borrelia burgdorferi 156a]
 gi|218249869|ref|YP_002374801.1| flagellar motor switch protein FliM [Borrelia burgdorferi ZS7]
 gi|221217666|ref|ZP_03589134.1| flagellar motor switch protein FliM [Borrelia burgdorferi 72a]
 gi|223888930|ref|ZP_03623521.1| flagellar motor switch protein FliM [Borrelia burgdorferi 64b]
 gi|224533145|ref|ZP_03673745.1| flagellar motor switch protein FliM [Borrelia burgdorferi WI91-23]
 gi|224533778|ref|ZP_03674366.1| flagellar motor switch protein FliM [Borrelia burgdorferi CA-11.2a]
 gi|225549106|ref|ZP_03770081.1| flagellar motor switch protein FliM [Borrelia burgdorferi 94a]
 gi|225550153|ref|ZP_03771113.1| flagellar motor switch protein FliM [Borrelia burgdorferi 118a]
 gi|225552170|ref|ZP_03773110.1| flagellar motor switch protein FliM [Borrelia sp. SV1]
 gi|226320579|ref|ZP_03796139.1| flagellar motor switch protein FliM [Borrelia burgdorferi 29805]
 gi|226321596|ref|ZP_03797122.1| flagellar motor switch protein FliM [Borrelia burgdorferi Bol26]
 gi|3913687|sp|Q57511|FLIM_BORBU RecName: Full=Flagellar motor switch protein FliM
 gi|1165263|gb|AAA85602.1| FliM [Borrelia burgdorferi]
 gi|1185056|gb|AAB58965.1| switch protein [Borrelia burgdorferi]
 gi|2688188|gb|AAC66670.1| flagellar motor switch protein (fliM) [Borrelia burgdorferi B31]
 gi|110890377|gb|ABH01545.1| flagellar motor switch protein [Borrelia afzelii PKo]
 gi|215979878|gb|EEC20700.1| flagellar motor switch protein FliM [Borrelia afzelii ACA-1]
 gi|215981030|gb|EEC21837.1| flagellar motor switch protein FliM [Borrelia burgdorferi 156a]
 gi|218165057|gb|ACK75118.1| flagellar motor switch protein FliM [Borrelia burgdorferi ZS7]
 gi|221192343|gb|EEE18562.1| flagellar motor switch protein FliM [Borrelia burgdorferi 72a]
 gi|223885746|gb|EEF56845.1| flagellar motor switch protein FliM [Borrelia burgdorferi 64b]
 gi|224511872|gb|EEF82273.1| flagellar motor switch protein FliM [Borrelia burgdorferi WI91-23]
 gi|224513071|gb|EEF83434.1| flagellar motor switch protein FliM [Borrelia burgdorferi CA-11.2a]
 gi|225369265|gb|EEG98718.1| flagellar motor switch protein FliM [Borrelia burgdorferi 118a]
 gi|225370332|gb|EEG99770.1| flagellar motor switch protein FliM [Borrelia burgdorferi 94a]
 gi|225371168|gb|EEH00598.1| flagellar motor switch protein FliM [Borrelia sp. SV1]
 gi|226232785|gb|EEH31538.1| flagellar motor switch protein FliM [Borrelia burgdorferi Bol26]
 gi|226233998|gb|EEH32719.1| flagellar motor switch protein FliM [Borrelia burgdorferi 29805]
 gi|312147869|gb|ADQ30528.1| flagellar motor switch protein FliM [Borrelia burgdorferi JD1]
 gi|312149126|gb|ADQ29197.1| flagellar motor switch protein FliM [Borrelia burgdorferi N40]
          Length = 352

 Score =  236 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 42/293 (14%), Positives = 97/293 (33%), Gaps = 9/293 (3%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +  SS    + ++        +   V +   S     +   I S       +  +
Sbjct: 58  SKEQVRTVSSFHEAFARYTTTSLSALLRKMVHVHVASVDQLTYEEFIRSIPNPTTLAIIN 117

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +     +        +   +++ L G   +TI +  +R L+ +E+ + +  I +I A + 
Sbjct: 118 MDPLKGSAIFEVDPTIAFAIVDRLFGGDGDTI-KDKSRDLTEIEQSVMESVIIRILANMR 176

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  S   +  P           +        E +  + + + I  V       +P  T+ 
Sbjct: 177 EAWSQVVDLRPRFGHIEV--NPQFAQIVPPTEMIILVTLEVKIGKVEGLMNFCLPYITIE 234

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                              + + +D    K     + +   I   K  ++++++L  G V
Sbjct: 235 PIVSKLSTRYWHSLIGVGTTSENLDALREKLENTAMPLVAEIGEVKLKVREILSLDKGDV 294

Query: 265 IPFLHR-EKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ--KSLKNF 314
           +            L    KE + C +G +G   +++IT++I   +    LK  
Sbjct: 295 LNLESSLINKDLTLKVGTKEKFKCRMGLMGNKVSVQITEKIGDIKGFDLLKEL 347


>gi|331269275|ref|YP_004395767.1| flagellar motor switch protein FliM [Clostridium botulinum
           BKT015925]
 gi|329125825|gb|AEB75770.1| flagellar motor switch protein FliM [Clostridium botulinum
           BKT015925]
          Length = 331

 Score =  236 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 42/285 (14%), Positives = 100/285 (35%), Gaps = 7/285 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +    +   + + +      ++  +V I   + Q   +   IHS     + +   
Sbjct: 48  SKDHIRTLELIHDNFARIISNYLTAQVRTNVKIKIETVQQITYEEFIHSVPNPTILTIFK 107

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +   S +     +      +++ LLG       +   R  + ++K + K+    + A L 
Sbjct: 108 MPPLSGSILFETNPQFAYQIIDVLLGGPGVGQYKT--REFTDIDKNIIKQINKGLIANLK 165

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
                  +  P +E          N     NE V  I  ++ +   ++   + IP  ++ 
Sbjct: 166 LAWEDVIQVEPEIEGLET--NPALNQTLAPNEPVALITFSVEMGGNSTFINICIPYLSIE 223

Query: 208 KTTLIS---LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
           K           +    +  E+  +   R+   + + +   +   K T+ + +TL +G V
Sbjct: 224 KVLDKLVVQYWFRENDTDTLEESNEKLRRRMNVVELPMKAVLGSTKLTVGEFLTLSVGDV 283

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
           +       +   +    +     + G +GKN  ++I D I+ D +
Sbjct: 284 VTLDALTSSPVKMMVGNQPYLLAKPGTMGKNRGVQILDIIDKDVE 328


>gi|83647849|ref|YP_436284.1| flagellar motor switch protein FliM [Hahella chejuensis KCTC 2396]
 gi|83635892|gb|ABC31859.1| flagellar motor switch protein FliM [Hahella chejuensis KCTC 2396]
          Length = 340

 Score =  236 bits (603), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 40/299 (13%), Positives = 97/299 (32%), Gaps = 12/299 (4%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
                      R+                +   + ++        +  + D++    Q  
Sbjct: 32  GVRSYDLTSQDRIVRG------RMPTLEMINERFARYTRISLFNLLRRNADVASGGVQIL 85

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           KF   IH+       +   +              LV  L++N  G       ++  R  +
Sbjct: 86  KFGEYIHTLYVPTSLNLVKIRPLRGTGLFILDAKLVFKLVDNFFGGDGR-HAKIEGREFT 144

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E ++ +  + Q+   + +  +   +     E                +E V     ++
Sbjct: 145 PTEIRIVQMVLEQVFHDMKEAWNAVMKVD--FEYVNSEVNPAMANIVSPSEVVVVSTFHI 202

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            ++       + +P   +     +  +  Q+  ++  E  I    +   +  V ++  + 
Sbjct: 203 ELDGGGGDMHVAMPYSMIEPIREVLDAGVQSDVDDVDERWISALQQDILEARVPLNAAVV 262

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
            +K +L+ +  LK G VIP          ++ANG  I+  ++G+   N  ++I D+I  
Sbjct: 263 RQKISLRSLSRLKPGDVIPVELP--ETITVTANGVPIFIAKVGQCNGNLALKIVDKIKR 319


>gi|51598538|ref|YP_072726.1| flagellar motor switch protein FliM [Borrelia garinii PBi]
 gi|219684519|ref|ZP_03539462.1| flagellar motor switch protein FliM [Borrelia garinii PBr]
 gi|219685746|ref|ZP_03540557.1| flagellar motor switch protein FliM [Borrelia garinii Far04]
 gi|51573109|gb|AAU07134.1| flagellar motor switch protein [Borrelia garinii PBi]
 gi|219671881|gb|EED28935.1| flagellar motor switch protein FliM [Borrelia garinii PBr]
 gi|219672685|gb|EED29713.1| flagellar motor switch protein FliM [Borrelia garinii Far04]
          Length = 352

 Score =  236 bits (603), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 42/293 (14%), Positives = 97/293 (33%), Gaps = 9/293 (3%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +  SS    + ++        +   V +   S     +   I S       +  +
Sbjct: 58  SKEQVRTVSSFHEAFARYTTTSLSALLRKMVHVHVASVDQLTYEEFIRSIPNPTTLAIIN 117

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +     +        +   +++ L G   +TI +  +R L+ +E+ + +  I +I A + 
Sbjct: 118 MDPLKGSAIFEVDPTIAFAIVDRLFGGDGDTI-KDKSRDLTEIEQSVMESVIIRILANMR 176

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  S   +  P           +        E +  + + + I  V       +P  T+ 
Sbjct: 177 EAWSQVVDLRPRFGHIEV--NPQFAQIVPPTEMIILVTLEVKIGKVEGLMNFCLPYITIE 234

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                              + + +D    K     + +   I   K  ++++++L  G V
Sbjct: 235 PIVSKLSTRYWHSLIGVGTTSENLDALREKLENTAMPLIAEIGEVKLKVREILSLDKGDV 294

Query: 265 IPFLHR-EKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ--KSLKNF 314
           +            L    KE + C +G +G   +++IT++I   +    LK  
Sbjct: 295 LNLESSLINKDLTLKVGTKEKFKCRMGLMGNKVSVQITEKIGDIKGFDLLKEL 347


>gi|330953758|gb|EGH54018.1| flagellar motor switch protein FliM [Pseudomonas syringae Cit 7]
          Length = 322

 Score =  236 bits (603), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 44/306 (14%), Positives = 98/306 (32%), Gaps = 17/306 (5%)

Query: 5   SIHKNTSP-----LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVD 59
               N+ P            R+                +   + ++        +    D
Sbjct: 25  QTDNNSEPGSVKSYDLTSQDRIVRG------RMPTLEMINERFPRYTRISMFNLLRRSAD 78

Query: 60  ISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETI 119
           ++    Q  KF   +HS       + A +              LV  L++N  G      
Sbjct: 79  VAVGGVQVMKFGEYVHSLYVPTSLNLAKIKPLRGTALFILDAKLVFKLVDNFFGGDGR-H 137

Query: 120 PQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNE 179
            ++  R  +  E ++ +  + Q    L +      E +   E                +E
Sbjct: 138 AKIEGREFTPTELRVVRMVLDQAFVDLKEAWQAIMEVN--FEYINSEVNPAMANIVGPSE 195

Query: 180 FVTTINMNMTIENVASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQL 238
            V     ++ ++       + +P   +     +  +  Q+  ++Q E  ++        +
Sbjct: 196 AVVISTFHIELDGGGGDLHVTMPYSMIEPIREMLDAGFQSDLDDQDERWVNALKEDVLDV 255

Query: 239 NVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTI 298
           NV + T I  ++  L+D++ ++ G VIP         +L ANG   +  +LG       +
Sbjct: 256 NVPLTTTIAQRQLPLRDILHMRPGDVIPVEL--GDSLVLRANGVPSFKVKLGSHKGKMAL 313

Query: 299 RITDRI 304
           ++ + I
Sbjct: 314 QVIEPI 319


>gi|268589967|ref|ZP_06124188.1| flagellar motor switch protein FliM [Providencia rettgeri DSM 1131]
 gi|291314684|gb|EFE55137.1| flagellar motor switch protein FliM [Providencia rettgeri DSM 1131]
          Length = 335

 Score =  236 bits (603), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 37/307 (12%), Positives = 84/307 (27%), Gaps = 10/307 (3%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
            N  P  P    R+  +             +   + +         +    DI+    + 
Sbjct: 33  DNVRPYDPNTQRRVIRERMQS------LEIINERFARQFRMGLFNMLRRSPDITVGGIKI 86

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSL 127
             +     +       +   +              LV   ++NL G       +   +  
Sbjct: 87  EPYHEFARNLPVPTNLNLIHMPPLRGTALFTFEPALVYIAVDNLFGGDGRFPVRQEGKEF 146

Query: 128 STVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMN 187
           +  E+++  R +               +          I     N     N+ V T    
Sbjct: 147 TNTEQRIINRMLKLALGAYRDAWKPIADIEVEYVRSE-IQVKFTNITTSPNDIVVTTPFL 205

Query: 188 MTIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRI 246
           + I N    F + IP   +             +   ++E  +     +  +  + +    
Sbjct: 206 VEIGNTVGEFSICIPIAMIEPLRERLINPPMEQGHQENETWVTNLVTQVKRSELELVANF 265

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                 +  ++ L+ G VIP         I++ +G  + + + G     Y +R+   IN 
Sbjct: 266 VDIPMRISRLLQLQKGDVIPIEKP--DRLIVNVDGVPVLTSQYGTQNGQYALRVEHLINP 323

Query: 307 DQKSLKN 313
              +L  
Sbjct: 324 VLNTLDE 330


>gi|332298232|ref|YP_004440154.1| flagellar motor switch protein FliM [Treponema brennaborense DSM
           12168]
 gi|332181335|gb|AEE17023.1| flagellar motor switch protein FliM [Treponema brennaborense DSM
           12168]
          Length = 344

 Score =  236 bits (603), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 37/285 (12%), Positives = 97/285 (34%), Gaps = 8/285 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +  S +   + +        ++   V +   S     +   I S       +  +
Sbjct: 48  SKEQIRTVSIMHETFARLTTTSLSAQLRSMVHVHVASVDQLTYEEFIRSIPTPTTLAVIN 107

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +     N  +     +  ++++ L G + +       R L+ +E+ + +  I +I A + 
Sbjct: 108 MDPLKGNAILEIDPAITFSMIDRLFGGTGQGAKV--QRDLTDIEQSVMEGIIVRILANMR 165

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  +   +  P L         +       +E V  + +   +          IP  T+ 
Sbjct: 166 EAWTQVIDLRPRLGQIET--NPQFAQIVPPSEMVVLVTLETKVGEEEGMMNFCIPYLTIE 223

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                        +   + +   +     K   +++++   I      ++DV+ L++G +
Sbjct: 224 PIISKLSSQFWFSSVRRSSTTQYLGVLKEKLSDVDMDVVAEIGSVSLPIRDVLALRVGDI 283

Query: 265 IPF-LHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
           +     R      LS   K+ + C+ G +GK   +++  +I   +
Sbjct: 284 VRLSNVRITDPITLSIGNKKKFLCQPGVIGKKMAVQVLSKITQGE 328


>gi|77457773|ref|YP_347278.1| flagellar motor switch protein FliM [Pseudomonas fluorescens Pf0-1]
 gi|77381776|gb|ABA73289.1| flagellar motor switch protein [Pseudomonas fluorescens Pf0-1]
          Length = 322

 Score =  236 bits (602), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 38/277 (13%), Positives = 94/277 (33%), Gaps = 6/277 (2%)

Query: 31  IEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSS 90
                  +   + ++        +    D++    Q  KF   +HS       +   +  
Sbjct: 50  RMPTLEMINERFARYTRISMFNMLRRSADVAVGGVQVMKFGEYVHSLYVPTSLNLVKIKP 109

Query: 91  WSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCI 150
                       LV  L++N  G       ++  R  +  E ++ +  + Q    L +  
Sbjct: 110 LRGTALFILDAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLEQAFVDLKEAW 168

Query: 151 STTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTT 210
               E +   E                +E +     ++ ++       + +P   +    
Sbjct: 169 QAIMEVN--FEYINSEVNPAMANIVGPSEAIVVSTFHIELDGGGGDLHVTMPYSMIEPVR 226

Query: 211 LISLS-SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLH 269
            +  +  Q+  ++Q E  ++   +    ++V I   +  ++  L+D++ ++ G VIP   
Sbjct: 227 EMLDAGFQSDLDDQDERWVNALRQDVLDVDVPIGATVARRQLKLRDILHMQPGDVIPVEM 286

Query: 270 REKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
            E    I+ ANG   +  ++G    N  +++ + I  
Sbjct: 287 PED--MIMRANGVPAFKVKMGSHKGNLALQVIEPIER 321


>gi|330876026|gb|EGH10175.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 322

 Score =  236 bits (602), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 43/301 (14%), Positives = 97/301 (32%), Gaps = 12/301 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +          R+                +   + ++        +    D++   
Sbjct: 30  SEPGSVKSYDLTSQDRIVRG------RMPTLEMINERFARYTRISMFNLLRRSADVAVGG 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            Q  KF   +HS       + A +              LV  L++N  G       ++  
Sbjct: 84  VQVMKFGEYVHSLYVPTSLNLAKIKPLRGTALFILDAKLVFKLVDNFFGGDGR-HAKIEG 142

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E ++ +  + Q    L +      E +   E                +E V   
Sbjct: 143 REFTPTELRVVRMVLDQAFIDLKEAWQAIMEVN--FEYINSEVNPVMANIVGPSEAVVIS 200

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQLNVNID 243
             ++ ++       + +P   +     +  +  Q+  ++Q E  ++        +NV + 
Sbjct: 201 TFHIELDGGGGDLHVTMPYSMIEPIREMLDAGFQSDLDDQDERWVNALKEDVLDVNVPLT 260

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
           T I  ++  L+D++ ++ G VIP         +L ANG   +  +LG       +++ + 
Sbjct: 261 TTIAQRQLPLRDILHMRPGDVIPVEL--SDTLVLRANGVPSFKVKLGSHKGKMALQVIEP 318

Query: 304 I 304
           I
Sbjct: 319 I 319


>gi|167037657|ref|YP_001665235.1| flagellar motor switch protein FliM [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|167040318|ref|YP_001663303.1| flagellar motor switch protein FliM [Thermoanaerobacter sp. X514]
 gi|256750752|ref|ZP_05491637.1| flagellar motor switch protein FliM [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300914402|ref|ZP_07131718.1| flagellar motor switch protein FliM [Thermoanaerobacter sp. X561]
 gi|307724362|ref|YP_003904113.1| flagellar motor switch protein FliM [Thermoanaerobacter sp. X513]
 gi|320116072|ref|YP_004186231.1| flagellar motor switch protein FliM [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
 gi|166854558|gb|ABY92967.1| flagellar motor switch protein FliM [Thermoanaerobacter sp. X514]
 gi|166856491|gb|ABY94899.1| flagellar motor switch protein FliM [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|256750335|gb|EEU63354.1| flagellar motor switch protein FliM [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300889337|gb|EFK84483.1| flagellar motor switch protein FliM [Thermoanaerobacter sp. X561]
 gi|307581423|gb|ADN54822.1| flagellar motor switch protein FliM [Thermoanaerobacter sp. X513]
 gi|319929163|gb|ADV79848.1| flagellar motor switch protein FliM [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
          Length = 332

 Score =  236 bits (602), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 40/284 (14%), Positives = 98/284 (34%), Gaps = 6/284 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +    +     + L       +   V+++  S     +    +S       +   
Sbjct: 50  SKEQLRTLQMIFENLSRSLTSFLSGYLRTIVNVTVVSVDQLTYYEFSNSLNNPVFIAIID 109

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
            +     F +  +NN    +L+ +LG   +   +L +R  + +E  L  + + Q+ ++  
Sbjct: 110 AAPLEGLFLLEFNNNTTYAILDRILGGMGK--GELLDRDYTEIEISLLTKIVKQMLSLFK 167

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  S   + +P+L         +       NE V    +++ I          +P  TL 
Sbjct: 168 EPWSNILDINPSLIRVET--NSQFAQIISPNETVALCTLSIKINETEGIMNFCMPHLTLE 225

Query: 208 KTTLISLSS--QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVI 265
                  +    +  + + +   +    K  +  + +  ++     T+K+ +  +IG +I
Sbjct: 226 PIVPKLTTKFWFSSMKKEEKVNPELIKSKISKTYIPLTAQLGSTTITVKEFLDFEIGDII 285

Query: 266 PFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
                 K    +  + K  +    G     Y++RIT+ I    +
Sbjct: 286 MLDKHFKEPVDIIIDKKVKFRGIPGIKNNKYSVRITEVIYKGDE 329


>gi|308273526|emb|CBX30128.1| hypothetical protein N47_D29370 [uncultured Desulfobacterium sp.]
          Length = 322

 Score =  236 bits (602), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 37/301 (12%), Positives = 96/301 (31%), Gaps = 4/301 (1%)

Query: 6   IHKNTSPLHPILLARLTGKLGDKKTIE-KISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
              +   +   +     GK      +       +   +  FL +     + L  D+S   
Sbjct: 24  TESDVPEIDGAIGLYDFGKKSSPGHLSLPGLGMINERFINFLNESLPGTIGLSTDVSVDE 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
             S KF     S       +   +        +     LV   ++ + G    +  +L  
Sbjct: 84  IDSIKFGDFCRSLPVPTSLNIFKMEPLKGFALLVFEGWLVFAFVDAMFGGKGVSHVKLEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  + +E+K+  R +  +   L +  +  ++    +         +        + +   
Sbjct: 144 RGFTAIEQKIVSRIVDIVLVDLQKAWAEIKDLK--MVYTRSEMDPQFAGIAKPTDMIIAT 201

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNID 243
              + I N      + +P + +         + +++             +K  +L++N+ 
Sbjct: 202 KFALNIGNFTGGMTICLPYDVIEPIGEKLKENYRSEKFEADPVWKQHIKKKIQELDINLK 261

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
             +   K T ++ + +K+  V+    +     ++S      +   +G +     IRI D+
Sbjct: 262 CTLGRIKITGREFLEMKVDDVLLTGQKVDDPIVVSVGDLNKFKGHVGSMNNKKAIRIADK 321

Query: 304 I 304
           I
Sbjct: 322 I 322


>gi|119953077|ref|YP_945286.1| flagellar motor switch protein FliM [Borrelia turicatae 91E135]
 gi|119861848|gb|AAX17616.1| flagellar motor switch protein FliM [Borrelia turicatae 91E135]
          Length = 352

 Score =  236 bits (601), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 42/293 (14%), Positives = 100/293 (34%), Gaps = 9/293 (3%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +  SS    + ++        +   V +   S     +   I S       +  +
Sbjct: 58  SKEQVRTVSSFHEAFARYTTTSLSALLRKMVHVHVASVDQLTYEEFIRSIPNPTTLAIIN 117

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +     +        +   +++ L G   +TI +  +R L+ +E+ + +  I +I A + 
Sbjct: 118 MDPLKGSAIFEVDPTIAFAIVDRLFGGDGDTI-KDKSRDLTEIEQSVMESVIIRILANMR 176

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  S   +  P           +        E V  + + + I  V       +P  T+ 
Sbjct: 177 EAWSQVVDLRPRFGHIEV--NPQFAQIVPPTEMVILVTLEVKIGKVEGLMNFCLPYITIE 234

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                              + + +D    K    ++ +   I   K  ++++++L  G V
Sbjct: 235 PIVSKLSTRYWHSLIGVGTTSENLDILREKLENTDMLLVAEIGEVKLKVREILSLAKGDV 294

Query: 265 IPFLH-REKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKS--LKNF 314
           +   +       IL    K+ + C +G VG   ++++T+++   +    LK  
Sbjct: 295 LNLENSPIDKDLILKVGTKQKFKCRMGLVGNKISVQVTEKVGEVEDFDLLKEL 347


>gi|291613061|ref|YP_003523218.1| flagellar motor switch protein FliM [Sideroxydans lithotrophicus
           ES-1]
 gi|291583173|gb|ADE10831.1| flagellar motor switch protein FliM [Sideroxydans lithotrophicus
           ES-1]
          Length = 333

 Score =  236 bits (601), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 35/302 (11%), Positives = 90/302 (29%), Gaps = 11/302 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
                  +     R+                +   + +         +    +IS    +
Sbjct: 31  EGGVRAYNMATQERIVRG------RMPTMEIINERFARLFRISLYNFIHRSSEISVGPVR 84

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
             KFS  I +       +   +     +       NLV  ++++L G       ++  R 
Sbjct: 85  VMKFSEFIRNLPVPANLNLVQVKPLRGSALFIFDPNLVFMVVDSLFGGDGRFHTRVEGRE 144

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E ++ ++ +  +     +   T Q+     E        +       NE V     
Sbjct: 145 FTQTEHRIIQKLLDVVFQTYGKSWETVQKLD--FEFIRSEVNPQFANIATPNEVVVVTTF 202

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQLNVNIDTR 245
            +    V  S  + +P   +     +  S  Q       +  +   +R+     V +   
Sbjct: 203 EVEFTGVGGSIHICMPYAMIEPIREMLYSTMQGDHVIADKRWLHMLSRQIQLAEVELTAV 262

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           +    T ++ V+ ++ G +IP     +    +  +   +  C+ G     Y +++   + 
Sbjct: 263 LGHATTNVEHVLKMRAGDIIPLE--VEDTIQVLVDTVPVMECKYGSSNGQYALKVEKMLA 320

Query: 306 FD 307
            +
Sbjct: 321 TE 322


>gi|237799245|ref|ZP_04587706.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331022100|gb|EGI02157.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 322

 Score =  236 bits (601), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 41/297 (13%), Positives = 96/297 (32%), Gaps = 12/297 (4%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +          R+                +   + ++        +    D++    Q  
Sbjct: 34  SVKSYDLTSQDRIVRG------RMPTLEMINERFARYTRISMFNLLRRSADVAVGGVQVM 87

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           KF   +HS       + A +              LV  L++N  G       ++  R  +
Sbjct: 88  KFGEYVHSLYVPTSLNLAKIKPLRGTALFILDAKLVFKLVDNFFGGDGR-HAKIEGREFT 146

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E ++ +  + Q    L +      E +   E                +E V     ++
Sbjct: 147 PTELRVVRMVLDQAFIDLKEAWQAIMEVN--FEYINSEVNPAMANIVGPSEAVVISTFHI 204

Query: 189 TIENVASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            ++       + +P   +     +  +  Q+  ++Q E  ++        +NV + T I 
Sbjct: 205 ELDGGGGDLHVTMPYSMIEPIREMLDAGFQSDLDDQDERWVNALKEDVLDVNVPLTTTIA 264

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
            ++  L+D++ ++ G VIP         ++ ANG   +  +LG       +++ + I
Sbjct: 265 QRQLPLRDILHMRPGDVIPVEL--SDSLVMRANGVPSFKVKLGSHKGKMALQVIEPI 319


>gi|212709505|ref|ZP_03317633.1| hypothetical protein PROVALCAL_00547 [Providencia alcalifaciens DSM
           30120]
 gi|212687843|gb|EEB47371.1| hypothetical protein PROVALCAL_00547 [Providencia alcalifaciens DSM
           30120]
          Length = 335

 Score =  235 bits (600), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 36/307 (11%), Positives = 87/307 (28%), Gaps = 10/307 (3%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
            N  P  P    R+  +             +   + +         +    DI+  + + 
Sbjct: 33  DNVRPYDPNTQRRVFRERMQS------LEIINERFARQFRMGLFNMLRRSPDITVGAIKI 86

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSL 127
             +     +       +   +              LV   ++NL G       +   +  
Sbjct: 87  EPYHEFARNLPVPTNLNLIHMPPLRGTALFTFEPALVYIAVDNLFGGDGRFPVRSEGKEF 146

Query: 128 STVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMN 187
           +  E+++  R +               +          I     N     N+ V T    
Sbjct: 147 TNTEQRIINRMLKLALGAYRDAWKPIADVEVEYVRSE-IQVKFTNITTSPNDIVVTTPFL 205

Query: 188 MTIENVASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQLNVNIDTRI 246
           + I N    F + IP   +        +    +   ++E  +     +  +  + +   +
Sbjct: 206 VEIGNTVGEFSICIPIAMIEPLRERLTNPPMEQGHQENEAWVTNLVTQVKRSELELIANL 265

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                 +  ++ L+ G V+P         I++ +G  + + + G     Y +R+   IN 
Sbjct: 266 VDIPLRISRLLQLQKGDVLPIEKP--DRLIVNVDGVPVLTSQYGTQNGQYALRVEHLINP 323

Query: 307 DQKSLKN 313
              +L  
Sbjct: 324 VLNTLDE 330


>gi|150021178|ref|YP_001306532.1| flagellar motor switch protein FliM [Thermosipho melanesiensis
           BI429]
 gi|149793699|gb|ABR31147.1| flagellar motor switch protein FliM [Thermosipho melanesiensis
           BI429]
          Length = 329

 Score =  235 bits (600), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 50/292 (17%), Positives = 98/292 (33%), Gaps = 7/292 (2%)

Query: 20  RLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKE 79
                    K  E+    L   + + L   F  ++   V ++        +   I S K 
Sbjct: 40  DFLRPRKFSKEQERTLQMLHENFARTLSTYFSGRLRSFVAVNLVGIDQMTYDEFIKSIKN 99

Query: 80  NFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTI 139
               +  S   +  +  +     +   +LE LLG          NR  +  E ++ ++ +
Sbjct: 100 PSFITIFSAKEFVGSAVLDIDLAIFYGILEILLGGPGSMTE--INRPPTETEIEVMRKEV 157

Query: 140 AQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVL 199
             I   L+Q  +T     P +E        +       NE V  I   + I NV     +
Sbjct: 158 VNILTNLSQAWTTVYSFVPVIEAIET--NPQFVQVVALNEMVLVITFFVNIGNVEGYVNI 215

Query: 200 IIPQETLLKTTLIS---LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDV 256
             P   +             + K +  SE+ +        +  V +   I     TL D+
Sbjct: 216 CWPSSLIEPIGEKLTTQSWFKTKQKVVSEEDMKALKENLARTIVELSATIGETNLTLWDI 275

Query: 257 VTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
           + L++G VI     ++    +  NGK+ +    G     Y ++I +  + ++
Sbjct: 276 LNLEVGDVIRLNTFKEDPLKIKLNGKDKFLGAPGVFKGKYAVKILEVFDEEE 327


>gi|225375335|ref|ZP_03752556.1| hypothetical protein ROSEINA2194_00960 [Roseburia inulinivorans DSM
           16841]
 gi|225212824|gb|EEG95178.1| hypothetical protein ROSEINA2194_00960 [Roseburia inulinivorans DSM
           16841]
          Length = 326

 Score =  235 bits (600), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 47/312 (15%), Positives = 109/312 (34%), Gaps = 9/312 (2%)

Query: 2   RGQSIHKNTSPLHPILLA--RLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVD 59
            G+   ++        +     T      K   +    +   Y + L       +   V 
Sbjct: 19  NGELDAEDMKEKDEKQVKNYDFTRPAKFSKEHLRTLEIIFEHYGRLLSTNLPVYLRKTVQ 78

Query: 60  ISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETI 119
           +   + ++  +S   ++     +    ++S  S +  I  ++NL   +++ +LG     +
Sbjct: 79  VEVMNSEAVTYSEFTNALSNPVLLGLVNVSPLSGSIIIELADNLGYAIVDRMLGGLGTPL 138

Query: 120 PQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNE 179
            +   R  S +E  + +R      ++L +  S+  E SP LE        +        E
Sbjct: 139 DKP--RDFSEIELLILERIYNVCVSLLPEPWSSVCEISPRLERIET--NSQFAQIISPTE 194

Query: 180 FVTTINMNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTY 236
            +  + +++ I +V     + +P  TL              N  E+  +   D       
Sbjct: 195 MIALVTLHIKIGDVEGLMNICLPYLTLESVMDKLNTKFWYSNLQEHDDKQYTDAIEALIS 254

Query: 237 QLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNY 296
           +  + +   +     ++ D V L++G +I           +     + ++   G VG NY
Sbjct: 255 KAKIPVKAVLGNSTISVDDFVNLQVGDIIRLDSGVNQDLNIFVGNIKKFTALPGAVGDNY 314

Query: 297 TIRITDRINFDQ 308
            +R+T  +  +Q
Sbjct: 315 AVRVTSVVREEQ 326


>gi|71737319|ref|YP_275531.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257484906|ref|ZP_05638947.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|289629023|ref|ZP_06461977.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289651613|ref|ZP_06482956.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|298487824|ref|ZP_07005864.1| Flagellar motor switch protein fliM [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|71557872|gb|AAZ37083.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|298157549|gb|EFH98629.1| Flagellar motor switch protein fliM [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320325124|gb|EFW81193.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320329383|gb|EFW85376.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330866455|gb|EGH01164.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           aesculi str. 0893_23]
 gi|330889050|gb|EGH21711.1| flagellar motor switch protein FliM [Pseudomonas syringae pv. mori
           str. 301020]
 gi|330986499|gb|EGH84602.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331011074|gb|EGH91130.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 322

 Score =  235 bits (600), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 43/301 (14%), Positives = 97/301 (32%), Gaps = 12/301 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   +          R+                +   + ++        +    D++   
Sbjct: 30  SEPGSVKSYDLTSQDRIVRG------RMPTLEMINERFARYTRISMFNLLRRSADVAVGG 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            Q  KF   +HS       + A +              LV  L++N  G       ++  
Sbjct: 84  VQVMKFGEYVHSLYVPTSLNLAKIKPLRGTALFILDAKLVFKLVDNFFGGDGR-HAKIEG 142

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E ++ +  + Q    L +      E +   E                +E V   
Sbjct: 143 REFTPTELRVVRMVLDQAFIDLKEAWQAIMEVN--FEYINSEVNPAMANIVGPSEAVVIS 200

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQLNVNID 243
             ++ ++       + +P   +     +  +  Q+  ++Q E  I+        +NV + 
Sbjct: 201 TFHIELDGGGGDLHVTMPYSMIEPIREMLDAGFQSDLDDQDERWINALKEDVLDVNVPLT 260

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
           T I  ++  L+D++ ++ G VIP         ++ ANG   +  +LG       +++ + 
Sbjct: 261 TTIAQRQLPLRDILHMRPGDVIPVEL--SESLVMRANGVPSFKVKLGSHKGKMALQVIEP 318

Query: 304 I 304
           I
Sbjct: 319 I 319


>gi|189911092|ref|YP_001962647.1| flagellar motor switch protein FliM [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Ames)']
 gi|167775768|gb|ABZ94069.1| Endoflagellar motor switch protein [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Ames)']
          Length = 341

 Score =  235 bits (600), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 48/314 (15%), Positives = 102/314 (32%), Gaps = 17/314 (5%)

Query: 6   IHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSC 65
             K           +        K   +    +  ++ +        ++   V +   S 
Sbjct: 32  EQKKVKIYDFKRPDKF------SKNQIRTLQMMHEIFARLATTGLSAQLRALVVVHVASV 85

Query: 66  QSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNR 125
               +   I S       +  ++     +  +    ++  T+++ L G   E+     NR
Sbjct: 86  DQLTYEEFIRSIPNPTTLAVINMDPLRGSAILEIDPSISFTIIDRLFGGKGESSKV--NR 143

Query: 126 SLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTIN 185
            LS +E  + +  I +I   L +  ST  +  P L +       +       N+ V  I 
Sbjct: 144 ELSDIELSVMEGIIVRILGNLRESWSTVIDLRPRLGNIET--NPQFAQVVPPNDMVVLIT 201

Query: 186 MNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNI 242
           +   +  V     L IP  T+              +  + + ++       +  Q+ + +
Sbjct: 202 LETKVGEVEGMTNLCIPYITIEPIINKLSAQYWYSSIRKGEVDENRAVIQERLDQVKIPL 261

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPF-LHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
            + +     +L D++ L +G VI       KT  ++    +  +    GRVG    I+I 
Sbjct: 262 ISEVGSVDISLNDLMNLHVGDVIKLENTPIKTDLMVKVGDRSKFKATPGRVGNRLAIQIG 321

Query: 302 DRINFDQKSLKNFL 315
           D I   +      L
Sbjct: 322 DSI---EDIPDELL 332


>gi|83589656|ref|YP_429665.1| flagellar motor switch protein FliM [Moorella thermoacetica ATCC
           39073]
 gi|83572570|gb|ABC19122.1| flagellar motor switch protein FliM [Moorella thermoacetica ATCC
           39073]
          Length = 323

 Score =  235 bits (600), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 45/281 (16%), Positives = 98/281 (34%), Gaps = 8/281 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +    +   Y + +       +   + +   S +   +   I S     + +  S
Sbjct: 47  SKEHLRTLYMIHENYGRLVANFLSAYLRASIQVKIVSVEQMTYEDFILSLPTPTLMNVFS 106

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +     +  +  + N +  +++ L G   E + +  NR L+ +E  + +R  +++   L+
Sbjct: 107 MEPLKGSAVLETNMNFIFPIIDLLFGGRGEMVAR--NRELTEIELHVLRRLNSRMLEQLS 164

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
              S  Q  +P LE+       +       NE V  I M  T+        L +P   L 
Sbjct: 165 YSWSDIQNITPKLENMET--NPQFTQAISPNETVAVITMGTTVGKYEGLLNLCLPYMLLE 222

Query: 208 KTTLISLSSQ----NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQ 263
                  +S             D      +   ++ V +   I   +  ++D + L++G 
Sbjct: 223 PVISRLSASHWFATGGEREARPDYRTVVEKILAEVPVELIAYIGRTRLPVRDFIQLQVGD 282

Query: 264 VIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
           VI           L  +G   +  + G V K   +++T+ +
Sbjct: 283 VITLEKTVGEDLELYVDGHHKFQVQPGIVNKKIAVQVTEVV 323


>gi|226944505|ref|YP_002799578.1| flagellar motor switch protein [Azotobacter vinelandii DJ]
 gi|226719432|gb|ACO78603.1| flagellar motor switch protein [Azotobacter vinelandii DJ]
          Length = 350

 Score =  235 bits (599), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 44/330 (13%), Positives = 109/330 (33%), Gaps = 19/330 (5%)

Query: 1   MRGQSIHKNTSPLHPILLARL-----TGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMD 55
           ++G S  +++SP  P    R+       +    +        +   + ++        + 
Sbjct: 16  LKGVSGEEDSSPSEPADTQRIRPYNPATQHRVIRERLHALDIINERFARYFRMSLFNLIR 75

Query: 56  LDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGAS 115
              DI+  S +   +S    +       +  ++        +    +LV  +++NL G  
Sbjct: 76  RSADITVDSVRYQSYSDFARNVPVPTNINLLAMKPLRGTALVVFPPSLVFMVVDNLFGGD 135

Query: 116 HETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNR 175
              + +   R  +  E+++ +R +            +       ++        K     
Sbjct: 136 GRFLTKSEGREFTHTEQRIIRRLLGLALEAYQSAWKSVYPLE--IDYLRSEMQAKFANIT 193

Query: 176 -LSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKS-ENQSEDLIDPFAR 233
              NE V     ++ + N+AS F +++P   +     +     N S  ++        A 
Sbjct: 194 SSPNEIVINSTFHLEVGNLASDFNIVMPYLMIEPLRSLLNGPLNDSHPDEERQWGKRMAS 253

Query: 234 KTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVG 293
           +  Q  + +          +  V+ LK+G V+P         +   +G  +  CE G   
Sbjct: 254 EIKQSQIELIADFAGIDLCIGQVMALKVGDVLPIELP--ETVVARVDGVPVMRCEYGSRN 311

Query: 294 KNYTIRITDRIN--------FDQKSLKNFL 315
               +++ + I+          ++ +K  L
Sbjct: 312 GQRALQVKELIDHSSANAGATTERFIKGSL 341


>gi|326796458|ref|YP_004314278.1| flagellar motor switch protein FliM [Marinomonas mediterranea
           MMB-1]
 gi|326547222|gb|ADZ92442.1| flagellar motor switch protein FliM [Marinomonas mediterranea
           MMB-1]
          Length = 329

 Score =  235 bits (599), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 46/285 (16%), Positives = 97/285 (34%), Gaps = 7/285 (2%)

Query: 31  IEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSS 90
                  +   + ++        +    D+S    Q  KF   +H+       +      
Sbjct: 48  RMPTLEMINERFARYTRISLFNLLRRTADVSSGGLQIMKFGEYVHTLYVPTSLNLVKFRP 107

Query: 91  WSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCI 150
             S         LV  L++N  G       ++  R  +  E ++ +  + Q+   L +  
Sbjct: 108 LRSTALFILDAKLVFKLVDNFFGGDGR-HAKIEGREFTPTEIRIVQLMLEQVFVDLTEAW 166

Query: 151 STTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTT 210
           +   +    LE                +E V     ++ ++       + +P   +    
Sbjct: 167 APVLKLE--LEYISSEVNPAMANIVSPSEVVVVSTFHIELDGGGGELHITLPYSMIEPVR 224

Query: 211 LISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLH 269
            +  +  Q+  + + +       +    ++VN+   I  KK TL DV+  K G VIP   
Sbjct: 225 ELLDAGVQSDVDEKDDRWGKSLEQDVQDVDVNLHVNIASKKITLGDVLKFKTGDVIPIEM 284

Query: 270 REKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD-QKSLKN 313
                  + AN    +  +LG     Y++++ + I    ++SLKN
Sbjct: 285 P--EYVTVRANNVPTFRGKLGSSNGKYSVQMKESIKAQMKESLKN 327


>gi|330808225|ref|YP_004352687.1| flagellar motor switch protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327376333|gb|AEA67683.1| Flagellar motor switch protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 322

 Score =  235 bits (599), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 37/277 (13%), Positives = 94/277 (33%), Gaps = 6/277 (2%)

Query: 31  IEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSS 90
                  +   + ++        +    D++    Q  KF   +HS       +   +  
Sbjct: 50  RMPTLEMINERFARYTRISMFNMLRRSADVAVGGVQVMKFGEYVHSLYVPTSLNLVKIKP 109

Query: 91  WSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCI 150
                       LV  L++N  G       ++  R  +  E ++ +  + Q    L +  
Sbjct: 110 LRGTALFILDAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLEQAFVDLKEAW 168

Query: 151 STTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTT 210
               E +   E                +E +     ++ ++       + +P   +    
Sbjct: 169 QAIMEVN--FEYINSEVNPAMANIVGPSEAIVVSTFHIELDGGGGDLHVTMPYSMIEPVR 226

Query: 211 LISLS-SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLH 269
            +  +  Q+  ++Q E  I+   +    ++V I   +  ++  L+D++ ++ G +IP   
Sbjct: 227 EMLDAGFQSDLDDQDERWINALRQDVLDVDVPIGATVARRQLRLRDILHMQPGDIIPVEM 286

Query: 270 REKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
            E    ++ ANG   +  ++G    N  +++ + I  
Sbjct: 287 PED--MVMRANGVPAFKVKMGSHKGNLALQVIEPIER 321


>gi|312962266|ref|ZP_07776758.1| flagellar motor switch protein FliM [Pseudomonas fluorescens WH6]
 gi|311283603|gb|EFQ62192.1| flagellar motor switch protein FliM [Pseudomonas fluorescens WH6]
          Length = 322

 Score =  235 bits (599), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 39/299 (13%), Positives = 95/299 (31%), Gaps = 12/299 (4%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           +          R+                +   + ++        +    D++    Q  
Sbjct: 34  SVKSYDLTSQDRIVRG------RMPTLEMINERFARYTRISMFNMLRRSADVAVGGVQGM 87

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           KF   +HS       +   +              LV  L++N  G       ++  R  +
Sbjct: 88  KFGEYVHSLYVPTSLNLVKIKPLRGTALFILDAKLVFKLVDNFFGGDGR-HAKIEGREFT 146

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E ++ +  + Q    L +      E +   E                +E +     ++
Sbjct: 147 PTELRVVRMVLEQAFIDLKEAWQAIMEVN--FEYINSEVNPAMANIVGPSEAIVVSTFHI 204

Query: 189 TIENVASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            ++       + +P   +     +  +  Q+  ++Q E  +         ++V +   + 
Sbjct: 205 ELDGGGGDLHVTMPYSMIEPVREMLDAGFQSDLDDQDERWVKALREDLLDVDVPLSATVA 264

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
            ++  L+D++ ++ G VIP         I+ ANG   +  +LG    N  +++ + IN 
Sbjct: 265 RRQLRLRDILHMQPGDVIPVELP--QEMIMRANGVPSFKVKLGSHKGNLALQVIEPINR 321


>gi|229591843|ref|YP_002873962.1| flagellar motor switch protein FliM [Pseudomonas fluorescens SBW25]
 gi|229363709|emb|CAY51095.1| flagellar motor switch protein [Pseudomonas fluorescens SBW25]
          Length = 322

 Score =  235 bits (599), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 36/277 (12%), Positives = 91/277 (32%), Gaps = 6/277 (2%)

Query: 31  IEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSS 90
                  +   + ++        +    D++    Q  KF   +HS       +   +  
Sbjct: 50  RMPTLEMINERFARYTRISMFNMLRRSADVAVGGVQVMKFGEYVHSLYVPTSLNLVKIKP 109

Query: 91  WSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCI 150
                       LV  L++N  G       ++  R  +  E ++ +  + Q    L +  
Sbjct: 110 LRGTALFILDAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLEQAFIDLKEAW 168

Query: 151 STTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTT 210
               E +   E                +E +     ++ ++       + +P   +    
Sbjct: 169 QAIMEVN--FEYINSEVNPAMANIVGPSEAIVVSTFHIELDGGGGDLHVTMPYSMIEPVR 226

Query: 211 LISLS-SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLH 269
            +  +  Q+  ++Q E  +         ++V +   +  ++  L+D++ ++ G +IP   
Sbjct: 227 EMLDAGFQSDLDDQDERWVKALREDLLDVDVPLSATVARRQLRLRDILHMQPGDIIPVEL 286

Query: 270 REKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                 I+ ANG   +  +LG    N  +++ + I  
Sbjct: 287 P--EEMIMRANGVPSFKVKLGSHKGNLALQVVESITR 321


>gi|303248092|ref|ZP_07334357.1| flagellar motor switch protein FliM [Desulfovibrio fructosovorans
           JJ]
 gi|302490491|gb|EFL50399.1| flagellar motor switch protein FliM [Desulfovibrio fructosovorans
           JJ]
          Length = 326

 Score =  234 bits (598), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 40/297 (13%), Positives = 89/297 (29%), Gaps = 10/297 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
                        R+            +   +   + +         M    D++  S  
Sbjct: 32  DSGVVVFDLSNQDRIIRG------RMPVLEIINDRFARLASNAMANAMRKRADVNPISID 85

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
             KF   + S       +   L     N  +   + LV  ++E+  G +     ++  R 
Sbjct: 86  MSKFGDFMRSLPVPTSINIFKLDPLRGNAILVVDSRLVFAMVESFFGGAGSQP-KIEGRD 144

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            + +E+ +  R +      + +      E   ++E        +       ++ V  +  
Sbjct: 145 FTPIEQAIINRVVRIALENMEESWQPVHEV--HIELVRSEVNPQFAAIVPPSDVVIVVTF 202

Query: 187 NMTIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTR 245
            + +EN   S ++ +P  T+         S Q +        I  F  +  +  V +  R
Sbjct: 203 EVELENAIGSLIVCLPYATIEPIRTKLYASFQTERLEVDHAWIARFKERLMETPVEMLVR 262

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
               + T + +++LK G +I   +           G   +    G V  N   +I  
Sbjct: 263 FGRSQVTGRQLLSLKPGDIIMLDNDVDALLEAEVQGVRKFRGIPGLVKSNKAFQIVK 319


>gi|192360300|ref|YP_001982201.1| flagellar motor switch protein FliM [Cellvibrio japonicus Ueda107]
 gi|190686465|gb|ACE84143.1| flagellar motor switch protein FliM [Cellvibrio japonicus Ueda107]
          Length = 339

 Score =  234 bits (598), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 44/298 (14%), Positives = 97/298 (32%), Gaps = 12/298 (4%)

Query: 10  TSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGK 69
                     R+                +   + ++        +    D+S    Q  K
Sbjct: 33  VRAYDLTSQDRIVRG------RMPTLEMINERFARYTRISMFNLLRRTADVSVGGVQIQK 86

Query: 70  FSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLST 129
           F   +H+       +            I     LV  L++N  G       ++  R  + 
Sbjct: 87  FGEYVHTLYVPTSLNMVKFRPLRGTALIILDARLVFKLVDNFFGGDGR-HAKIEGREFTP 145

Query: 130 VEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMT 189
            E ++ +  + Q    L +          + E  +             +E V     ++ 
Sbjct: 146 TELRVVQMVLNQAFVDLGEAWKAVFPV--SFEYVHSEVNPSLANIVSPSEVVVVSTFHIE 203

Query: 190 IENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINL 248
           ++       + +P   +     +  +  Q+ SE Q E  +           V+++  +  
Sbjct: 204 LDGGGGEMHITVPYSMIEPIREVLDAGLQSDSEEQDERWVRALREDVLAAKVDLECDVVR 263

Query: 249 KKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
           +  TL+D+V LK G +IP         +++ANG  ++  +LG+   N  ++I + I+ 
Sbjct: 264 RDITLRDIVDLKEGDIIPVEFP--DYHVVTANGVPMFRTQLGQHNDNLALKILEFIDR 319


>gi|229918638|ref|YP_002887284.1| flagellar motor switch protein FliM [Exiguobacterium sp. AT1b]
 gi|229470067|gb|ACQ71839.1| flagellar motor switch protein FliM [Exiguobacterium sp. AT1b]
          Length = 329

 Score =  234 bits (598), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 44/309 (14%), Positives = 106/309 (34%), Gaps = 14/309 (4%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           Q   K           R        K   +  + +   + + L   F  ++   V  S  
Sbjct: 30  QEEEKKVRQYDFKRAVRF------SKDQIRSLTRIHEHFTRMLTTFFSAQLRTYVQFSVN 83

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
           S +   +   IHS     + +       +  F I  + N+   +L+ LLG     + ++ 
Sbjct: 84  SVEQLPYDEFIHSIPSMTMINLIEAPPLNGRFIIEVNPNISYAMLDRLLGGPGVEMDKIE 143

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
           +   + +E ++  +   +  +       +  E    +         +       NE V  
Sbjct: 144 S--FTEIEMRILTQLYKRAFSTYGDAWESIAEIKAEMSAVEV--NPQFLQLVSPNETVVL 199

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLS----SQNKSENQSEDLIDPFARKTYQLN 239
           I++ +TI  V+ +  + +P  T+        S     +    N S+   +P   +     
Sbjct: 200 ISIGVTIGEVSGTINVCLPFVTIEPVLSKLSSHYWMQEANRRNASQSSKEPLKAQLMNST 259

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           V + + +     T  D++ L++G  +      K    +     +++  ++G  GK   ++
Sbjct: 260 VEVVSLLGETTITFGDLLHLEVGDCLALDQLAKEPLSVMVGENKVFKGQVGVSGKRMAVQ 319

Query: 300 ITDRINFDQ 308
           +  R+  ++
Sbjct: 320 VLHRVKEEE 328


>gi|300722647|ref|YP_003711937.1| flagellar motor switch and energizing protein [Xenorhabdus
           nematophila ATCC 19061]
 gi|297629154|emb|CBJ89750.1| flagellar biosynthesis; component of motor switch and energizing
           [Xenorhabdus nematophila ATCC 19061]
          Length = 335

 Score =  234 bits (598), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 36/303 (11%), Positives = 84/303 (27%), Gaps = 10/303 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S      P  P    R+  +             +   + +         +    DI+  +
Sbjct: 30  SGESEVRPYDPNTQRRVVRERLQS------LEIINERFARQFRMGLFNMLRRSPDITVGA 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L             +LV   ++NL G       ++  
Sbjct: 84  IKIQPYHEFARNLAVPTNLNLVHLKPLRGTALFAFEPSLVYIAVDNLFGGDGRFPTKVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +            +  +          +     N     N+ V T 
Sbjct: 144 REFTYTEQRIINRMLKLALDAYRDAWDSIFKIEVEYVRSE-MQVKFTNITTSPNDIVVTT 202

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKS-ENQSEDLIDPFARKTYQLNVNID 243
              + I  +   F + IP   +        +   ++   +         ++     + + 
Sbjct: 203 PFQVEIGALTGEFNICIPFAMIEPLRERLTNPPVENLRQEDGQWRKSLVKQVQHSELELV 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ LK G V+P         I+  +G  +   + G +   Y +R+   
Sbjct: 263 ANFVDIPLRLSKILELKAGDVLPIEKP--ERLIVHVDGVPVLISQYGTLHGQYALRVEHL 320

Query: 304 INF 306
           IN 
Sbjct: 321 INP 323


>gi|238924157|ref|YP_002937673.1| flagellar motor switch protein FliM [Eubacterium rectale ATCC
           33656]
 gi|238875832|gb|ACR75539.1| flagellar motor switch protein FliM [Eubacterium rectale ATCC
           33656]
 gi|291524890|emb|CBK90477.1| flagellar motor switch protein FliM [Eubacterium rectale DSM 17629]
          Length = 326

 Score =  234 bits (598), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 42/308 (13%), Positives = 103/308 (33%), Gaps = 13/308 (4%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           ++  +          ++        K   +    +   Y + L       +   V +   
Sbjct: 29  ENSEQTVKDYDFARPSKF------SKEHLRTLEIIFEHYGRLLTTNLPVYLRKSVQVEVM 82

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
           + ++  +S   ++     +    + +    N  +  ++ L   +++ +LG   +++ +  
Sbjct: 83  NSEAVTYSEFTNALSNPVLLGIVNFAPLHGNIIVEMASGLGYAIVDRMLGGRGDSLDKT- 141

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  S +E  + +R +     +L +      + SP+LE        +       +E +  
Sbjct: 142 -REFSEIELLIIERILVICINLLQEPWQNVLDISPHLERIET--NSQYAQIISPSEVIAI 198

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLIS---LSSQNKSENQSEDLIDPFARKTYQLNV 240
           I MN+ I +V     + +P  TL              N   +   +  +       +  +
Sbjct: 199 ITMNIKIGDVEGLMNICLPYITLESVIDKLNTRYWYSNIQNHDETNYRNAIESLIQKSQI 258

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            +   +     ++KD  TL  G VI           +     + ++   G  G  Y +RI
Sbjct: 259 PVKAVLGKSLISVKDFSTLVPGDVIRLDTNVDDELDIYVGNIKKFTALPGSSGDKYAVRI 318

Query: 301 TDRINFDQ 308
           T  +  +Q
Sbjct: 319 TSVVREEQ 326


>gi|222147563|ref|YP_002548520.1| flagellar motor switch protein [Agrobacterium vitis S4]
 gi|221734551|gb|ACM35514.1| flagellar motor switch protein [Agrobacterium vitis S4]
          Length = 319

 Score =  234 bits (598), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 106/305 (34%), Positives = 169/305 (55%)

Query: 11  SPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKF 70
            P+   LLARLTG LGD K++EK+    G LY +FLP +F  + +L +++ Y   +SG  
Sbjct: 14  KPMDHALLARLTGGLGDMKSVEKLCQDFGQLYSEFLPDVFHSETNLTIEVGYLGFKSGLM 73

Query: 71  SHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTV 130
             +I S  +NFV +  SL +WS NF + C N  VITL+E LLG   E I +   R LS +
Sbjct: 74  RDLIASLGDNFVLANTSLRNWSQNFVMACGNGFVITLMETLLGGMQEFIGEPIKRPLSNI 133

Query: 131 EKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTI 190
           E  LA     +I+ VL   ++ T    P  E  ++ +   +       EF   ++M++ +
Sbjct: 134 ELDLAVMVFERIANVLRSGVNATGGFEPIFERPHNWENRLRQDGEQIEEFGALVHMSIKL 193

Query: 191 ENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKK 250
             + S F LIIPQ+TLLKT + +  S+N+     ++  +  A +  +  V ++ RI+L+ 
Sbjct: 194 GKITSDFALIIPQKTLLKTNVTAPKSKNQVSKARKEWAEQLAEQVRKSQVTLEGRISLQS 253

Query: 251 TTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
            +L  V  L  G VIPFL +      +SANG+++Y+CE GR G +YT+R+    + D + 
Sbjct: 254 LSLLTVSKLAAGDVIPFLEKGDVTVDVSANGRDLYTCEFGRAGDHYTVRVKSMHSTDSEL 313

Query: 311 LKNFL 315
           L++ +
Sbjct: 314 LRHLM 318


>gi|291529031|emb|CBK94617.1| flagellar motor switch protein FliM [Eubacterium rectale M104/1]
          Length = 326

 Score =  234 bits (598), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 42/308 (13%), Positives = 103/308 (33%), Gaps = 13/308 (4%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           ++  +          ++        K   +    +   Y + L       +   V +   
Sbjct: 29  ENSEQTVKDYDFARPSKF------SKEHLRTLEIIFEHYGRLLTTNLPVYLRKSVQVEVM 82

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
           + ++  +S   ++     +    + +    N  +  ++ L   +++ +LG   +++ +  
Sbjct: 83  NSEAVTYSEFTNALSNPVLLGIVNFAPLQGNIIVEMASGLGYAIVDRMLGGRGDSLDKT- 141

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  S +E  + +R +     +L +      + SP+LE        +       +E +  
Sbjct: 142 -REFSEIELLIIERILVICINLLQEPWQNVLDISPHLERIET--NSQYAQIISPSEVIAI 198

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLIS---LSSQNKSENQSEDLIDPFARKTYQLNV 240
           I MN+ I +V     + +P  TL              N   +   +  +       +  +
Sbjct: 199 ITMNIKIGDVEGLMNICLPYITLESVIDKLNTRYWYSNIQNHDETNYRNAIESLIQKSQI 258

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            +   +     ++KD  TL  G VI           +     + ++   G  G  Y +RI
Sbjct: 259 PVKAVLGKSLISVKDFSTLVPGDVIRLDTNVDDELDIYVGNIKKFTALPGSSGDKYAVRI 318

Query: 301 TDRINFDQ 308
           T  +  +Q
Sbjct: 319 TSVVREEQ 326


>gi|220932512|ref|YP_002509420.1| flagellar motor switch protein FliM [Halothermothrix orenii H 168]
 gi|219993822|gb|ACL70425.1| flagellar motor switch protein FliM [Halothermothrix orenii H 168]
          Length = 334

 Score =  234 bits (598), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 42/289 (14%), Positives = 99/289 (34%), Gaps = 7/289 (2%)

Query: 20  RLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKE 79
                    K   +    +   + + L      ++   VD    S +   +   I S  E
Sbjct: 40  DFRRPDKLSKEQMRTLEMIHENFARILTTTLSTQLRSRVDFEVASIEQLTYEEFIRSLPE 99

Query: 80  NFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTI 139
             +   + +  ++  F    + ++   +++ L G     + ++  R+ + +EK + ++ I
Sbjct: 100 PTIIGISEMEPFNGQFIFEINPDIGFAIIDRLFGGMGNPLDRV--RTYTDIEKVVLRKVI 157

Query: 140 AQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVL 199
           +   + L +         P L         +      SN+    I M+  I N      +
Sbjct: 158 SWFLSGLPEAWENIIRVKPRLR--EIESNPQFTQVVPSNDMTILITMSAKIANSEGLVNV 215

Query: 200 IIPQETLLKTTLIS---LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDV 256
            IP   +              N  E ++   I+   +K  +  + +   +   + T+ D+
Sbjct: 216 CIPYIMIEPIVPQLNAQQWFSNTREERTAQHIEAIKKKLKRAPLEVIAEVGKTQLTVTDL 275

Query: 257 VTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           + L+ G VI    + +    +       +    G   K+  ++ITD I+
Sbjct: 276 LYLQPGDVIRLDKKAEEKVDIRIGKNVKFQGVAGVSNKHMAVKITDVIS 324


>gi|326204614|ref|ZP_08194470.1| flagellar motor switch protein FliM [Clostridium papyrosolvens DSM
           2782]
 gi|325985181|gb|EGD46021.1| flagellar motor switch protein FliM [Clostridium papyrosolvens DSM
           2782]
          Length = 328

 Score =  234 bits (597), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 38/281 (13%), Positives = 95/281 (33%), Gaps = 7/281 (2%)

Query: 32  EKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSW 91
           ++    +   Y + +       +   V +   S  + ++S   +S     +      +  
Sbjct: 52  KRTLQFINENYARLVQSFLSGYLRSLVQVDVLSVDALQYSEFSNSLANPIILGIVDFTPL 111

Query: 92  SSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCIS 151
           + +       ++   L++ +LG    ++ ++  RS + +E  + +R I QI  ++ +   
Sbjct: 112 NGSVIFEMDPSIAYALIDRILGGRGASMERV--RSFTEIELAIIERIIIQILNLMREPWE 169

Query: 152 TTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTL 211
           +     P LE        +       NE V  I +N+ +  V     + IP  T+     
Sbjct: 170 SIIAIKPRLEKIET--NAQFAQIIHPNEMVALITLNVVVGEVKGMINICIPHMTVEPIMP 227

Query: 212 ISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFL 268
                    N    + E        K     V +   +     ++ + + L+ G V+P  
Sbjct: 228 KLSTKLWFTNVENEKIEHNKSDIEFKIEHTYVPVRAVLGKTSISISEFLDLQSGDVLPLD 287

Query: 269 HREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
                   +       ++ + G       ++IT+ +  ++ 
Sbjct: 288 TNVNGDLEILVGDLPKFNAKPGVKKNKVAVKITEVLRREED 328


>gi|168187522|ref|ZP_02622157.1| flagellar motor switch protein FliM [Clostridium botulinum C str.
           Eklund]
 gi|169294580|gb|EDS76713.1| flagellar motor switch protein FliM [Clostridium botulinum C str.
           Eklund]
          Length = 331

 Score =  234 bits (596), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 43/285 (15%), Positives = 101/285 (35%), Gaps = 7/285 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +    +   + + +      ++  +V ++  + Q   +   IHS     + +   
Sbjct: 48  SKDHIRTLELIHDNFARIISNYLTAQVRTNVKVNIETVQQITYEEFIHSVPNPTILTVFK 107

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +   S +     +      +++ LLG S     +   R L+ ++K + K+    +   L 
Sbjct: 108 MPPLSGSILFETNPQFAYQIIDVLLGGSGTGQYKT--RELTDIDKNIIKQINNGLITNLK 165

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
                  E  P +E          N     NE V  I  ++ +   ++   + IP  ++ 
Sbjct: 166 LAWEDVMEVEPEIEGLET--NPALNQTLAPNEPVALITFSVEMGGNSTFINICIPYLSIE 223

Query: 208 KTTLIS---LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
           K           +  +    E   +   ++   + + +   +   K  +++ ++L IG V
Sbjct: 224 KVLDKLVVQYWFRENNVESLEGSKEKLKKRMKVVELPMSVVLGSTKLDVREFLSLCIGDV 283

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
           I       +   +    +     + G VGKN  ++I D I+ D +
Sbjct: 284 ITLDALTSSPVKVMVEDEPYLLAKPGIVGKNKGVQILDIIDKDVE 328


>gi|288962686|ref|YP_003452980.1| flagellar motor switch protein [Azospirillum sp. B510]
 gi|288914952|dbj|BAI76436.1| flagellar motor switch protein [Azospirillum sp. B510]
          Length = 374

 Score =  234 bits (596), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 34/302 (11%), Positives = 105/302 (34%), Gaps = 3/302 (0%)

Query: 16  ILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIH 75
             + RL       K    +   +     + L    ++    +V+ S +  +  +++    
Sbjct: 74  SAIQRLVSSTTVNKDRLPMLDVVFDRMVRMLNTSLRQFASTNVEASLSKIEWLRYTDFQD 133

Query: 76  SFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLA 135
           + +   +   A    W +   +   + L+  +++ LLG       ++  R+ +++E+K+ 
Sbjct: 134 AIELPALIGVARAEPWDNQMLVTIDSALIYCMMDVLLGGRRSRPGRIDGRAYTSIERKMT 193

Query: 136 KRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVAS 195
           +R +  +   L Q      +     +        +  T   +   +  + + + +E    
Sbjct: 194 ERMMKVVLQDLGQSFDPLAQVDFVFDRLEV--NPQFATITRATNAIIRVRIAVEVERRTG 251

Query: 196 SFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLK 254
              ++IP  TL       +     +              +  +  + +   +   K  L 
Sbjct: 252 HIDIVIPYATLEPIRGKLVQMFMGEKFGHDTVWESHLKNELMRSKLELVAVLAETKVPLG 311

Query: 255 DVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
           +V+  + GQ +       +  ++ +    +++  +G+   N  ++I   ++  Q+ +   
Sbjct: 312 EVLAWQKGQSLKLRISPDSTVMVFSKTIPLFAGHMGQRNDNIAVKIDTDLDTKQELIDGL 371

Query: 315 LH 316
           L 
Sbjct: 372 LS 373


>gi|291538507|emb|CBL11618.1| flagellar motor switch protein FliM [Roseburia intestinalis XB6B4]
          Length = 326

 Score =  233 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 41/292 (14%), Positives = 97/292 (33%), Gaps = 7/292 (2%)

Query: 20  RLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKE 79
                    K   +    +   Y + L       +  +V +   + ++  +S   ++   
Sbjct: 39  DFARPAKFSKEHLRTLEIIFEHYGRLLSTNLPVYLRKNVQVEVMNSEAVTYSEFSNALSN 98

Query: 80  NFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTI 139
             +    + S  + +  I  + NL   +++ +LG     + +   R  S +E  + +R  
Sbjct: 99  PVLLGIVNASPLNGSIVIEMAQNLGYAVVDRMLGGKGVPLDKP--RDFSEIELLIIERIF 156

Query: 140 AQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVL 199
                +L +      E  P LE        +        E +  + +N+ I +V     +
Sbjct: 157 NVAVDLLVEPWENVCELEPRLERIET--NSQFAQIISPTEMIALVTLNVKIGDVEGLLNV 214

Query: 200 IIPQETLLKTTLIS---LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDV 256
            +P  TL              +  E   +   +       +  + I   +     ++ D 
Sbjct: 215 CLPYLTLESIMDKLNTKYWYSSLQEKDEQQYTETIEALISKAPMPIKAVLGNSSISVNDF 274

Query: 257 VTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
           + L++G +I    +      +     + ++   G  G +Y +RIT  I  +Q
Sbjct: 275 LGLQVGDIIRLDTKVDQELSVFVGSIKKFTALPGETGDDYAVRITSVIREEQ 326


>gi|261344127|ref|ZP_05971771.1| flagellar motor switch protein FliM [Providencia rustigianii DSM
           4541]
 gi|282567719|gb|EFB73254.1| flagellar motor switch protein FliM [Providencia rustigianii DSM
           4541]
          Length = 335

 Score =  233 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 36/307 (11%), Positives = 89/307 (28%), Gaps = 10/307 (3%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
            N  P +P    R+  +             +   + +         +    DI+  + + 
Sbjct: 33  DNVRPYNPNTQRRVFRERMQS------LEIINERFARQFRMGLFNMLRRSPDITVGAIKV 86

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSL 127
             +     +       +   +              LV   ++NL G       +   +  
Sbjct: 87  EPYHEFARNLPVPTNLNLIHMPPLRGTALFTFEPALVYIAVDNLFGGDGRFPVRSEGKEF 146

Query: 128 STVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMN 187
           +  E+++  R +               +          I     N     N+ V T    
Sbjct: 147 TNTEQRIINRMLKLALNAYRDAWRPIADVEVEYVRSE-IQVKFTNITTSPNDIVVTTPFL 205

Query: 188 MTIENVASSFVLIIPQETLLKTTLISLSSQNKSE-NQSEDLIDPFARKTYQLNVNIDTRI 246
           + I N    F + IP   +       ++   +    ++E  +     +  +  + +   +
Sbjct: 206 VEIGNTVGEFSICIPIAMIEPLRERLINPPTEQGHQENEAWVTNLVTQVKRSELELVANL 265

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                 +  ++ L+ G V+P         I++ +G  + + + G     Y +R+   IN 
Sbjct: 266 VEIPLRISSLLQLQKGDVLPIDKP--DRLIVNVDGVPVLTSQYGTQNGQYALRVEHLINP 323

Query: 307 DQKSLKN 313
              +L  
Sbjct: 324 VLNTLDE 330


>gi|302037615|ref|YP_003797937.1| flagellar motor switch protein FliM [Candidatus Nitrospira
           defluvii]
 gi|300605679|emb|CBK42012.1| Flagellar motor switch protein FliM [Candidatus Nitrospira
           defluvii]
          Length = 323

 Score =  233 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 34/276 (12%), Positives = 86/276 (31%), Gaps = 3/276 (1%)

Query: 31  IEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSS 90
                  +   + +     +   +   ++ S    Q  KF   I        F+  ++  
Sbjct: 50  RMPTMEMINDRFTRQQSISWSAVLREKIEFSVLGTQIMKFGDFIQKVPVPSSFNLFAMEP 109

Query: 91  WSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCI 150
              N        LV  +++   G   +T  +   R  +T++ +L K+ + Q  A L +  
Sbjct: 110 MRGNGLFVMDAMLVYLIVDFFFGGKVQTHVKPEGREFTTIQLRLIKKLVQQALADLEKAW 169

Query: 151 STTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTT 210
                    +         +      ++E V  + + + + +++    +  P   L    
Sbjct: 170 QAVMPVK--IGYLRSESNPQFAMVVTTSEIVVVVTLQVHLGDISREMFIAYPYSMLEPIK 227

Query: 211 LISLSSQ-NKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLH 269
               S     +  Q       F     + +V +  ++   +  ++D++    G V+    
Sbjct: 228 EKLYSGLFADNVEQDSSWGSRFKDSLQECDVALTVQLGTARINVQDLLNFNPGDVLMLDQ 287

Query: 270 REKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
                 +    G   +  + G    N+  R+T  + 
Sbjct: 288 HPGDPMLCLVEGDPKFQGQPGIFKGNHACRVTKILG 323


>gi|172057877|ref|YP_001814337.1| flagellar motor switch protein FliM [Exiguobacterium sibiricum
           255-15]
 gi|171990398|gb|ACB61320.1| flagellar motor switch protein FliM [Exiguobacterium sibiricum
           255-15]
          Length = 327

 Score =  233 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 43/311 (13%), Positives = 108/311 (34%), Gaps = 14/311 (4%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           +R Q   +           R        K   +  + +   + + L   F  ++   V  
Sbjct: 27  IRSQEEERRVKVYDFKRALRF------SKDQMRNLTRIHEQFARVLTTHFSAQLRTYVQF 80

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           +  + +   +   IHS     + +  +L           + N+   +L+ LLG   E + 
Sbjct: 81  TVNTVEQLPYDEFIHSIPNMTLINLVNLHPLDGRVIFEVNPNIAYAMLDRLLGGPGEGMN 140

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++ N  L+ +E ++  +   +          +  E     E        +       NE 
Sbjct: 141 KIEN--LTEIETRILTQLFKRAFVQYGAAWESIAEIEA--EYDDLEINPQFLQLVSPNET 196

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLS----SQNKSENQSEDLIDPFARKTY 236
           V  +++ +T+  V+ +  + +P  TL        S     Q K ++      +    +  
Sbjct: 197 VILVSIYVTVGEVSGTLNVCLPFVTLEPIIPKLSSHFWMQQEKRKSADNQESEHMQTQLM 256

Query: 237 QLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNY 296
              V++   +   + +  +++ L++G  +    R      L  + ++++    G  GK+ 
Sbjct: 257 GSIVDLKAVLGQTELSFGELLHLEVGDCLSLQTRTSDPVELFVDDRKMFKARPGLNGKHL 316

Query: 297 TIRITDRINFD 307
            +++  RI  +
Sbjct: 317 ALQVLQRIEEE 327


>gi|116328061|ref|YP_797781.1| flagellar motor switch protein FliM [Leptospira borgpetersenii
           serovar Hardjo-bovis L550]
 gi|116331486|ref|YP_801204.1| flagellar motor switch protein FliM [Leptospira borgpetersenii
           serovar Hardjo-bovis JB197]
 gi|116120805|gb|ABJ78848.1| Endoflagellar motor switch protein [Leptospira borgpetersenii
           serovar Hardjo-bovis L550]
 gi|116125175|gb|ABJ76446.1| Endoflagellar motor switch protein [Leptospira borgpetersenii
           serovar Hardjo-bovis JB197]
          Length = 341

 Score =  233 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 46/315 (14%), Positives = 103/315 (32%), Gaps = 17/315 (5%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S  K           +        K   +    +   + +        ++   V +   S
Sbjct: 31  SEQKKVKIYDFKRPDKF------SKDQIRTLQMMHETFARLATTGLSAQLRALVSVHVAS 84

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
                +   I S       +  ++     +  +    ++  T+++ L G   E      +
Sbjct: 85  VDQLTYEEFIRSIPNPTTLAVINMDPLRGSAILEIDPSISFTIIDRLFGGKGEQAK--IS 142

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R LS +E  + +  I +I   + +  ST  +  P L +       +       N+ V  I
Sbjct: 143 RELSEIEMSVMEGIIVRILGNMRESWSTVIDLRPRLGNIET--NPQFAQVVPPNDMVVLI 200

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVN 241
            +   I  V     L IP  T+              +  + + ++       +  Q+ + 
Sbjct: 201 TLETKIGEVEGMTNLCIPYITIEPIINKLSAQYWYSSIRKGELDENRAVIQERLDQVAIP 260

Query: 242 IDTRINLKKTTLKDVVTLKIGQVIPFLHR-EKTCAILSANGKEIYSCELGRVGKNYTIRI 300
           +   +     ++ D + L +G V+   +   ++  I+    ++ + C  GRVG    I+I
Sbjct: 261 LIAEVGSVDVSINDFMNLSVGDVVKLENTSTRSEMIVKVGERKKFKCLPGRVGSRLAIQI 320

Query: 301 TDRINFDQKSLKNFL 315
            DR+   +      L
Sbjct: 321 GDRV---EDIPDELL 332


>gi|226327727|ref|ZP_03803245.1| hypothetical protein PROPEN_01600 [Proteus penneri ATCC 35198]
 gi|225203431|gb|EEG85785.1| hypothetical protein PROPEN_01600 [Proteus penneri ATCC 35198]
          Length = 343

 Score =  233 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 41/308 (13%), Positives = 88/308 (28%), Gaps = 10/308 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
             +  P  P    R+  +             +   + +         +    DI+    +
Sbjct: 40  EPDIQPYDPNTQRRVVRERLQS------LEIINERFARQFRMGLFNMLRRSPDITVGGIK 93

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
              +     +       +   L             NLV   ++NL G        +  R 
Sbjct: 94  IHPYHDFARNLPVPTNLNLVHLKPLRGTALFTFEPNLVYIAVDNLFGGDGRFPIPVEGRE 153

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E+++  + +            +  +          +     N     N+ V T   
Sbjct: 154 FTNTEQRIINKMLKLALDAYRDAWDSIFKIQVEYVRSE-MQVKFTNITSSPNDIVVTTPF 212

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSSQNKS-ENQSEDLIDPFARKTYQLNVNIDTR 245
            + I ++   F + IP   +       ++   ++   +    +D    +     + +   
Sbjct: 213 QVEIGSMVGEFSICIPFAMIEPLRERLINPPIENVRQEDGVWLDSLVNQVQHSELELVAN 272

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
                  L  V+TLK G VIP         I   +G  + + + G V   Y +R+   IN
Sbjct: 273 FTDIPLRLSKVLTLKEGDVIPIDKP--ERLIAHVDGVPVLTSQYGTVNGQYALRVEHLIN 330

Query: 306 FDQKSLKN 313
               +L  
Sbjct: 331 PVLNALDE 338


>gi|296122747|ref|YP_003630525.1| flagellar motor switch protein FliM [Planctomyces limnophilus DSM
           3776]
 gi|296015087|gb|ADG68326.1| flagellar motor switch protein FliM [Planctomyces limnophilus DSM
           3776]
          Length = 375

 Score =  233 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 46/292 (15%), Positives = 100/292 (34%), Gaps = 5/292 (1%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +   +L   + +         +   V++   S     +S  + S +    F+   
Sbjct: 60  SKEQMRAFQALHEGFSREFGAALSGMLRAIVEVKLISVDQLTYSEFVFSLENPTCFNLLE 119

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
                 +  +  S +++  +++ LLG   E+IP + +R L+ +E +L  R    +   L 
Sbjct: 120 SKGLEGHLILDLSPSIIFPIVDRLLGGGKESIPSIPSRPLTEIELQLVSRITLLVINGLE 179

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
                       L+        +       NE +  ++  +T+  V     L IP  T+ 
Sbjct: 180 NAWHNVCSL--GLKVTQIESNPQLVQIVPPNEVIVLVSFEITMGEVRGIMNLCIPFNTIE 237

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
             +        S  + +               +  V +   +   + T +D+  L +G V
Sbjct: 238 PLSGKLSSDTWSAYQKKGLDPKQRVILEDGLSKAAVKMIVNLAHTRLTARDLAHLAVGDV 297

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLH 316
           I   H ++    +   G  ++  + G V     IR+T  +   +  L+  L 
Sbjct: 298 IMTEHPKEDGLEVVVEGCPMFMAKPGAVKGKKAIRVTGMVAHSRDILREKLQ 349


>gi|220929456|ref|YP_002506365.1| flagellar motor switch protein FliM [Clostridium cellulolyticum
           H10]
 gi|219999784|gb|ACL76385.1| flagellar motor switch protein FliM [Clostridium cellulolyticum
           H10]
          Length = 328

 Score =  233 bits (594), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 39/281 (13%), Positives = 94/281 (33%), Gaps = 7/281 (2%)

Query: 32  EKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSW 91
           ++    +   Y + +       +   V +   S  + ++S   +S     +      +  
Sbjct: 52  KRTLQFINENYARLVQSFLSGYLRSLVQVDVLSVDALQYSEFSNSLANPVILGIVDFTPL 111

Query: 92  SSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCIS 151
           + +       ++   L++ +LG    ++ ++  RS + +E  + +R I QI  ++ +   
Sbjct: 112 NGSVIFEMDPSIAYALIDRILGGRGASMERV--RSFTEIELAIIERIIIQILNLMREPWE 169

Query: 152 TTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTL 211
           +     P LE        +       NE V  I +N+ +  V     + IP  T+     
Sbjct: 170 SIIAIKPRLEKIET--NAQFAQIIHPNEMVALITLNVVVGEVKGLINICIPHITVEPIMP 227

Query: 212 ISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFL 268
                    N    + E        K     V +   +     ++ + + L+ G V+P  
Sbjct: 228 KLSTKLWFTNVENEKVEHNKSDIEFKIGHTYVPVRAVLGRTSISISEFLDLQGGDVLPLD 287

Query: 269 HREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
                   +       +  + G       I+IT+ +  ++ 
Sbjct: 288 TNVNGDLEILVGDLPKFKAKPGVKKNKVAIKITEVLRREED 328


>gi|299131782|ref|ZP_07024977.1| flagellar motor switch protein FliM [Afipia sp. 1NLS2]
 gi|298591919|gb|EFI52119.1| flagellar motor switch protein FliM [Afipia sp. 1NLS2]
          Length = 399

 Score =  233 bits (594), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 40/293 (13%), Positives = 102/293 (34%), Gaps = 4/293 (1%)

Query: 14  HPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHI 73
               +  +            +   +     + +    +     +V++S     S +F+  
Sbjct: 86  DHSGIRAIIDSAMVSYERLPMLEIVFDRLVRLMTTSLRNFTSDNVEVSLDRITSVRFADY 145

Query: 74  IHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGAS-HETIPQLYNRSLSTVEK 132
           ++S     V +      W +       ++L+ ++++ LLG    +T  ++  R  +T+E 
Sbjct: 146 LNSIPLPCVLTVFKAEEWENFGLFTVDSSLIYSMIDVLLGGRRGQTSLRIEGRPYTTIET 205

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            L KR +  + A   Q        +  ++        +             + + + +E+
Sbjct: 206 NLVKRLVEVVLADAEQAFRPLSPVTFTIDRLET--NPRFAAISRPANAAILVRLRVDMED 263

Query: 193 VASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
              +  L++P  T+     + L     +   +        A +  +  + +D  +     
Sbjct: 264 RGGNVELLLPYATIEPIRNVLLQMFMGEKFGRDPIWEGHLATEIAKAEMYVDAVLYEADM 323

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
            LK +++LK+G  +P   R      +      +    +GRVG    IR++  +
Sbjct: 324 PLKQLMSLKVGDTLPLDIRPDAMVSVRCGDVTLSEGRMGRVGDRVAIRVSKPL 376


>gi|58039165|ref|YP_191129.1| flagellar motor switch protein FliM [Gluconobacter oxydans 621H]
 gi|58001579|gb|AAW60473.1| Flagellar motor switch protein FliM [Gluconobacter oxydans 621H]
          Length = 343

 Score =  232 bits (593), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 45/306 (14%), Positives = 103/306 (33%), Gaps = 10/306 (3%)

Query: 10  TSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGK 69
           T       + R+    G       +   +   + + L    +     +V+ S     S +
Sbjct: 30  TGAADSSGIERVVSTSGVSSERLPMLEVVFDRFTRILTTSLRNFTSDNVEASMDRLGSQR 89

Query: 70  FSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE-------TIPQL 122
           F   + +     +F+      W +   +  S++L+ ++++ LLG              + 
Sbjct: 90  FGDYLENVPGQAMFAVFKAEEWDNYGVVVLSSSLIYSIVDALLGGHVRGDSALTAPASRQ 149

Query: 123 YNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVT 182
             R  + +E+ L +  +  I   L    S     + + E        +      +   V 
Sbjct: 150 TGRHHTAIERALIEPMVRIILDDLETSFSPLCAVNFHFERLEM--NSRFAMICRAGNGVV 207

Query: 183 TINMNMTIENVASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQLNVN 241
           T    + +E       +++P  TL     I L     +         +  AR+ +Q ++ 
Sbjct: 208 TARFGIDMEGRGGDVDIVLPHATLEPVRDILLQQFMGEKFGHDGIWENHLARELWQTDLT 267

Query: 242 IDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
           +D  +  +   LKD++ L  G  +    +      L      +++  +GR      ++I 
Sbjct: 268 LDAVLEEQTMNLKDIMKLAPGDQLVLRRKPDASVSLRCGEHVLFTGRVGRKQGQVAVKIE 327

Query: 302 DRINFD 307
           D +N  
Sbjct: 328 DVLNQK 333


>gi|220905099|ref|YP_002480411.1| flagellar motor switch protein FliM [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
 gi|219869398|gb|ACL49733.1| flagellar motor switch protein FliM [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
          Length = 326

 Score =  232 bits (593), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 30/297 (10%), Positives = 86/297 (28%), Gaps = 10/297 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
                        R+            +   +   + +         +   V+++  S  
Sbjct: 32  DSGIVAFDLANQDRIIRG------RMPVLEIVNDRFARLCTNALSNSVRKRVELNPISID 85

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
             KF   + S       +   +     N  +   + LV  L+E++ G +     ++  R 
Sbjct: 86  MTKFGEFMRSLPVPTSINIFKMDPLRGNAIMVVDSRLVFALVESVFGGAGSQP-KVEGRE 144

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            + +E+ +  + +      + +      +    L         +       ++ V  I  
Sbjct: 145 FTRIEQAVVDKIVKIALDNMEESWRPVHDVKLELVR--SEINPQFAAIVPPSDVVVVITF 202

Query: 187 NMTIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTR 245
            + ++    S ++ +P  T+         S Q +        +     +  +  V +   
Sbjct: 203 EVELDTALGSMIICLPYATIEPIRSKLHASFQTERLEVDHAWVARLKERLMETPVELKVC 262

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
                 T   ++ +++G ++     E+     +  G   Y    G +    + +I  
Sbjct: 263 FGKTTITGNQLLRMQVGDILVLDKDEEDMLDCTVAGVCKYQGIAGTIKAMKSFQIIK 319


>gi|300854133|ref|YP_003779117.1| flagellar motor switch protein [Clostridium ljungdahlii DSM 13528]
 gi|300434248|gb|ADK14015.1| flagellar motor switch protein [Clostridium ljungdahlii DSM 13528]
          Length = 331

 Score =  232 bits (593), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 44/309 (14%), Positives = 107/309 (34%), Gaps = 13/309 (4%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           +   +   P       +        K   +    +   Y + +      ++  +V +   
Sbjct: 30  EEEKQKVKPYDFRSPQKF------SKDHIRTLELIHDNYARIISNYLTAQVRTNVKVKVE 83

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
           S Q   +   IHS     V +   +   S +     +   V  +++ LLG + +   ++ 
Sbjct: 84  SVQQITYEEFIHSVPNPTVLTIFKMPPLSGSVLFEVNPQFVFQIIDLLLGGNGKGKYKV- 142

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            +  + ++K + K   A + + L             +E          N     N+ V  
Sbjct: 143 -KEFTDIDKNIIKVVNAGLISNLKLAWEDVMPIETEVEGLET--NPALNQTLAPNDPVAL 199

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLIS---LSSQNKSENQSEDLIDPFARKTYQLNV 240
           I  ++ + N ++   + IP  ++ K           Q+  E+   +  +    +   ++V
Sbjct: 200 ITFSVEMGNSSTFINICIPYLSIEKVLDKLVVQYWFQDSDEDILNESREKLRNRLDIVDV 259

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            +   +     T+++ + L +G V+    +  +   L    K  Y  + G + KN  + I
Sbjct: 260 ELTAILGTVDVTVQEFLNLNVGDVLTLKEKTTSPVKLMVEDKVYYYGKPGVIDKNMGVEI 319

Query: 301 TDRINFDQK 309
            D ++ D +
Sbjct: 320 LDILDKDVE 328


>gi|289578422|ref|YP_003477049.1| flagellar motor switch protein FliM [Thermoanaerobacter italicus
           Ab9]
 gi|297544698|ref|YP_003677000.1| flagellar motor switch protein FliM [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
 gi|289528135|gb|ADD02487.1| flagellar motor switch protein FliM [Thermoanaerobacter italicus
           Ab9]
 gi|296842473|gb|ADH60989.1| flagellar motor switch protein FliM [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
          Length = 332

 Score =  232 bits (593), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 37/285 (12%), Positives = 92/285 (32%), Gaps = 8/285 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +    +     + L       +   V+++  S     +    +S       +   
Sbjct: 50  SKEQLRTLQMIFENLTRSLTSFLSGYLRTVVNVTVISVDQLTYYEFSNSLNNPVFIAIID 109

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
            +     F +  +NN    +L+ +LG   +   +L +R  + +E  L  + + Q+  +  
Sbjct: 110 AAPLEGPFLLEFNNNTTYAILDRILGGIGK--GELVDRDYTEIEISLLTKIVKQMLPLFK 167

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +      + +P+L         +       NE V    +++ I          +P  TL 
Sbjct: 168 EPWGNIVDINPSLVRVET--NSQFAQIISPNETVALCTLSLKINETEGMMNFCMPHLTLE 225

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                        +  +       +    K  +  + +  ++     T+K+ +  +IG +
Sbjct: 226 PIVPKLTTKFWFSSLKKEGRVS-PELIKSKISKTYIPLTAQLGSTTITVKEFLNFEIGDI 284

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
           I      K    +  +    +    G     Y+++IT+ I    +
Sbjct: 285 ILLDKNFKDPVDIIIDKNVKFRGIPGIRNNKYSVKITEVIYKGDE 329


>gi|209884529|ref|YP_002288386.1| flagellar motor switch protein FliM [Oligotropha carboxidovorans
           OM5]
 gi|209872725|gb|ACI92521.1| flagellar motor switch protein FliM [Oligotropha carboxidovorans
           OM5]
          Length = 398

 Score =  232 bits (593), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 40/300 (13%), Positives = 104/300 (34%), Gaps = 4/300 (1%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
                      +  +            +   +     + +    +     +V++S     
Sbjct: 78  DSEVHLEDHSGIRAIIDSAMVSYERLPMLEIVFDRLVRLMTTSLRNFTSDNVEVSLDRIT 137

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGAS-HETIPQLYNR 125
           S +F+  ++S     V +      W +       ++L+ ++++ LLG    +T  ++  R
Sbjct: 138 SVRFADYLNSIPLPCVLTVFKAEEWENFGLFTVDSSLIYSMIDVLLGGRRGQTSLRIEGR 197

Query: 126 SLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTIN 185
             +T+E  L KR +  + A   Q        +  ++        +             + 
Sbjct: 198 PYTTIETNLVKRLVEVVLADAEQAFRPLSPVTFTIDRLET--NPRFAAISRPANAAILVR 255

Query: 186 MNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDT 244
           + + +E+   +  L++P  T+     + L     +   +        A +  Q  + +D 
Sbjct: 256 LRVDMEDRGGNVELLLPYATIEPIRNVLLQMFMGEKFGRDPIWEGHLATEIAQAELYVDA 315

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
            +   +  LK +++L++G  +P   R      +     ++    +GRVG    IR++  +
Sbjct: 316 VLYEAEIPLKQLMSLQVGDTLPLDIRPDALVSVRCGDVKLSEGRMGRVGDRVAIRVSKPL 375


>gi|163794148|ref|ZP_02188121.1| flagellar motor switch protein FliM [alpha proteobacterium BAL199]
 gi|159180762|gb|EDP65281.1| flagellar motor switch protein FliM [alpha proteobacterium BAL199]
          Length = 341

 Score =  232 bits (592), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 40/302 (13%), Positives = 103/302 (34%), Gaps = 4/302 (1%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
                      +  +            +   +     + +    +     +V++S  +  
Sbjct: 41  EAGDGDGDTSGIHAIVNSALVSYERLPMLEVVFDRLVRMMSTSLRNFTSDNVEVSLDNIT 100

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGAS-HETIPQLYNR 125
           S +F   ++S     + S      W +   +   + L+ ++++ LLG        ++  R
Sbjct: 101 SIRFGDYLNSIPLPAMLSVFKAEEWDNFGLLVVDSALIYSIVDVLLGGRRGTAAMRIEGR 160

Query: 126 SLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTIN 185
             +T+E+ L +R +  + + L+         +   +        +  T            
Sbjct: 161 PYTTIERNLVERMVTVVLSDLSAAFDPLSPVTFRFDRLET--NPRFATIARPANAAVLAR 218

Query: 186 MNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDT 244
           + + +E+      L++P  TL     + L     +   +        A + +  +V +D 
Sbjct: 219 LRIDMEDRGGRLELMLPYATLEPVRELLLQMFMGEKFGRDSIWETHLANELWNTDVELDA 278

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
            ++     L DV+ LK G  I       +   +      ++S ++GR   +  +RI++R+
Sbjct: 279 VLDEIVMPLHDVLNLKPGSRILLNAMPNSTIDMRCGNVSLFSGKMGRKNGSIAVRISNRL 338

Query: 305 NF 306
             
Sbjct: 339 RK 340


>gi|83594172|ref|YP_427924.1| flagellar motor switch protein FliM [Rhodospirillum rubrum ATCC
           11170]
 gi|83577086|gb|ABC23637.1| flagellar motor switch protein FliM [Rhodospirillum rubrum ATCC
           11170]
          Length = 384

 Score =  232 bits (592), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 40/297 (13%), Positives = 107/297 (36%), Gaps = 4/297 (1%)

Query: 14  HPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHI 73
               +  +            +   +     + +    +     +V++S  + QS +F   
Sbjct: 89  DKSGIQAIISTALVSYERLPMLEVVFDRLVRMMSTSLRNFTSDNVEVSLDNIQSYRFGDY 148

Query: 74  IHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGAS-HETIPQLYNRSLSTVEK 132
           ++S     + S      W +   +   ++++ ++++ LLG        ++  R  +T+E+
Sbjct: 149 LNSIPLPAMLSVFKAEEWDNYGLLTIDSSMIYSIVDVLLGGRRGTAAMRIEGRPYTTIER 208

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            L +R +  + A L+         +   +        +  T    +       + + +E+
Sbjct: 209 NLVERLVHVVLADLSAAFDPLSPVTFRFDRLET--NPRFATISRPSNAAIVAKLRIDMED 266

Query: 193 VASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
                 ++IP  TL     + L     +   +        A + +   V +D  ++    
Sbjct: 267 RGGRLDMLIPYATLEPVRELLLQMFMGEKFGRDSIWETHLAEEMWSTEVQMDAILDEVYM 326

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
            L  ++++++G  I F     +   L      ++  ++GR G+N  IR+  + N  +
Sbjct: 327 PLNKILSMEVGSQILFNATPDSTVQLRCGDVPMFDGKMGRKGQNIAIRVDSKHNRAK 383


>gi|89895728|ref|YP_519215.1| hypothetical protein DSY2982 [Desulfitobacterium hafniense Y51]
 gi|89335176|dbj|BAE84771.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 338

 Score =  232 bits (592), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 41/285 (14%), Positives = 103/285 (36%), Gaps = 7/285 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K       ++   Y + L       +   ++   +S +   +   I S     + S  +
Sbjct: 55  SKDQIHSLQNIYENYCRSLTTYLSGHLHSVIETKVSSIEQITYDEFIRSLPNPTILSLYT 114

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           L+       +  S  L   +++ LLG   +   +  NR L+ +E+ +      Q+  ++ 
Sbjct: 115 LNPLEGTLLMEMSPALAFAIIDRLLGGQGQGSEK--NRDLTEIERTIISHRAQQMINLIG 172

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  S    + P  E        +       NE +  + + + +  +     + +P   L 
Sbjct: 173 EAWSEVIPNEP--EYIVLETNPQFTQIVAPNEMIILVTLEVQVGEMVGMVNMCLPYLVLE 230

Query: 208 KTTLISLS---SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                  +      +++  S++ ++   RK     V++ T +   +  ++D++ L  G V
Sbjct: 231 PVLDKLSTLFLFSTQAKVTSKEQVNAIRRKIEWAKVDMTTLLGHSEILVRDLLELAPGDV 290

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
           IP +   K    +       +    G  G++  ++IT+ +   + 
Sbjct: 291 IPLMQNVKEALPVYVGNFRKFKGIPGLHGEHLAVQITEIVEEGRD 335


>gi|144897829|emb|CAM74693.1| Flagellar motor switch protein fliM [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 382

 Score =  232 bits (592), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 39/281 (13%), Positives = 103/281 (36%), Gaps = 4/281 (1%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
                 +   +     + +    +     +V++S  +  S +F   ++S     + +   
Sbjct: 104 SYERLPMLEVVFDRLVRMMSTSMRNFTSDNVEVSLDNILSLRFGDYLNSIPLPAMLAVFK 163

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGAS-HETIPQLYNRSLSTVEKKLAKRTIAQISAVL 146
              W +   +   ++L+ ++++ LLG        ++  R  +T+E+ L +R +  + + L
Sbjct: 164 AEEWDNYGLLTVDSSLIYSIVDVLLGGRRGTAAMRIEGRPYTTIERNLVERMVHVVLSDL 223

Query: 147 NQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL 206
           +         +   +        +  T    +       + + +E+      L++P  TL
Sbjct: 224 SAAFDPLSPVTFRFDRLET--NPRFATISRPSNAAIVAKLRIDMEDRGGRLELLLPYATL 281

Query: 207 LKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVI 265
                + L     +   +        A + +   V ++  ++ +   L+DV+  K+G  I
Sbjct: 282 EPVRELLLQMFMGEKFGRDSIWETHLAEELWLTEVQMEAVLDEQVMGLRDVLNWKVGSKI 341

Query: 266 PFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
               +  +   L      ++   +GR G +  IR+ D+I  
Sbjct: 342 LLNAQPNSPIDLRCGDVSMFRGRMGRKGPHIAIRVDDKIKG 382


>gi|302338090|ref|YP_003803296.1| flagellar motor switch protein FliM [Spirochaeta smaragdinae DSM
           11293]
 gi|301635275|gb|ADK80702.1| flagellar motor switch protein FliM [Spirochaeta smaragdinae DSM
           11293]
          Length = 341

 Score =  232 bits (592), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 40/280 (14%), Positives = 92/280 (32%), Gaps = 8/280 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +  S +   + +        ++   V +   S     +   I S          +
Sbjct: 48  SKEQIRTVSIMHETFARLTTTALSAQLRSMVHVHVASVDQLTYEEFIRSIPNPTTLGIIN 107

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +     +  +     +  ++++ L+G   E      NR L+ +E+ + +  I +I   L 
Sbjct: 108 MDPLKGSAVLEIDPAITFSVIDRLMGGQGE--GSKVNRDLTDIEQTVMEGIIVRILGNLR 165

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  S   +  P L         +        E V  + +   +  V       IP  T+ 
Sbjct: 166 EAWSQVIDLRPRLGQIET--NPQFAQIVPPTEMVVLVTLETKVGEVEGMMNFCIPYLTIE 223

Query: 208 KTTLISLSS---QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                  +     +     + + ++    +   + + +   I     T++DV++L+ G V
Sbjct: 224 PIISKLSAQYMYSSVRSGATTENLNILKDRLSTVAIPVVAEIGEMNLTVRDVLSLRAGDV 283

Query: 265 IPF-LHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
           I     R      +    ++ + C  G VG    ++I  R
Sbjct: 284 IRLPDVRVGDPMTIKIGNRKKFECRPGLVGNKVAVQIVHR 323


>gi|307546956|ref|YP_003899435.1| flagellar motor switch protein FliM [Halomonas elongata DSM 2581]
 gi|307218980|emb|CBV44250.1| flagellar motor switch protein FliM [Halomonas elongata DSM 2581]
          Length = 347

 Score =  232 bits (591), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 42/307 (13%), Positives = 96/307 (31%), Gaps = 10/307 (3%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
                   P  P    R+       +        +   + +         +    DI+  
Sbjct: 29  GGSAPKVRPFDPASQHRII------RERLHTLDIINERFARHFRMGLFNLIRRSADITVD 82

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
           S +   +S    +       +  ++     +  I    NLV  +++NL G     + +  
Sbjct: 83  SVRYQSYSEFSRNVPVPTNINMIAMKPLKGSALIVFPPNLVFMVVDNLFGGDGRFLTKSE 142

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  +  E+++ +R +       +    +      +      +     N     NE V  
Sbjct: 143 GREFTNTEQRIIQRMLRLAIEAYSDSWRSVYPLEISFLRSE-MQAKFANITNSPNEIVVN 201

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNI 242
            N N+ + N+ASSF + +P   +     + ++   +  ++Q        A +     V +
Sbjct: 202 TNFNLEVGNLASSFQICMPYSMIEPLRDLLINPLSDGHQDQDSTWTRRMAGEIRHSTVEL 261

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
                   + + DV  L++G ++P             +G  +  CE G       +R+  
Sbjct: 262 VADFADLPSRIADVTALEVGDILPLELP--ETVTAKVDGVPVMECEYGSQHGQRALRVLR 319

Query: 303 RINFDQK 309
             +    
Sbjct: 320 LFDHAAD 326


>gi|56964023|ref|YP_175754.1| flagellar motor switch protein FliM [Bacillus clausii KSM-K16]
 gi|56910266|dbj|BAD64793.1| flagellar motor switch protein FliM [Bacillus clausii KSM-K16]
          Length = 329

 Score =  232 bits (591), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 44/307 (14%), Positives = 96/307 (31%), Gaps = 13/307 (4%)

Query: 6   IHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSC 65
             K           R        K   +  S +   Y + L      K+   V I   S 
Sbjct: 32  SEKKVRVYDFKRALRF------SKDQIRNLSRIHENYARLLTTNLSAKLRSLVQIQVASV 85

Query: 66  QSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNR 125
           +   +   + S       +       +    I  + N+   + + +LG    +  ++ N 
Sbjct: 86  EQVPYEEYVRSIPTMTFLNVIEPIPLNGRVLIEINPNIAYAMFDRVLGGHGMSFNKIDN- 144

Query: 126 SLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTIN 185
            L+ +E K+       + A   +  +T  E  P  E+               NE V  I+
Sbjct: 145 -LTEIETKILSGLFESMLASFAEAWTTVIEMEPITENIEV--NPHFLQLVSPNETVVVIS 201

Query: 186 MNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNI 242
           ++ +I N      + +P   L +           Q +    S +      ++  Q  + +
Sbjct: 202 LSTSIANTTGLMTICLPHVVLEEILPKLTSHHWFQEQRGALSTEDQALLNKQVRQTTLEV 261

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
              +     T+++ + L  G V+           +   G++ +S + G       +++TD
Sbjct: 262 AAELGRSTITIEEFLRLGKGDVVALNQLIDEPLDVLVGGEKKFSGQPGVKRDRMALQVTD 321

Query: 303 RINFDQK 309
            +     
Sbjct: 322 VLGGTDD 328


>gi|290475711|ref|YP_003468600.1| flagellar motor switch protein [Xenorhabdus bovienii SS-2004]
 gi|289175033|emb|CBJ81836.1| flagellar biosynthesis; component of motor switch and energizing
           [Xenorhabdus bovienii SS-2004]
          Length = 335

 Score =  232 bits (591), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 36/310 (11%), Positives = 85/310 (27%), Gaps = 10/310 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S      P  P    R+  +             +   + +         +    DI+  +
Sbjct: 30  SGESEIRPYDPNTQRRVVRERLQS------LEIINERFARQFRMGLFNMLRRSPDITVGA 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +   +     +       +   L             +LV   ++NL G       ++  
Sbjct: 84  IKIQPYHEFARNLAVPTNLNLVHLKPLRGTALFAFEPSLVYIAVDNLFGGDGRFPTKVEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E+++  R +            +  +          +     N     N+ V T 
Sbjct: 144 REFTYTEQRVINRMLKLALDAYRDAWDSIFKIEVEYVRSE-MQVKFTNITTSPNDIVVTT 202

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQLNVNID 243
              + I  +   F + IP   +        +        +     +   ++     + + 
Sbjct: 203 PFQVEIGALCGEFNICIPFAMIEPLRERLTNPPVENVRQEEGQWRESLVKQVQHSELELV 262

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
                    L  ++ L+ G V+P         I   +G  + + + G +   Y +R+   
Sbjct: 263 ANFVDIPLRLSKILQLRRGDVLPIERP--ERLIAHVDGVPVLTSQYGTLNGQYALRVEHL 320

Query: 304 INFDQKSLKN 313
           IN    +L  
Sbjct: 321 INPVLNALDE 330


>gi|303325483|ref|ZP_07355926.1| flagellar motor switch protein FliM [Desulfovibrio sp. 3_1_syn3]
 gi|302863399|gb|EFL86330.1| flagellar motor switch protein FliM [Desulfovibrio sp. 3_1_syn3]
          Length = 326

 Score =  232 bits (591), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 32/297 (10%), Positives = 84/297 (28%), Gaps = 10/297 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
                        R+            +   +   + +         +   V+++  S  
Sbjct: 32  DSGIVAFDLANQDRIIRG------RMPVLEIVNDRFARLCTNALSNAVRKRVELNPISID 85

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
             KF   + S       +   +     N  +   + LV  L+EN+ G +     ++  R 
Sbjct: 86  MTKFGEFMRSLPVPTSINIFKMDPLRGNAIMVVDSRLVFALVENVFGGAGTQP-KIEGRE 144

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            + +E+ +  + +      + +      +    L         +       ++ V  I  
Sbjct: 145 FTRIEQAVVDKIVKIALDNMEESWRPVHDVKLELVR--SEINPQFAAIVPPSDVVVVITF 202

Query: 187 NMTIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTR 245
            + ++    S ++ +P  T+         S Q +        +     +  +  V +   
Sbjct: 203 EVELDTALGSMIICLPYATIEPIRSKLHASFQTERLEVDHAWVARLKERLLETPVELKVH 262

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
                 T   ++ +++G V+      +     +  G   Y    G V      +I  
Sbjct: 263 YGNTTITGNQLLRMQVGDVLVLDTDVEDLLTCTVAGVGKYQGIAGTVKAMKAFQIIK 319


>gi|288958672|ref|YP_003449013.1| flagellar motor switch protein [Azospirillum sp. B510]
 gi|288910980|dbj|BAI72469.1| flagellar motor switch protein [Azospirillum sp. B510]
          Length = 357

 Score =  232 bits (591), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 39/302 (12%), Positives = 99/302 (32%), Gaps = 4/302 (1%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
                    +  L            +   +     + +    +     +V++S     S 
Sbjct: 54  GAGDGDNSGIMALVNSALVNYERLPMLEVVFDRLVRMMSTSLRNFTSDNVEVSLDQISSV 113

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGAS-HETIPQLYNRSL 127
           +F   ++S     + S      W +   +   + L+ ++++ LLG        ++  R  
Sbjct: 114 RFGDYLNSIPLPAMLSVFKAEEWDNYGLMVVDSALIYSIVDVLLGGRRGTAAMRIEGRPY 173

Query: 128 STVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMN 187
           +T+E+ L +R +  + + L+         +   +        +  T          + + 
Sbjct: 174 TTIERNLVERMVHVVLSDLSAAFDPLSPVTFRFDRLET--NPRFATIARPANAAVLVKLR 231

Query: 188 MTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRI 246
           + +E+      L+IP  TL     + L     +   +        A +    +V++   +
Sbjct: 232 IDMEDRGGRLELMIPYATLEPVRELLLQMFMGEKFGRDSIWETHLASELMVTDVDLSAVL 291

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
           +    TL DV+  ++G  I           L      ++   +GR G +  +R+   +  
Sbjct: 292 DEVTMTLHDVLNWRVGTRILLNATPDGAIELRCGDVSMFQGRMGRKGGHIAVRLEKELPK 351

Query: 307 DQ 308
            +
Sbjct: 352 QE 353


>gi|183220997|ref|YP_001838993.1| flagellar motor switch protein FliM [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Paris)']
 gi|167779419|gb|ABZ97717.1| Flagellar motor switch protein FliM [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Paris)']
          Length = 341

 Score =  232 bits (591), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 48/314 (15%), Positives = 102/314 (32%), Gaps = 17/314 (5%)

Query: 6   IHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSC 65
             K           +        K   +    +  ++ +        ++   V +   S 
Sbjct: 32  EQKKVKIYDFKRPDKF------SKDQIRTLQMMHEIFARLATTGLSAQLRALVVVHVASV 85

Query: 66  QSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNR 125
               +   I S       +  ++     +  +    ++  T+++ L G   E+     NR
Sbjct: 86  DQLTYEEFIRSIPNPTTLAVINMDPLRGSAILEIDPSISFTIIDRLFGGKGESSKV--NR 143

Query: 126 SLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTIN 185
            LS +E  + +  I +I   L +  ST  +  P L +       +       N+ V  I 
Sbjct: 144 ELSDIELSVMEGIIVRILGNLRESWSTVIDLRPRLGNIET--NPQFAQVVPPNDMVVLIT 201

Query: 186 MNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNI 242
           +   +  V     L IP  T+              +  + + ++       +  Q+ + +
Sbjct: 202 LETKVGEVERMTNLCIPYITIEPIINKLSAQYWYSSIRKGEVDENRAVIQERLDQVKIPL 261

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPF-LHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
            + +     +L D++ L +G VI       KT  ++    +  +    GRVG    I+I 
Sbjct: 262 ISEVGSVDISLNDLMNLHVGDVIKLENTPIKTDLMVKVGDRSKFKATPGRVGNRLAIQIG 321

Query: 302 DRINFDQKSLKNFL 315
           D I   +      L
Sbjct: 322 DSI---EDIPDELL 332


>gi|219670152|ref|YP_002460587.1| flagellar motor switch protein FliM [Desulfitobacterium hafniense
           DCB-2]
 gi|219540412|gb|ACL22151.1| flagellar motor switch protein FliM [Desulfitobacterium hafniense
           DCB-2]
          Length = 331

 Score =  232 bits (591), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 41/285 (14%), Positives = 103/285 (36%), Gaps = 7/285 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K       ++   Y + L       +   ++   +S +   +   I S     + S  +
Sbjct: 48  SKDQIHSLQNIYENYCRSLTTYLSGHLHSVIETKVSSIEQITYDEFIRSLPNPTILSLYT 107

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           L+       +  S  L   +++ LLG   +   +  NR L+ +E+ +      Q+  ++ 
Sbjct: 108 LNPLEGTLLMEMSPALAFAIIDRLLGGQGQGSEK--NRDLTEIERTIISHRAQQMINLIG 165

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  S    + P  E        +       NE +  + + + +  +     + +P   L 
Sbjct: 166 EAWSEVISNEP--EYIVLETNPQFTQIVAPNEMIILVTLEVQVGEMVGMVNMCLPYLVLE 223

Query: 208 KTTLISLS---SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                  +      +++  S++ ++   RK     V++ T +   +  ++D++ L  G V
Sbjct: 224 PVLDKLSTLFLFSTQAKVTSKEQVNAIRRKIEWAKVDMTTLLGHSEILVRDLLELAPGDV 283

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
           IP +   K    +       +    G  G++  ++IT+ +   + 
Sbjct: 284 IPLMQNVKEALPVYVGNFRKFKGIPGLHGEHLAVQITEIVEEGRD 328


>gi|217077700|ref|YP_002335418.1| flagellar motor switch protein FliM [Thermosipho africanus TCF52B]
 gi|217037555|gb|ACJ76077.1| flagellar motor switch protein FliM [Thermosipho africanus TCF52B]
          Length = 329

 Score =  232 bits (591), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 48/292 (16%), Positives = 101/292 (34%), Gaps = 7/292 (2%)

Query: 20  RLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKE 79
                    K  E+    L   + + L   F  ++   V +         +   + S + 
Sbjct: 40  DFLRPRKFSKEQERTLQMLHENFARSLSTYFSGRLRSFVAVDLVGLDQMTYDEFVKSIRN 99

Query: 80  NFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTI 139
               +  S   +  +  +     +   +LE LLG     +    NR  +  E ++ ++ +
Sbjct: 100 PSYIAVFSAKEFVGSAILDIDLEIFFGVLEILLGGPGMNVE--INRPPTDTEIEVMRKEV 157

Query: 140 AQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVL 199
             I   L Q  ST    +P +E        +      SNE V  I + + I N+     +
Sbjct: 158 VNILTNLVQAWSTVYSFTPVIEAIET--NPQFVQIVASNEMVLVITLLLKIGNIEGYINI 215

Query: 200 IIPQETLLKTTLIS---LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDV 256
             P   +             + K +  SE+ +        +  V +   +     TL D+
Sbjct: 216 CWPSSLVEPIGEKLTTQSWFKTKQKIVSEEDMKALRENLARTIVELSVAVGETNLTLWDI 275

Query: 257 VTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
           + L++G VI     ++    +  NGK+ +    G     Y ++I + ++ ++
Sbjct: 276 LNLEVGDVIRLDTFKEDPLKIKLNGKDKFLGVPGVFKGKYAVKIVEVLDEEE 327


>gi|240145492|ref|ZP_04744093.1| flagellar motor switch protein FliM [Roseburia intestinalis L1-82]
 gi|257202307|gb|EEV00592.1| flagellar motor switch protein FliM [Roseburia intestinalis L1-82]
 gi|291536015|emb|CBL09127.1| flagellar motor switch protein FliM [Roseburia intestinalis M50/1]
          Length = 326

 Score =  232 bits (591), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 41/292 (14%), Positives = 97/292 (33%), Gaps = 7/292 (2%)

Query: 20  RLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKE 79
                    K   +    +   Y + L       +  +V +   + ++  +S   ++   
Sbjct: 39  DFARPAKFSKEHLRTLEIIFEHYGRLLSTNLPVYLRKNVQVEVMNSEAVTYSEFSNALSN 98

Query: 80  NFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTI 139
             +    + S  + +  I  + NL   +++ +LG     + +   R  S +E  + +R  
Sbjct: 99  PVLLGIVNASPLNGSIVIEMAQNLGYVVVDRMLGGKGVPLDKP--RDFSEIELLIIERIF 156

Query: 140 AQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVL 199
                +L +      E  P LE        +        E +  + +N+ I +V     +
Sbjct: 157 NVAVDLLVEPWENVCELEPRLERIET--NSQFAQIISPTEMIALVTLNVKIGDVEGLLNV 214

Query: 200 IIPQETLLKTTLIS---LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDV 256
            +P  TL              +  E   +   +       +  + I   +     ++ D 
Sbjct: 215 CLPYLTLESIMDKLNTKYWYSSLQEKDEQQYTETIEALISKAPMPIKAVLGNSSISVNDF 274

Query: 257 VTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
           + L++G +I    +      +     + ++   G  G +Y +RIT  I  +Q
Sbjct: 275 LGLQVGDIIRLDTKVDQELSVFVGSIKKFTALPGETGDDYAVRITSVIREEQ 326


>gi|183598647|ref|ZP_02960140.1| hypothetical protein PROSTU_02052 [Providencia stuartii ATCC 25827]
 gi|188020831|gb|EDU58871.1| hypothetical protein PROSTU_02052 [Providencia stuartii ATCC 25827]
          Length = 335

 Score =  232 bits (591), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 36/307 (11%), Positives = 87/307 (28%), Gaps = 10/307 (3%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
           +   P  P    R+  +             +   + +         +    DI+    + 
Sbjct: 33  EQVRPYDPNTQRRVIRERMQS------LEIINERFARQFRMGLFNMLRRSPDITVGGIKI 86

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSL 127
             +     +       +   +              LV   ++NL G       +   +  
Sbjct: 87  EPYHEFARNLPVPTNLNLIHMPPLRGTALFTFEPALVYIAVDNLFGGDGRFPVRSEGKEF 146

Query: 128 STVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMN 187
           +  E+++  R +    +          +          +     N     N+ V T    
Sbjct: 147 TNTEQRIIHRMLKLALSAYRDAWRPIADIDVEYVRSE-MQVKFTNITTSPNDIVVTTPFL 205

Query: 188 MTIENVASSFVLIIPQETLLKTTLISLSSQNKSE-NQSEDLIDPFARKTYQLNVNIDTRI 246
           + I N    F + IP   +       ++   +    ++E  +     +  +  + +    
Sbjct: 206 VEIGNTIGEFSICIPIAMIEPLRERLINPPVEQGHQENEAWVSNLVTQVKRSELELVANF 265

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                 +  ++ L+ G VIP         I+S +G  + + + G     Y +R+   IN 
Sbjct: 266 VDIPLRISRLLQLQKGDVIPIEKP--DRLIVSVDGVPVLTSQYGTQNGQYALRVEHLINP 323

Query: 307 DQKSLKN 313
              +L  
Sbjct: 324 VLNTLDE 330


>gi|310659031|ref|YP_003936752.1| flim [Clostridium sticklandii DSM 519]
 gi|308825809|emb|CBH21847.1| FliM [Clostridium sticklandii]
          Length = 332

 Score =  231 bits (590), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 45/297 (15%), Positives = 95/297 (31%), Gaps = 7/297 (2%)

Query: 20  RLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKE 79
                    K   K    +   + + L       +     I   S +   +    +S   
Sbjct: 40  DFKSPKKLAKDQLKTLHMIHENFSRILNTYLSGYLRSITQIDVISVEELSYYEFNNSISN 99

Query: 80  NFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTI 139
             + S               SN L  T+++ +LG + +   +  +R  + +E  +  + +
Sbjct: 100 PALISVIDFMPLPGQIIFEMSNRLAFTMIDRILGGNGKY--ESESRPFTEIETTILNKLM 157

Query: 140 AQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVL 199
           A +S +L +      E  P L+        +      SNE V  I +   + ++     +
Sbjct: 158 ANVSRLLIEPWENVIELDPELDKIET--NSQFAQIVSSNETVALITLRANVGDIEGLMNI 215

Query: 200 IIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDV 256
            +P   L                 +  +ED       +  + N++I+  +     T+++ 
Sbjct: 216 CMPHIVLEPILPNLSTKFWFSTVKKELNEDDKGYLETRVKRANIDINAVVGDTYITVEEF 275

Query: 257 VTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKN 313
           + L+ G VI    +      L   GK  Y    G +  N   +IT  +    +    
Sbjct: 276 IYLQEGDVIKLSRKIDEDLELHVEGKTKYLGRPGTLKNNMAFKITKVVEKGDEDYDE 332


>gi|288573016|ref|ZP_06391373.1| flagellar motor switch protein FliM [Dethiosulfovibrio
           peptidovorans DSM 11002]
 gi|288568757|gb|EFC90314.1| flagellar motor switch protein FliM [Dethiosulfovibrio
           peptidovorans DSM 11002]
          Length = 334

 Score =  231 bits (590), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 43/306 (14%), Positives = 95/306 (31%), Gaps = 13/306 (4%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           +   S  KN          +        K   +    +   + + L       +   V  
Sbjct: 28  ISQASAEKNVKGYDFRRPDKF------SKDQLRAIQMIHESFSRQLTTSLSTMVRSIVTC 81

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
              S     +   + S  +  V     +     N  +  + NLV  +++ LLG   E   
Sbjct: 82  EVASVDQVAYEEFVRSMVQPTVMGVLEMYPLEGNAVVEMNPNLVFAIIDRLLGGKGEVFG 141

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           +   R L+ +E  + +R   ++  +L    ST  +     +                 + 
Sbjct: 142 KP--RDLTDIESTVIERVFMRMLELLEDSWSTVIDVRFRFD--SMESNPFFVQICPGTDM 197

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQ 237
           V  + + ++I +V     L IP   +              +  +N+ +D           
Sbjct: 198 VLLVTLRVSIGDVEGMVSLCIPYFVMEPVMDKLSSQIWFASTGKNKDQDHRGFLTASLGT 257

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
           + V +   +     +L DV+ L++G VI           +    +  ++   G V   Y+
Sbjct: 258 VKVPVHLELGDTVLSLFDVMRLRVGDVIRLDSMLDDPVRVRVGSRIKFTGRPGTVDGRYS 317

Query: 298 IRITDR 303
           + + + 
Sbjct: 318 VEVLEV 323


>gi|24214781|ref|NP_712262.1| flagellar motor switch protein FliM [Leptospira interrogans serovar
           Lai str. 56601]
 gi|45657699|ref|YP_001785.1| flagellar motor switch protein FliM [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|24195784|gb|AAN49280.1| flagellar motor switch protein FliM [Leptospira interrogans serovar
           Lai str. 56601]
 gi|45600939|gb|AAS70422.1| FliM [Leptospira interrogans serovar Copenhageni str. Fiocruz
           L1-130]
          Length = 341

 Score =  231 bits (590), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 46/315 (14%), Positives = 103/315 (32%), Gaps = 17/315 (5%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S  K           +        K   +    +   + +        ++   V +   S
Sbjct: 31  SEQKKVKIYDFKRPDKF------SKDQIRTLQMMHETFARLATTGLSAQLRALVSVHVAS 84

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
                +   I S       +  ++     +  +    ++  T+++ L G   E      +
Sbjct: 85  VDQLTYEEFIRSIPNPTTLAVINMDPLRGSAILEIDPSISFTIIDRLFGGKGEQAK--IS 142

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R LS +E  + +  I +I   + +  ST  +  P L +       +       N+ V  I
Sbjct: 143 RELSEIEMSVMEGIIVRILGNMRESWSTVIDLRPRLGNIET--NPQFAQVVPPNDMVVLI 200

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVN 241
            +   I  V     L IP  T+              +  + + ++       +  Q+ + 
Sbjct: 201 TLETKIGEVEGMTNLCIPYITIEPIINKLSAQYWYSSIRKGELDENRAVIQERLDQVAIP 260

Query: 242 IDTRINLKKTTLKDVVTLKIGQVIPFLHR-EKTCAILSANGKEIYSCELGRVGKNYTIRI 300
           +   +     ++ D + L IG V+   +   ++  I+    ++ + C  GRVG    I+I
Sbjct: 261 LIAEVGSVDVSINDFMNLSIGDVVKLENTSTRSEMIVKVGERKKFKCLPGRVGSRLAIQI 320

Query: 301 TDRINFDQKSLKNFL 315
            +R+   +      L
Sbjct: 321 GERV---EDIPDELL 332


>gi|209964207|ref|YP_002297122.1| flagellar motor switch protein FliM [Rhodospirillum centenum SW]
 gi|7025351|gb|AAF35843.1|AF220001_1 polar motor switch protein FpiM [Rhodospirillum centenum]
 gi|209957673|gb|ACI98309.1| flagellar motor switch protein FliM [Rhodospirillum centenum SW]
          Length = 362

 Score =  231 bits (589), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 38/281 (13%), Positives = 97/281 (34%), Gaps = 4/281 (1%)

Query: 30  TIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLS 89
               +   +     + +    +     +V++S     S +F   ++S     + +     
Sbjct: 81  ERLPMLEVVFDRLVRMMSTSLRNFTSDNVEVSLDQISSVRFGDYLNSIPLPAMLAVFKAE 140

Query: 90  SWSSNFFIGCSNNLVITLLENLLGAS-HETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQ 148
            W +   +   + L+ ++++ LLG        ++  R  +T+E+ L +R +  + + L+ 
Sbjct: 141 EWDNYGLMVIDSALIYSIVDVLLGGRRGTAAMRIEGRPYTTIERNLVERMVHVVLSDLSA 200

Query: 149 CISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLK 208
                   +   +        +  T          + + + +E+      L+IP  TL  
Sbjct: 201 AFDPLSPVTFRFDRLET--NPRFATIARQANAAVLVKLRIDMEDRGGRLELLIPYATLEP 258

Query: 209 TTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPF 267
              + L     +   +        A + +  +V++   ++    +L DV+  +IG  +  
Sbjct: 259 VRELLLQMFMGEKFGRDSIWETHLASELWMTDVHLSAVLDEITLSLYDVLNWRIGSRVLL 318

Query: 268 LHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
                    L      ++   +GR G N  +RI       +
Sbjct: 319 NVAPDDTIELRCGDVPMFLGRMGRKGGNIAVRIDREAPKPE 359


>gi|257457606|ref|ZP_05622773.1| flagellar motor switch protein FliM [Treponema vincentii ATCC
           35580]
 gi|257444992|gb|EEV20068.1| flagellar motor switch protein FliM [Treponema vincentii ATCC
           35580]
          Length = 344

 Score =  231 bits (589), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 41/321 (12%), Positives = 108/321 (33%), Gaps = 12/321 (3%)

Query: 2   RGQSIHKNTSPLHP---ILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDV 58
            G +  +   P++    I +          K   +  S +   + +        ++    
Sbjct: 19  SGDTEAEEFRPVNDTRKIKIYDFKRPDKFSKEQMRTVSIMHETFARLTTTALSAQLRSMA 78

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
            +   S     +   I S       +  ++     N  +    ++  ++++ L G + ++
Sbjct: 79  HVHVASVDQLTYEEFIRSIPTPTTLAVINMDPLKGNAVLEIDPSVTFSIIDRLFGGTGQS 138

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSN 178
              +  R L+ +E  + +  I +I A + +  +   +  P L         +       +
Sbjct: 139 --TMVQRELTDIEASVMEGVIVRILANMREAWTQVIDLRPRLGQIET--NPQFAQIVPPS 194

Query: 179 EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKT 235
           E V  + +   +          IP  T+              +   + +   +     K 
Sbjct: 195 EMVVLVTLETKVGEEEGMMNFCIPYITIEPIISKLSSQFWFSSVRRSSTTQYMGVLKEKL 254

Query: 236 YQLNVNIDTRINLKKTTLKDVVTLKIGQVIPF-LHREKTCAILSANGKEIYSCELGRVGK 294
             +++++   +   K  ++DV+ L+ G V+     R      LS   ++ + C+ G VG 
Sbjct: 255 STVDMDVVAEVGSLKLPVRDVLNLRAGDVVRLTDTRVGHPFTLSVGSRKKFWCQPGVVGN 314

Query: 295 NYTIRITDRINF-DQKSLKNF 314
              ++I ++I   +Q   +  
Sbjct: 315 KVAVQILEKIEDINQDEFEEL 335


>gi|323705435|ref|ZP_08117010.1| flagellar motor switch protein FliM [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323535337|gb|EGB25113.1| flagellar motor switch protein FliM [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 329

 Score =  231 bits (589), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 46/310 (14%), Positives = 96/310 (30%), Gaps = 11/310 (3%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           +          P       +        K   +    +     +         +   V +
Sbjct: 27  IEENQQEAKVKPYDFRRPNKF------SKEQLRTLQMIFENMSRSFTTFLSGYLRTLVQV 80

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S  S +   +    +S       +            + C+NN   T+++ +LG    +  
Sbjct: 81  SIVSVEQITYYEFSNSLTNPVFIAVIDAKPLEGPIILECNNNTTFTIIDKILGGIGAS-- 138

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           +   R  + +E  L  R   Q+  ++    S   E +P +         +       NE 
Sbjct: 139 ETVQRDYTEIEMGLLTRITTQLLPLIKDAWSNVIELNPEITRIET--NSQFTQVISPNET 196

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDL-IDPFARKTYQLN 239
           V    M++ I +        +P  T++    +  +    S  + +   I     K     
Sbjct: 197 VALCTMSLKINDNEGLINFCLPHITIVPILPLLTTKTWFSNAEKQTYDIGIIKDKISNTY 256

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           V +   I   K T++D+++   G VI    R K    +  N +  +    G   K Y ++
Sbjct: 257 VPLKVVIGTSKITVRDLLSFDKGDVIEINKRYKDPIEVKINDETKFLGVPGIRNKKYCVQ 316

Query: 300 ITDRINFDQK 309
           IT+  +    
Sbjct: 317 ITEICSEGDD 326


>gi|150388448|ref|YP_001318497.1| flagellar motor switch protein FliM [Alkaliphilus metalliredigens
           QYMF]
 gi|149948310|gb|ABR46838.1| flagellar motor switch protein FliM [Alkaliphilus metalliredigens
           QYMF]
          Length = 331

 Score =  231 bits (589), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 44/294 (14%), Positives = 94/294 (31%), Gaps = 7/294 (2%)

Query: 20  RLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKE 79
                    K   +    +   +   L       +   V     + +   +    +S   
Sbjct: 40  DFKSPKKLAKDQLRTLQIIHDNFSGMLNTFLAGYLRTYVQAEVLTVEELSYYEFSNSVVN 99

Query: 80  NFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTI 139
             V S  + +       +  S ++  TL+E +LG   +   ++  R  + +E  L K  +
Sbjct: 100 PAVLSIINFTPLEGQIIVDISPSISFTLIERILGGMGKETEEI--RPFTEIETTLIKNLM 157

Query: 140 AQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVL 199
            Q+  ++        E  P L+        +       N+ V  I +N+ I +V     +
Sbjct: 158 RQVINLMIDPWENVIELQPKLDKIET--NSQFAQIVSPNDTVALITLNLKIGDVEGMMNI 215

Query: 200 IIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDV 256
            IP   +              N S+  +E       ++  +  V+I  ++     T+KD 
Sbjct: 216 CIPHIVIEPILDKLSTKLWFSNSSKPVTERDKKALQKRVEKSAVDITAQLGSTCVTVKDF 275

Query: 257 VTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
           + L++G VI   +       +    K  Y    G       +++T       + 
Sbjct: 276 LELQMGDVIMLDNPVDKELQILVGDKIRYRGLPGTSKNKLAVKVTGIDQKGDEI 329


>gi|197285496|ref|YP_002151368.1| flagellar motor switch protein FliM [Proteus mirabilis HI4320]
 gi|227355987|ref|ZP_03840379.1| flagellar motor switch protein [Proteus mirabilis ATCC 29906]
 gi|194682983|emb|CAR43414.1| flagellar motor switch protein [Proteus mirabilis HI4320]
 gi|227163975|gb|EEI48877.1| flagellar motor switch protein [Proteus mirabilis ATCC 29906]
          Length = 343

 Score =  231 bits (589), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 40/308 (12%), Positives = 88/308 (28%), Gaps = 10/308 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
             +  P  P    R+  +             +   + +         +    DI+    +
Sbjct: 40  EPDIQPYDPNTQRRVVRERLQS------LEIINERFARQFRMGLFNMLRRSPDITVGGIK 93

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
              +     +       +   L             NLV   ++NL G        +  R 
Sbjct: 94  IHPYHDFARNLPVPTNLNLVHLKPLRGTALFTFEPNLVYIAVDNLFGGDGRFPIPVEGRE 153

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E+++  + +            +  +          +     N     N+ V T   
Sbjct: 154 FTNTEQRIINKMLKLALDAYRDAWDSIFKIQVEYVRSE-MQVKFTNITSSPNDIVVTTPF 212

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSSQNKS-ENQSEDLIDPFARKTYQLNVNIDTR 245
            + I ++   F + IP   +       ++   ++   +    +D    +     + +   
Sbjct: 213 QVEIGSMVGEFSICIPFAMIEPLRERLINPPIENLRQEDSVWLDSLVNQVKHSELELVAN 272

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
                  L  V+TLK G V+P         I   +G  + + + G V   Y +R+   IN
Sbjct: 273 FTDIPLRLSKVLTLKKGDVLPIDKP--ERLIAHVDGVPVLTSQYGTVHGQYALRVEHLIN 330

Query: 306 FDQKSLKN 313
               +L  
Sbjct: 331 PVLNALDE 338


>gi|320538201|ref|ZP_08038096.1| flagellar motor switch protein FliM [Treponema phagedenis F0421]
 gi|320145018|gb|EFW36739.1| flagellar motor switch protein FliM [Treponema phagedenis F0421]
          Length = 344

 Score =  231 bits (589), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 39/282 (13%), Positives = 99/282 (35%), Gaps = 8/282 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +  S +   + +        ++   V +   S     +   I S       +  +
Sbjct: 48  SKEQMRTLSLMHETFARLTTTSLSAQLRSMVHVHVASVDQLTYEEFIRSIPTPTTIAVIN 107

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +     N  +    ++  ++++ L G + +       R L+ +E  + +  I +I A + 
Sbjct: 108 MDPLKGNAILEIDPSVTFSIIDRLFGGTGQGTKV--QRDLTDIENSVMEGVIVRILANVR 165

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  +   +  P L         +       +E V  + +   + +        IP  T+ 
Sbjct: 166 EAWTQVIDLRPRLGQIET--NPQFTQIVPPSEMVVLVTLETKVGDEEGMMNFCIPYITIE 223

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                        +   + +   +     K   +++++   +     +++DV++L+IG V
Sbjct: 224 PIISKLSSQFWFSSVRRSSTTQYMGVLKDKLSTVDMDVVAEVGFLNLSVRDVLSLRIGDV 283

Query: 265 IPF-LHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           I            LS   ++ + C+ G VGK   ++I ++I 
Sbjct: 284 IRLKDTHVGDPFTLSVGNRKKFLCQPGVVGKKVAVQILNKIE 325


>gi|126665008|ref|ZP_01735991.1| flagellar motor switch protein M [Marinobacter sp. ELB17]
 gi|126630378|gb|EBA00993.1| flagellar motor switch protein M [Marinobacter sp. ELB17]
          Length = 331

 Score =  231 bits (588), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 40/296 (13%), Positives = 93/296 (31%), Gaps = 12/296 (4%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
                      R+                +   + ++        +    D+S +  Q  
Sbjct: 32  GVKSYDLASQDRIVRG------RMPTLEMINERFARYTRISLFNLLRRTADVSTSGVQIM 85

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           KF   +H+       +   +              LV  L++N  G       ++  R  +
Sbjct: 86  KFGEYVHTLYVPTSLNLCKIRPLRGTSLFVLDAKLVFKLVDNFFGGQGR-HAKIEGREFT 144

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E ++ +  + Q+   + +   T  + +   E                +E V     ++
Sbjct: 145 PTENRIVQMMLNQVFHDMQEAWQTVLKVN--FEYLSSEVNPSMANIVSPSEVVVVSTFHI 202

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            ++         +P   +     +  +  Q+  ++  E  +         ++V +++ I 
Sbjct: 203 ELDGGGGELHFALPYSMIEPIRDVLDAGVQSDIDDTDERWVSALQEDIKTVSVAVNSTIC 262

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
            +  +L++V   K G +IP          ++ANG  IY+  LG       +RI  R
Sbjct: 263 RRHISLREVAKFKAGDIIPIEMA--EHLTVTANGIPIYTATLGTRDDKLALRIHGR 316


>gi|23099022|ref|NP_692488.1| flagellar motor switch protein FliM [Oceanobacillus iheyensis
           HTE831]
 gi|22777250|dbj|BAC13523.1| flagellar motor switch protein [Oceanobacillus iheyensis HTE831]
          Length = 330

 Score =  231 bits (588), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 52/287 (18%), Positives = 100/287 (34%), Gaps = 9/287 (3%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +  S +   Y + L   F  ++   V+IS TS     +   I S  +  + +   
Sbjct: 48  SKDQIRSISRIHENYARMLTTFFATQLRSYVNISVTSVDQVPYEEFIRSIPKKTILNLYG 107

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +     N  +  + N+   LL+ LLG    TI +  N  L+ +EK L  +   +    L 
Sbjct: 108 MEPLDGNLIMEINPNIAYALLDRLLGGKGSTITKDGN--LTEIEKTLFMQMFEKAEDALR 165

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
              S+  E  P LE     +  +       NE V  +++   I        + IP   L 
Sbjct: 166 DAWSSVVEIEPVLE--EFEENPQFMQKIAPNETVVVVSLTTVIGETTGMINICIPHVILE 223

Query: 208 KTTLISLS--SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVI 265
                         + N+ E       +   +  V +   +     ++ D +  + G +I
Sbjct: 224 PIIPKLSVHYWMQSNSNKDEQAYGKMQQNLKKTEVELKAILGATTISIHDFLNFQQGDII 283

Query: 266 PFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI---NFDQK 309
                     +LS   +  +  + G+     +++I + I   N D +
Sbjct: 284 SLDQPIDAPLLLSIYDQPKFFAQPGKFKNKMSVQILEEIKGVNEDDE 330


>gi|27380936|ref|NP_772465.1| flagellar motor switch protein FliM [Bradyrhizobium japonicum USDA
           110]
 gi|27354102|dbj|BAC51090.1| flagellar motor switch protein [Bradyrhizobium japonicum USDA 110]
          Length = 400

 Score =  231 bits (588), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 46/295 (15%), Positives = 102/295 (34%), Gaps = 4/295 (1%)

Query: 14  HPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHI 73
               +  +            +   +     + L    +     +V++S     S +F   
Sbjct: 87  DHSGIRAIIDSAMVSYERLPMLEIVFDRLVRLLTTSLRNFTSDNVEVSLDRITSVRFGDY 146

Query: 74  IHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGAS-HETIPQLYNRSLSTVEK 132
           ++S     V S      W +       +NL+ ++++ LLG     +  ++  R  +T+E 
Sbjct: 147 MNSIPLPAVLSVFKAEEWDNFGMATVDSNLIYSMIDVLLGGRRGTSQLRIEGRPYTTIET 206

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
           +L KR +  + A   Q        +  ++        +             + + + +E+
Sbjct: 207 ELVKRLVEVVLADAEQAFRPLSPVTFTIDRLET--NPRFAAISRPANAAILVRLRIDMED 264

Query: 193 VASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
              +  L++P  T+     + L     +   +       FA +  Q  +++D  +     
Sbjct: 265 RGGNIELLLPYATIEPIRGVLLQMFMGEKFGRDPVWEGHFATEIGQAEISVDAVLYEADI 324

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
            LK ++ LK+G  +P   R      +      I    +GRVG    IR+T  +  
Sbjct: 325 PLKQLMRLKVGDTLPLDMRADANVTVRCGDVTITEGRMGRVGDRVAIRVTKPLRK 379


>gi|283850275|ref|ZP_06367564.1| flagellar motor switch protein FliM [Desulfovibrio sp. FW1012B]
 gi|283574301|gb|EFC22272.1| flagellar motor switch protein FliM [Desulfovibrio sp. FW1012B]
          Length = 326

 Score =  231 bits (588), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 44/306 (14%), Positives = 95/306 (31%), Gaps = 7/306 (2%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTI---EKISSSLGYLYKKFLPKIFKEKMDLD 57
           + G  I   T  L       +       + I     +   +   + +         M   
Sbjct: 17  LSGGEIEAETDILEDDSGVVVFDLSNQDRIIRGRMPVLEIINDRFARLASNAMANAMRKR 76

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
            D++  S    KF   + S       +   L     N  +   + LV  ++E+  G +  
Sbjct: 77  ADVNPISIDMSKFGDFMRSLPVPTSINIFKLDPLRGNAILVVDSRLVFAMVESFFGGAGS 136

Query: 118 TIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLS 177
              ++  R  + +E+ +  R +      + +      E   ++E        +       
Sbjct: 137 QP-KIEGRDFTPIEQAIINRVVRIALENMEESWQPVHEV--HIELVRSEVNPQFAAIVPP 193

Query: 178 NEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTY 236
           ++ V  +   + +EN   S ++ +P  T+         S Q +        I  F  +  
Sbjct: 194 SDVVVVVTFEVELENAIGSLIVCLPYATIEPIRSKLYASFQTERLEVDHAWIARFKERLM 253

Query: 237 QLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNY 296
           +  V +  R    + T + +++LK G +I   +           G   +    G V  N 
Sbjct: 254 ETPVELLVRFGRSQITGRQLLSLKPGDIIMLDNDVDALLDAEIQGVRKFRGIPGLVKSNK 313

Query: 297 TIRITD 302
             +I  
Sbjct: 314 AFQIVK 319


>gi|218778863|ref|YP_002430181.1| flagellar motor switch protein FliM [Desulfatibacillum alkenivorans
           AK-01]
 gi|218760247|gb|ACL02713.1| Flagellar motor switch protein FliM [Desulfatibacillum alkenivorans
           AK-01]
          Length = 325

 Score =  231 bits (588), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 38/296 (12%), Positives = 78/296 (26%), Gaps = 9/296 (3%)

Query: 13  LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSH 72
                  R+                +     +         M    DIS       KFS 
Sbjct: 38  YDFANQDRVIRG------RMPTLEVVNKRLARMFSSSLSATMRGAADISVRDTNMIKFSE 91

Query: 73  IIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEK 132
              S           +     +  +     LV  L+E   G +     ++  R  + +E 
Sbjct: 92  FQSSIPVPANIHMFKMEPLRGHALLVVDTPLVFQLIEYYFGGTPGGALKVEGRDFTRIEN 151

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
           ++ ++ +       +   +      P           +     L  + +  +   + +E 
Sbjct: 152 QIIRKVVGIFLKDFDDAWAPIFPIKPVYVRSEM--NPQFAVIGLPIDLMIIVRFQVELET 209

Query: 193 VASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
                 L IP   L           Q+ +             +  ++ V I   +     
Sbjct: 210 TEGGMTLAIPYSMLEPIRDKLYSGFQSDNLEADASWRKRVESQVQEVLVEICVELGTAVI 269

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
           T + +++L+ G VI               G    + + G V  +  I +  RI  D
Sbjct: 270 TAERLMSLRKGDVISLDQFADEPLTAKIQGVPKIAGKAGVVKGSKAIAVEGRITMD 325


>gi|42528263|ref|NP_973361.1| flagellar motor switch protein FliM [Treponema denticola ATCC
           35405]
 gi|4426948|gb|AAD20622.1| flagellar switch protein FliM [Treponema denticola]
 gi|41819533|gb|AAS13280.1| flagellar motor switch protein FliM [Treponema denticola ATCC
           35405]
 gi|325474547|gb|EGC77733.1| flagellar switch protein FliM [Treponema denticola F0402]
          Length = 344

 Score =  231 bits (588), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 35/282 (12%), Positives = 95/282 (33%), Gaps = 8/282 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +    +   + +        ++     +   + +   +   I S       +  +
Sbjct: 48  SKEQMRTVQMMHETFARLTTTSLSAQLRSMAHVHVATVEQLTYEEFIRSIPTPTTLAIIN 107

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +    ++  +    ++  ++++ L G   +       R L+ +E  + +  I +I A + 
Sbjct: 108 MDPLRASALLEIDPSVTFSIIDRLFGGKGQGSKV--QRELTEIESSVMEGVIVRILANMR 165

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  +T  +  P L +       +       +E V  + +   +        + +P  TL 
Sbjct: 166 EAWTTVVDLRPRLGNIDT--NPQFVQIVTPSEMVLLVTLETKVGEEEGMMNICLPYITLE 223

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                        +     +         K   + V++   +     +++DV+ L+ G V
Sbjct: 224 PIISKLSTQFWFSSVRRASTGQYAAAIKDKLSTVEVDMVAEVGSLDVSIRDVLNLRAGDV 283

Query: 265 IPF-LHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           +     R      L+   +  +SC+ G  GK   ++I ++I 
Sbjct: 284 VRLPNVRVGDPFKLTVGSRPKFSCQPGVKGKKLAVQILEKIE 325


>gi|325109075|ref|YP_004270143.1| flagellar motor switch protein FliM [Planctomyces brasiliensis DSM
           5305]
 gi|324969343|gb|ADY60121.1| flagellar motor switch protein FliM [Planctomyces brasiliensis DSM
           5305]
          Length = 368

 Score =  230 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 42/293 (14%), Positives = 97/293 (33%), Gaps = 5/293 (1%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +   +L   + +         +   +++   S     +   + S +    F+   
Sbjct: 54  SKEQMRAFQALHEGFSREFGASLSGMLRSIIEVKLISVDQLTYGEFVFSLENPTCFNLLF 113

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
               + +  +  + +++  +++ LLG    +     +R L+ +E +L  R        L 
Sbjct: 114 SDKLNGHLILDLNPSIIYPIVDRLLGGGKSSTQSYPSRPLTEIELRLVSRITKSAITALE 173

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
                  E    +         +       NE +  I+  +++  +     L IP  T+ 
Sbjct: 174 NSWINISELQLRVTQIE--SNPQLVQIVPPNEVIVLISFEISMGEMRGIMNLCIPFNTIE 231

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
             T        S    +  S               VN+   +     T  +++ L +G V
Sbjct: 232 PLTGKLSSDTWSAYTKQQISPQQKAQLEVGIGAAKVNLVAALAETHLTASELMNLDVGDV 291

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLHK 317
           I      K    +   GK  +S ++G++  +  I+I D++   +  +   L K
Sbjct: 292 ILTERDVKKGLTIFVEGKPTFSADVGQIKGHKAIQIRDKLPKTRDIVDQHLQK 344


>gi|306820127|ref|ZP_07453775.1| flagellar motor switch protein FliM [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
 gi|304551905|gb|EFM39848.1| flagellar motor switch protein FliM [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
          Length = 332

 Score =  230 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 47/293 (16%), Positives = 91/293 (31%), Gaps = 7/293 (2%)

Query: 20  RLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKE 79
                    K   K  S +   Y + L       + +  +I  +S +   +    +S   
Sbjct: 40  DFKSPKKLAKDQLKTLSIIHDNYARVLSTYLSGYLRVITEIEVSSVEELSYYEFNNSISN 99

Query: 80  NFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTI 139
             + +  +         +  S+ L  T+++ +LG       +  NR  S +E  +  + +
Sbjct: 100 PAMIAVVNFEPLPGQIILETSSKLAYTMIDRILGGDGLYDEE--NRDFSEIELIILSKLV 157

Query: 140 AQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVL 199
             I    ++      E SP LE        +       NE V  I +++ I  V     +
Sbjct: 158 RNIVGYFSEAWENVIELSPYLEKIE--PNSQFAQIVSPNETVALITLSVKIGEVEGLMNI 215

Query: 200 IIPQETLLKTTLISLS---SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDV 256
            +P   L        +        +   E           +  +     I     T++D 
Sbjct: 216 CLPNIVLEPIIQNLSTNFLFSGIKKEFDEKGKKNLESNVKKAKLEAVAIIGDTFITVEDF 275

Query: 257 VTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
           + +++G VI    +      L   GK  Y    G   KN   +I   I    +
Sbjct: 276 IFMQVGDVIKLNKKVDEELELKVAGKTKYLGYPGTYKKNMAFKINKVIEKGDE 328


>gi|309388831|gb|ADO76711.1| flagellar motor switch protein FliM [Halanaerobium praevalens DSM
           2228]
          Length = 335

 Score =  230 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 45/315 (14%), Positives = 100/315 (31%), Gaps = 17/315 (5%)

Query: 2   RGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDIS 61
           + QS  K           +L       K   +    +     +        K+   V+  
Sbjct: 28  KEQSEEKEVKDYDFRRPDKL------SKEQMRTLQMIHENLSRLFTTTLSTKLRSMVNFE 81

Query: 62  YTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQ 121
             S +   +S  IHS  E  +   + L      F    +  +   +++ L G     I  
Sbjct: 82  VASIEQLSYSEFIHSLPEPTIIGISKLEPLEGQFIFEINPEVGFAVIDRLFGGLGNPIDD 141

Query: 122 LYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFV 181
           +  RS + +E+ + KR +  +    ++      +  P L         +       ++  
Sbjct: 142 I--RSFTDIEQVVIKRVMNWLLGDFSEAWENISKLKPKL--LELESNPQFTQIVPDSDMT 197

Query: 182 TTINMNMTIENVASSFVLIIPQETLLKTTLIS---LSSQNKSENQSEDLIDPFARKTYQL 238
             I ++  I        + +P   L              +  E Q+ + I    ++  + 
Sbjct: 198 IIITLSARIGGSEGLMNICLPYIMLEPIVSNLNAQYWFSSTREKQTPEHIAKLRKRLNEA 257

Query: 239 NVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTI 298
            V +D  +   + T++D + L+ G V+    + +  A L       Y   +G    +  I
Sbjct: 258 LVEVDAVLGSTEITVEDFLYLQPGDVVRLDKKVEENAELKIGRSRKYEAVVGNKNNHKAI 317

Query: 299 RI----TDRINFDQK 309
           +I     + +   + 
Sbjct: 318 QIIGVAENLLEESED 332


>gi|283781536|ref|YP_003372291.1| flagellar motor switch protein FliM [Pirellula staleyi DSM 6068]
 gi|283439989|gb|ADB18431.1| flagellar motor switch protein FliM [Pirellula staleyi DSM 6068]
          Length = 362

 Score =  230 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 44/302 (14%), Positives = 99/302 (32%), Gaps = 12/302 (3%)

Query: 6   IHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSC 65
             +  +P       R+       K   +   SL   + +         +   V++  TS 
Sbjct: 45  TREKVTPYDFKRPERVG------KEQMRALQSLHEGFGRNFGAALSALLRSIVEVKLTSV 98

Query: 66  QSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNR 125
               +S  + S +    F+         N  +  + +++  +++ LLG   +    +  R
Sbjct: 99  DQLTYSEFVFSLENPTCFNLLRAEPLEGNLILDINPSILYPIIDRLLGG-GKEAGPVARR 157

Query: 126 SLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTIN 185
            L+ +E +L  R        L            +++        +       NE V  I+
Sbjct: 158 PLTEIELRLVSRITHLFLQELKHAWEGVLPLKLSVDRVE--SNPQLVQIVPPNEVVVLIS 215

Query: 186 MNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNI 242
             +T+ +V     L IP  ++ +                  +   I   +++  Q  V +
Sbjct: 216 FELTLNDVRGMINLCIPFNSIERIGSKLTSNNWVAYGKGGATPQSIAQISKRLDQSKVEL 275

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
              +     T  D++ L++G +I      +T   ++  G   +    G +  +  +RI  
Sbjct: 276 VVTLAETTITTGDMIGLRVGDIITTDKDIRTPLEIAVQGMAKFQASCGALKGHKAVRIEQ 335

Query: 303 RI 304
            I
Sbjct: 336 SI 337


>gi|150390473|ref|YP_001320522.1| flagellar motor switch protein FliM [Alkaliphilus metalliredigens
           QYMF]
 gi|149950335|gb|ABR48863.1| flagellar motor switch protein FliM [Alkaliphilus metalliredigens
           QYMF]
          Length = 331

 Score =  230 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 45/294 (15%), Positives = 96/294 (32%), Gaps = 7/294 (2%)

Query: 20  RLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKE 79
                    K   +    +   + + L       +   V     + +   +    +S   
Sbjct: 40  DFKSPKKLAKDQLRTLQIIHDNFSRMLNTFLAGYLRTYVQADVLTVEELSYYEFSNSVVN 99

Query: 80  NFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTI 139
             V S  + +       +  S ++  TL+E +LG   +   ++  R  + +E  L K+ +
Sbjct: 100 PAVLSIINFTPLEGQIIVDISPSISFTLIERILGGVGKGTEEV--RPFTEIETTLIKKLM 157

Query: 140 AQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVL 199
            Q+  ++        E  P L+        +       N+ V  + +N+ I +V     +
Sbjct: 158 RQVINLMVDPWENVIELQPKLDKIET--NSQFAQIVSPNDTVALVTLNLKIGDVEGMMNI 215

Query: 200 IIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDV 256
            IP   +              N S+  +E       ++  +  VNI  ++     T+KD 
Sbjct: 216 CIPHIVIEPILDKLSTKLWFSNISKPVTESDKKALQKRVEKSTVNITAQLGGTCVTVKDF 275

Query: 257 VTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
           + L+IG VI   +       +    K  Y    G       +++T       + 
Sbjct: 276 LELQIGDVIMLDNPVNKELQILVGDKIRYRGLPGTSKNKLAVKVTGIDEKGDEI 329


>gi|261855321|ref|YP_003262604.1| flagellar motor switch protein FliM [Halothiobacillus neapolitanus
           c2]
 gi|261835790|gb|ACX95557.1| flagellar motor switch protein FliM [Halothiobacillus neapolitanus
           c2]
          Length = 347

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 42/303 (13%), Positives = 99/303 (32%), Gaps = 6/303 (1%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           +  +            LT +    +        L   + +         +   VDIS   
Sbjct: 25  ATEEGVGDPSEARSYDLTTQERIVRGRLPTLEMLNERFARNFRIRLVSMLRRTVDISIEG 84

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +  K+S   H+       +   +            + LV  L++N  G       ++  
Sbjct: 85  VRMMKYSEYSHALYVPTSLTLVHVRPLKGTGLFMMESQLVFKLVDNFFGGFG-MHAKIEG 143

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  +  E ++  R + Q    + +  +     +  ++        +        E V   
Sbjct: 144 RDFTPTELRVITRVLEQAIDEVQRSWTPVYPVN--IQTVSHEMNPQLANIVSGTEVVVVN 201

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISL-SSQNKSENQSEDLIDPFARKTYQLNVNID 243
           +  + +E     F +++P   +     +     Q       E       R+  + ++ + 
Sbjct: 202 SFRIEVEGGGGKFDIVLPYSMIEPIRDLLDGGMQGDRLEVDERWTQALKRELGRADIELV 261

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
            ++   + +L D+  +++G V+PF        +L+A G  +Y  +LG    N ++RI   
Sbjct: 262 AQLGEMRMSLADIAHMEVGDVLPFEMP--EQVVLTAQGLPLYQGKLGVHRGNKSVRIQSP 319

Query: 304 INF 306
           +  
Sbjct: 320 VKE 322


>gi|146282919|ref|YP_001173072.1| flagellar motor switch protein FliM [Pseudomonas stutzeri A1501]
 gi|145571124|gb|ABP80230.1| flagellar motor switch protein FliM [Pseudomonas stutzeri A1501]
          Length = 342

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 40/275 (14%), Positives = 93/275 (33%), Gaps = 6/275 (2%)

Query: 31  IEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSS 90
                  +   + ++        +    D+S    Q  KF   +HS       +   +  
Sbjct: 69  RMPTLEMINERFARYTRISMFNLLRRSADVSVGGVQVMKFGEYVHSLYVPTSLNLVKMKP 128

Query: 91  WSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCI 150
                       LV  L++N  G       ++  R  +  E ++ +  + Q  A L +  
Sbjct: 129 LRGTALFILDAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLDQAFADLKEAW 187

Query: 151 STTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTT 210
               + +   E                +E V     ++ +++      + +P   +    
Sbjct: 188 HAVLDVN--FEYVNSEVNPALANIVSPSEVVVVSTFHIELDSGGGDLHVTMPYSMIEPIR 245

Query: 211 LISLS-SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLH 269
            +  +  Q+   +Q E  +         +NV +   +  ++  L+D++ ++ G VIP   
Sbjct: 246 EMLDAGFQSDVSDQDERWVKALREDILDVNVPLGATVVRRQLKLRDILNMQPGDVIPVEM 305

Query: 270 REKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
            E    I+ ANG   +  +LG    N  +++ + +
Sbjct: 306 PED--MIMRANGMPAFKVKLGAHKGNLALQVLEPV 338


>gi|119476310|ref|ZP_01616661.1| flagellar motor switch protein M [marine gamma proteobacterium
           HTCC2143]
 gi|119450174|gb|EAW31409.1| flagellar motor switch protein M [marine gamma proteobacterium
           HTCC2143]
          Length = 320

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 42/278 (15%), Positives = 93/278 (33%), Gaps = 6/278 (2%)

Query: 31  IEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSS 90
                  +   + ++        +    D++    Q  KF   +H+       +   L  
Sbjct: 48  RMPTLEMVNERFSRYTRISLFNLLRRSADVAVGGIQVQKFGEYVHTLFVPTSLNMIKLRP 107

Query: 91  WSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCI 150
                 I     LV  L++N  G       ++  R  +  E ++ +  + +  A L +  
Sbjct: 108 LRGTGLIVLDAKLVFKLVDNYFGGDGR-HAKIEGREFTPTELRVVEMVLQEAFADLKEAW 166

Query: 151 STTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTT 210
                      +               +E V     ++ ++       + +P   +    
Sbjct: 167 RAVLPVEFEFVNAEV--NPSMANIVSPSEVVVVSTFHIELDGGGGDMHITLPYAMIEPIR 224

Query: 211 LISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLH 269
               S  Q   ++  +  I           VN+  ++  K+  L+D++ LK G VIP   
Sbjct: 225 ETLDSGLQTDVDDIDDRWIKSLREDILNATVNMGCKVAEKEVPLRDIIDLKEGDVIPMEM 284

Query: 270 REKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
                 ++SANG  +   +LG+   N  +++ ++IN +
Sbjct: 285 PGD--LVISANGIPMMLAKLGQSKGNLALQVVEKINNE 320


>gi|298530627|ref|ZP_07018029.1| flagellar motor switch protein FliM [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298510001|gb|EFI33905.1| flagellar motor switch protein FliM [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 325

 Score =  229 bits (585), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 37/298 (12%), Positives = 91/298 (30%), Gaps = 10/298 (3%)

Query: 6   IHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSC 65
                         R+            +   +   + +         M   VD +  S 
Sbjct: 31  EDSGVVTFDLSNQDRIIRG------RMPVLEIINDRFARLATNTMANAMRKRVDFNPISI 84

Query: 66  QSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNR 125
              KF   + S       +   +     N  +     LV  L+EN  G +     ++  R
Sbjct: 85  DMSKFGDFMRSLPVPTSINIFKIDPLRGNALMIIDTRLVFALVENFFGGTGSQP-KIEGR 143

Query: 126 SLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTIN 185
             + +E+ +  +    + + L        E +  +E        +  T    ++ V  + 
Sbjct: 144 DFTPIEQSIVVKVSKMLLSNLEDAWRPVHEVN--IELTRSEVNPQFATIVPPSDVVVVVT 201

Query: 186 MNMTIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDT 244
             + +EN   S V+ +P  T+         S Q++        +  F  +  ++ V+ + 
Sbjct: 202 FEVELENAIGSMVVCLPYATIEPIRSKLYASYQSERLEVDHAWLSRFKERLLEIPVDFNV 261

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
            +   + T + ++ ++ G ++     ++        G   +    G    N   ++  
Sbjct: 262 TMGKTQITGRQLLNMEAGDILMLDTDQEDLLKAYVQGVLKFHGVPGFTKGNKAFQVVQ 319


>gi|154250207|ref|YP_001411032.1| flagellar motor switch protein FliM [Fervidobacterium nodosum
           Rt17-B1]
 gi|154154143|gb|ABS61375.1| flagellar motor switch protein FliM [Fervidobacterium nodosum
           Rt17-B1]
          Length = 329

 Score =  229 bits (585), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 43/293 (14%), Positives = 101/293 (34%), Gaps = 7/293 (2%)

Query: 20  RLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKE 79
                    K   +    +   + + +      K+     ++        +   + S   
Sbjct: 40  DFLRPQKFSKEQIRTVQMIHENFARSVSTYLSGKLRSFTSVNVVGIDQLTYDEYMKSIGN 99

Query: 80  NFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTI 139
               +  +   +  +  +  +  +   +L+ LLG   E I     R  + +E  + K+ I
Sbjct: 100 PSFITIFTAREFVGSSILNINLEIFYGILDVLLGGPGEVID--AKRVPTEIEIGIIKKEI 157

Query: 140 AQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVL 199
             I   L+Q  ++     P +E        +      SNE V  +   +    +     +
Sbjct: 158 VNILTSLSQAWASVHPFIPVVE--STETNPQFVQVVPSNEMVLAVTFFVNFGKIEGYMSI 215

Query: 200 IIPQETLLKTTLIS---LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDV 256
             P   +             + K +  +++L++       +  +++  +I   K TL ++
Sbjct: 216 CWPSSVIEPIGEKLTTQSWFKIKQKEVTQELVENLKLNIKKAKLDVIAKIGETKLTLGEI 275

Query: 257 VTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
           +TL++G VI           +  NGK  +  + G+   NY ++IT  I   ++
Sbjct: 276 LTLEVGDVIRLREHYDEPIKIEVNGKTKFLGKPGQFKGNYAVKITKVIEEGEE 328


>gi|146307837|ref|YP_001188302.1| flagellar motor switch protein FliM [Pseudomonas mendocina ymp]
 gi|145576038|gb|ABP85570.1| flagellar motor switch protein FliM [Pseudomonas mendocina ymp]
          Length = 323

 Score =  229 bits (585), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 39/279 (13%), Positives = 93/279 (33%), Gaps = 6/279 (2%)

Query: 31  IEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSS 90
                  +   + ++        +    D++    Q  KF   +HS       +   +  
Sbjct: 50  RMPTLEMINERFARYTRISMFNLLRRSADVAVGGVQVMKFGEYVHSLYVPTSLNLVKMKP 109

Query: 91  WSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCI 150
                       LV  L++N  G       ++  R  +  E ++ +  + Q    L +  
Sbjct: 110 LRGTGLFILDAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLDQAFVDLREAW 168

Query: 151 STTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTT 210
               + +   E                +E V     ++ ++       + +P   +    
Sbjct: 169 HAVMDIN--FEYVNSEVNPALANIVSPSEVVVVSTFHIELDGGGGDLHITMPYSMIEPIR 226

Query: 211 LISLS-SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLH 269
            +  +  Q+  ++Q E  I         ++V +   +  ++  L+D++ ++ G VIP   
Sbjct: 227 EMLDAGFQSDVDDQDERWIKALREDILDVSVPLAATVARRQLKLRDILHMQPGDVIPVEL 286

Query: 270 REKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
            E    I+ ANG   +  +LG    N  +++ + I   +
Sbjct: 287 PEN--VIMRANGVPTFKVKLGAHKGNLALQVLEPIERQR 323


>gi|153954743|ref|YP_001395508.1| hypothetical protein CKL_2125 [Clostridium kluyveri DSM 555]
 gi|219855207|ref|YP_002472329.1| hypothetical protein CKR_1864 [Clostridium kluyveri NBRC 12016]
 gi|146347601|gb|EDK34137.1| FliM [Clostridium kluyveri DSM 555]
 gi|219568931|dbj|BAH06915.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 331

 Score =  229 bits (584), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 46/310 (14%), Positives = 102/310 (32%), Gaps = 13/310 (4%)

Query: 3   GQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISY 62
            +   +   P       +        K   +    +   Y + +      ++  +V +  
Sbjct: 29  QEEEQQKVKPYDFRSPQKF------SKDHIRTLELIHDNYARIISNYLTAQVRSNVKVKV 82

Query: 63  TSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQL 122
            S Q   +   IHS     + +   +   S       +   V  +++ LLG S     + 
Sbjct: 83  ESVQQITYEEFIHSVPNPTILTIFKMPPLSGTVLFEINPQFVFEIIDLLLGGSGT--GKY 140

Query: 123 YNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVT 182
             R  + ++K + K     + + L        E    +E          N     N+ + 
Sbjct: 141 KAREFTDIDKNIIKVVNEGLISNLKLAWEDVMEVETEVEGIET--NPALNQTLAPNDPIA 198

Query: 183 TINMNMTIENVASSFVLIIPQETLLKTTLIS---LSSQNKSENQSEDLIDPFARKTYQLN 239
            I+ ++ +    +   + IP  ++ K           Q+  E    +  +    +   + 
Sbjct: 199 LISFSVELGKSTTFINICIPYLSIEKVLDKLVVQYWFQDGDEEVLAESREKLRERLNIVG 258

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           +++   +   + T+ + + L IG V+    +      L    K  Y  + G +GKN  I 
Sbjct: 259 IHLTAVLGTVEVTVNEFLNLNIGDVLTLKEKTTDPVKLMLEDKIYYYGKPGIIGKNMGIE 318

Query: 300 ITDRINFDQK 309
           I D I+ D +
Sbjct: 319 ILDIIDKDVE 328


>gi|182418362|ref|ZP_02949657.1| flagellar motor switch protein FliM [Clostridium butyricum 5521]
 gi|237666950|ref|ZP_04526935.1| flagellar motor switch protein FliM [Clostridium butyricum E4 str.
           BoNT E BL5262]
 gi|182377744|gb|EDT75288.1| flagellar motor switch protein FliM [Clostridium butyricum 5521]
 gi|237658149|gb|EEP55704.1| flagellar motor switch protein FliM [Clostridium butyricum E4 str.
           BoNT E BL5262]
          Length = 332

 Score =  229 bits (584), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 42/283 (14%), Positives = 107/283 (37%), Gaps = 7/283 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +    +   Y + +      +   +V +   + +   +   IHS +   + +   
Sbjct: 48  SKEHIRTLELVHDNYARIISNYLTGQTRQNVKVKIETVEQITYEEFIHSVQNPTIITVFK 107

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +   + N     +    + +++ LLG + +   ++  +  S ++K + ++    + + L 
Sbjct: 108 MPPLAGNIIFETNPQFSLQVIDILLGGNGDR--KVEAKEFSDIDKNIMRQITTGMISNLK 165

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
               +  E  P +E          N     N+ V  I  ++ +   ++   + IP  ++ 
Sbjct: 166 LAWESILEVEPEVEGIET--NPAINQTLAPNDPVALITFSVEMNKRSTFINMCIPYLSIE 223

Query: 208 KTTLIS---LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
           K         S +N  E+   +  +      ++++V++   +     T++D + L +G V
Sbjct: 224 KILDKLVVQYSFKNDDESLKAESREKIEEGIHKVDVDVIAELGKTSLTVEDFLKLNVGDV 283

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
           I    R  +   +    +E Y  + G  GKN  + I D  + +
Sbjct: 284 IKLDTRSSSPIKVYVGNEECYCAKPGVSGKNMGVMILDITDKE 326


>gi|160880835|ref|YP_001559803.1| flagellar motor switch protein FliM [Clostridium phytofermentans
           ISDg]
 gi|160429501|gb|ABX43064.1| flagellar motor switch protein FliM [Clostridium phytofermentans
           ISDg]
          Length = 325

 Score =  229 bits (584), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 30/291 (10%), Positives = 96/291 (32%), Gaps = 7/291 (2%)

Query: 20  RLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKE 79
                    K   +    +   Y + L       +  +V +   + ++  +    ++   
Sbjct: 39  DFHRPSKFSKEHLRTLDIIFEHYGRLLSTHLPAYLRKNVQVEVINSEAVVYQEFTNALSN 98

Query: 80  NFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTI 139
             +      +    N  I  + N+   +++ +LG S   + +  +R  S +E  + +R  
Sbjct: 99  PVLLGIIDFAPLEGNIIIELAENVGYAIVDRMLGGSGNPLEK--SRDFSEIELVIIERIF 156

Query: 140 AQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVL 199
             ++ +L +  +   + +P L         +       ++  + + +N+ I N+     +
Sbjct: 157 TVMTNILAEPWANVVKLNPRLIRIET--NSQFAQIISPSDMASIVTLNIKIGNIEGMMNV 214

Query: 200 IIPQETLLKTTLIS---LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDV 256
            +P   L                 E    +  +       +  + +   +     +L ++
Sbjct: 215 CLPYACLEVIIDKLNTKYWYSTMQEKGDSNYQEFIETAISRARIPVKAVLGKSSISLNEL 274

Query: 257 VTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
           + ++ G +I    +      +     + ++   G    +Y ++I+  I  +
Sbjct: 275 INMQKGDIIKLDRKIDDELSVYVGNIKKFTALPGASSDSYAVKISTIIREE 325


>gi|15639708|ref|NP_219158.1| flagellar motor switch protein FliM [Treponema pallidum subsp.
           pallidum str. Nichols]
 gi|6225364|sp|P74927|FLIM_TREPA RecName: Full=Flagellar motor switch protein FliM
 gi|2196898|gb|AAB61256.1| flagellar switch protein [Treponema pallidum]
 gi|3323023|gb|AAC65687.1| flagellar motor switch protein (fliM) [Treponema pallidum subsp.
           pallidum str. Nichols]
 gi|291060085|gb|ADD72820.1| flagellar motor switch protein FliM [Treponema pallidum subsp.
           pallidum str. Chicago]
          Length = 344

 Score =  229 bits (584), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 41/312 (13%), Positives = 106/312 (33%), Gaps = 11/312 (3%)

Query: 2   RGQSIHKNTSPLHP---ILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDV 58
            G +  ++  P+     I L          K   +  S +   + +        ++   V
Sbjct: 19  SGDASIEDARPISDTRKITLYDFRRPDKFSKEQMRTLSLMHETFARLTTTSLSAQLRSMV 78

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
            +   S     +   I S       +  ++     N  +    ++  ++++ L G + + 
Sbjct: 79  HVHVASVDQLTYEEFIRSIPTPSTLAVITMDPLKGNAVLEVDPSITFSIIDRLFGGTGQA 138

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSN 178
                 R L+ +E  + +  I +I A + +  +   +  P L         +       +
Sbjct: 139 AKV--QRDLTDIENSVMEGVIVRILANVRESWTQVIDLRPRLGQIET--NPQFAQIVPPS 194

Query: 179 EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKT 235
           E V  + +   +          IP  T+              +   + +   +     K 
Sbjct: 195 EMVVLVTLETKVGEEEGMMNFCIPYITIEPIISKLSSQFWFSSVRRSSTTQYMGVLRDKL 254

Query: 236 YQLNVNIDTRINLKKTTLKDVVTLKIGQVIPF-LHREKTCAILSANGKEIYSCELGRVGK 294
             +++++   +   + +++D++ L++G +I           +LS   ++ + C+ G VGK
Sbjct: 255 STVDMDVVAEVGSLRLSVRDILGLRVGDIIRLHDTHVGDPFVLSIGNRKKFLCQPGVVGK 314

Query: 295 NYTIRITDRINF 306
               +I +RI  
Sbjct: 315 KIAAQILERIES 326


>gi|330502773|ref|YP_004379642.1| flagellar motor switch protein FliM [Pseudomonas mendocina NK-01]
 gi|328917059|gb|AEB57890.1| flagellar motor switch protein FliM [Pseudomonas mendocina NK-01]
          Length = 323

 Score =  229 bits (583), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 38/279 (13%), Positives = 93/279 (33%), Gaps = 6/279 (2%)

Query: 31  IEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSS 90
                  +   + ++        +    D++    Q  KF   +HS       +   +  
Sbjct: 50  RMPTLEMINERFARYTRISMFNLLRRSADVAVGGVQVMKFGEYVHSLYVPTSLNLVKMKP 109

Query: 91  WSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCI 150
                       LV  L++N  G       ++  R  +  E ++ +  + Q    L +  
Sbjct: 110 LRGTGLFILDAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLDQAFVDLREAW 168

Query: 151 STTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTT 210
               + +   E                +E V     ++ ++       + +P   +    
Sbjct: 169 HAVMDIN--FEYVNSEVNPALANIVSPSEVVVVSTFHIELDGGGGDLHITMPYSMIEPIR 226

Query: 211 LISLS-SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLH 269
            +  +  Q+  ++Q E  I         ++V +   +  ++  L+D++ ++ G VIP   
Sbjct: 227 EMLDAGFQSDVDDQDERWIKALREDILDVSVPLAATVARRQLKLRDILHMQPGDVIPVEL 286

Query: 270 REKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
            E    ++ ANG   +  +LG    N  +++ + I   +
Sbjct: 287 PEN--VVMRANGVPTFKVKLGAHKGNLALQVLEPIERQR 323


>gi|146341901|ref|YP_001206949.1| flagellar motor switch protein FliM [Bradyrhizobium sp. ORS278]
 gi|146194707|emb|CAL78732.1| Flagellar motor switch protein FliM [Bradyrhizobium sp. ORS278]
          Length = 400

 Score =  229 bits (583), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 45/295 (15%), Positives = 98/295 (33%), Gaps = 4/295 (1%)

Query: 14  HPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHI 73
               +  +            +   +     + +    +     +V++S     S +F   
Sbjct: 87  DHSGIRAIIDSAMVSYERLPMLEIVFDRLVRLMTTSLRNFTSDNVEVSLDRITSVRFGDY 146

Query: 74  IHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGAS-HETIPQLYNRSLSTVEK 132
           ++S     V S      W +       + L+ ++++ LLG     T  ++  R  +T+E 
Sbjct: 147 MNSIPLPAVLSVFKAEEWENFGLAMVDSTLIYSIIDVLLGGRRGNTQLRVEGRPYTTIET 206

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            L KR I  + A   Q           ++        +             + + + +E+
Sbjct: 207 NLVKRLIEVVLADAEQAFRPLSPVRFTIDRLET--NPRFAAISRPANAAILVKLRIDMED 264

Query: 193 VASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
              +  L++P  T+     + L     +   +       FA +  +  V +D  +     
Sbjct: 265 RGGNIELLLPYATIEPIRPVLLQMFMGEKFGRDPVWEGHFATEITRAEVAVDAVLYEADV 324

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
            LK ++ LK+G  +P   R      +      +    +GRVG    IR+T  +  
Sbjct: 325 PLKQLMRLKVGDTLPLDIRPDALVAVRCGNTMLTEGRMGRVGDRVAIRVTKNLRK 379


>gi|319944169|ref|ZP_08018445.1| flagellar motor switch protein FliM [Lautropia mirabilis ATCC
           51599]
 gi|319742464|gb|EFV94875.1| flagellar motor switch protein FliM [Lautropia mirabilis ATCC
           51599]
          Length = 349

 Score =  229 bits (583), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 40/298 (13%), Positives = 97/298 (32%), Gaps = 11/298 (3%)

Query: 12  PLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFS 71
           P       R+                +   + + L       M  + +I+++    G++S
Sbjct: 58  PYDLARQERIIRG------RMPALELIHERFARSLGLAMFTFMQRNPEITHSDPVVGRYS 111

Query: 72  HIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVE 131
             + + +     +       + +  +     LV T+++ + G +   + +   R  S  E
Sbjct: 112 DFLGTIQLPASINIMQTRPLAGSALLVLDGQLVSTIVDLMFGGTGRPMRKSEGREFSMTE 171

Query: 132 KKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIE 191
           ++L K+ I   S+   +   +                 +     +  E V +    +   
Sbjct: 172 QRLIKKLIDLSSSEYGRAWESIHPMELVFTR--SESQPQFANIAIPAEMVVSTTFTLDFN 229

Query: 192 NVASSFVLIIPQETLLKTTLISLSSQNKSENQSED-LIDPFARKTYQLNVNIDTRINLKK 250
             + +  + IP   L        SS N +  + +   +   +++     V +   +    
Sbjct: 230 GQSGTIQICIPYSVLEPIRDTLSSSLNTNSGEEKRSWLGQMSKEIKPAGVELVAELTTAT 289

Query: 251 TTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
            TL +++ L+ G VI         A+L      I++   G     Y +RI    ++  
Sbjct: 290 LTLGELMKLRTGDVIEIETGPG--AMLKIGQVPIFNGRYGEHNGRYAVRIDTVHSYTD 345


>gi|189025946|ref|YP_001933718.1| flagellar motor switch protein FliM [Treponema pallidum subsp.
           pallidum SS14]
 gi|189018521|gb|ACD71139.1| flagellar motor switch protein [Treponema pallidum subsp. pallidum
           SS14]
          Length = 344

 Score =  228 bits (582), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 41/312 (13%), Positives = 106/312 (33%), Gaps = 11/312 (3%)

Query: 2   RGQSIHKNTSPLHP---ILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDV 58
            G +  ++  P+     I L          K   +  S +   + +        ++   V
Sbjct: 19  SGDASIEDARPISDTRKIKLYDFRRPDKFSKEQMRTLSLMHETFARLTTTSLSAQLRSMV 78

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
            +   S     +   I S       +  ++     N  +    ++  ++++ L G + + 
Sbjct: 79  HVHVASVDQLTYEEFIRSIPTPSTLAVITMDPLKGNAVLEVDPSITFSIIDRLFGGTGQA 138

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSN 178
                 R L+ +E  + +  I +I A + +  +   +  P L         +       +
Sbjct: 139 AKV--QRDLTDIENSVMEGVIVRILANVRESWTQVIDLRPRLGQIET--NPQFAQIVPPS 194

Query: 179 EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKT 235
           E V  + +   +          IP  T+              +   + +   +     K 
Sbjct: 195 EMVVLVTLETKVGEEEGMMNFCIPYITIEPIISKLSSQFWFSSVRRSSTTQYMGVLRDKL 254

Query: 236 YQLNVNIDTRINLKKTTLKDVVTLKIGQVIPF-LHREKTCAILSANGKEIYSCELGRVGK 294
             +++++   +   + +++D++ L++G +I           +LS   ++ + C+ G VGK
Sbjct: 255 STVDMDVVAEVGSLRLSVRDILGLRVGDIIRLHDTHVGDPFVLSIGNRKKFLCQPGVVGK 314

Query: 295 NYTIRITDRINF 306
               +I +RI  
Sbjct: 315 KIAAQILERIES 326


>gi|90423020|ref|YP_531390.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           BisB18]
 gi|90105034|gb|ABD87071.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           BisB18]
          Length = 404

 Score =  228 bits (582), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 40/295 (13%), Positives = 101/295 (34%), Gaps = 4/295 (1%)

Query: 14  HPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHI 73
               +  +            +   +     + +    +     +V++S     S +FS  
Sbjct: 91  DHSGIRAIIDSAMVSYERLPMLEIVFDRLVRLMTTSLRNFTSDNVEVSLDRITSVRFSDY 150

Query: 74  IHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGAS-HETIPQLYNRSLSTVEK 132
           + S     V S      W +       + L+ ++++ LLG    +   ++  R  +T+E 
Sbjct: 151 MSSIPLPAVLSVFKAEEWENFGLATVDSALIYSMIDVLLGGRRGQASMRVEGRPYTTIET 210

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            L KR +  + A   Q        +  ++        +             + +++ +E+
Sbjct: 211 NLVKRLVEVVLADAEQAFRPLSPVTFKIDRLET--NPRFAAITRPANAAILVRLHIDMED 268

Query: 193 VASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
              +  L++P  T+     + +     +   +        + +  Q  +++D  +   + 
Sbjct: 269 RGGNIELLLPYATIEPIRAVLMQMFMGEKFGRDPIWEGHLSTEIAQAEISVDAVLYEAEI 328

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
            LK ++ LK+G  +P   R      +      +    +GRV     IR+T ++  
Sbjct: 329 PLKQLMRLKVGDTLPLELRADALVAVRCGNVTLTEGRMGRVADRVAIRVTKQLRK 383


>gi|66768580|ref|YP_243342.1| flagellar motor switch protein FliM [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|66573912|gb|AAY49322.1| flagellar protein [Xanthomonas campestris pv. campestris str. 8004]
          Length = 337

 Score =  228 bits (582), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 41/303 (13%), Positives = 93/303 (30%), Gaps = 18/303 (5%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           + G++   + S    I+  R+                +   + +         +    D+
Sbjct: 31  LPGEARQYDLSSQDRIIRGRM-----------PTLEMVNERFARLWRIGLFNLIRRSADL 79

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S       KF+  +HS       +            I     LV T+++N  G       
Sbjct: 80  SVRGIDLVKFNEYMHSLYVPTNLNLIRFKPLRGTGLIVFEPTLVFTVVDNFFGGDGRFHT 139

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           ++  R  +  E ++ +  + Q  A L +  +   +     E                 E+
Sbjct: 140 RIEGREFTATEMRVIQLMLKQTFADLKEAWAPVMDVD--FEYINSEINPHFANIVTPREY 197

Query: 181 VTTINMNMTIENVASSFVLIIPQ--ETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQL 238
           V     ++ +E          P   +            Q+   ++ +        +    
Sbjct: 198 VVVCRFHVELEG-GGRRDPHHPAVLDAGADPRTARRRHQSDRNDRDDSWNVMLREQLDTA 256

Query: 239 NVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTI 298
            V + + +  K+ +L+ +  LKIG ++P     +    L      +++ E G    N  +
Sbjct: 257 EVTLSSVLASKRMSLRQLTGLKIGDILPIDLPAQVP--LCVEEIPLFTGEFGVSNGNNAV 314

Query: 299 RIT 301
           +IT
Sbjct: 315 KIT 317


>gi|83312597|ref|YP_422861.1| flagellar motor switch protein FliM [Magnetospirillum magneticum
           AMB-1]
 gi|82947438|dbj|BAE52302.1| Flagellar motor switch protein fliM [Magnetospirillum magneticum
           AMB-1]
          Length = 393

 Score =  228 bits (582), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 33/291 (11%), Positives = 101/291 (34%), Gaps = 4/291 (1%)

Query: 14  HPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHI 73
               +  +            +   +     + +    +     +V++S  +  S +F   
Sbjct: 99  DKSGIQAILNSALVSYERLPMLEVVFDRLVRMMSTSMRNFTSDNVEVSLDNILSLRFGDY 158

Query: 74  IHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGAS-HETIPQLYNRSLSTVEK 132
           ++S     + +      W +   +   ++L+ ++++ LLG        ++  R  +T+E+
Sbjct: 159 LNSIPLPAMLAVFKAEEWDNFGLLTVDSSLIYSIVDVLLGGRRGTAAMRIEGRPYTTIER 218

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            L +R +  + + L+         +   +        +  T    +       + + +E+
Sbjct: 219 NLVERMVHVVLSDLSAAFDPLSPVTFRFDRLET--NPRFATISRPSNAAIVAKLRIDMED 276

Query: 193 VASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
                 L++P  TL     + L     +   +        A + +   V ++  ++ +  
Sbjct: 277 RGGRLELLLPYATLEPVRELLLQMFMGEKFGRDSIWETHLAEELWLTEVELEAVLDEQVM 336

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
            L++V+  K G          +   +      ++   +GR G++  I++ +
Sbjct: 337 NLREVLNWKPGSKFMLNATADSQIDMRCGEVAMFRGRMGRKGQHIAIQVDE 387


>gi|294500928|ref|YP_003564628.1| flagellar motor switch protein FliM [Bacillus megaterium QM B1551]
 gi|294350865|gb|ADE71194.1| flagellar motor switch protein FliM [Bacillus megaterium QM B1551]
          Length = 328

 Score =  228 bits (582), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 44/282 (15%), Positives = 103/282 (36%), Gaps = 7/282 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +  + +   Y + L  +F  ++   V +S  S     +   I S  +  + +  +
Sbjct: 49  SKDQIRSLTRIHENYARMLINVFSAQLRNVVQVSVVSVDQIPYEEFIRSVPKVTILNVIA 108

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +     +  +  + N+   +L+ LLG   E+  ++ N  L+ +E  L +  + +    + 
Sbjct: 109 VPPLEGHIIMEVNPNIAYAMLDRLLGGQGESGGEISN--LTEIETSLVRNLLEKTLDSMR 166

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  S+  E  P  E        +       NE V  I++N+ I +      L IP  TL 
Sbjct: 167 EAWSSIAEIEP--ETSEFEVNPQFLQVISPNEIVIVISLNVQIGDETGMINLCIPHVTLE 224

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                       Q+  +  +   ++    +     + +   +     +++D + L  G V
Sbjct: 225 PIVSKLSVHYWMQSSKKEPNVQEVEQLKEQINDAELQVVAELGTADISIEDFLALDAGDV 284

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
           I           +    +  +  + G+V + + ++I D +  
Sbjct: 285 IRLQTSVHNPLTIYVGEQPKFIAQPGKVSRKFAVQILDDVKR 326


>gi|296283225|ref|ZP_06861223.1| flagellar motor switch protein FliM [Citromicrobium bathyomarinum
           JL354]
          Length = 339

 Score =  228 bits (582), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 43/293 (14%), Positives = 94/293 (32%), Gaps = 4/293 (1%)

Query: 18  LARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSF 77
           L  +            +   +     +      +      +++S     S +F   ++  
Sbjct: 47  LRAVIESRVVSHARLPMLEVVCERMVRSFATSMRNLTSDAIEVSLDDIASVRFGDFMNRV 106

Query: 78  KENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGAS-HETIPQLYNRSLSTVEKKLAK 136
               + +   + +W     +    NL+  +++ LLG        ++  R+ +T+E  L  
Sbjct: 107 PLPCMIAVFKVPAWQDYGLVTIEANLIYAVVDALLGGRKGAAPRKIEGRAFTTIETTLVS 166

Query: 137 RTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASS 196
           + I  +    +         +  LE        +           +     + ++    +
Sbjct: 167 KMIELVLREFSTAFEPIAPITMELERIET--SPRFAAIAGPTNVASAATFAVDMDGRGGN 224

Query: 197 FVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKD 255
           F +++P  TL             +         D    +  +  V I T +  ++  L D
Sbjct: 225 FTILLPFATLEPVRGKLSQRFMGEKLGGDNTWRDHMRNEILRTEVEIYTVLGEREMRLAD 284

Query: 256 VVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
           V +L+IGQ IPF         +   G  +   ++GR   +  I I D I   Q
Sbjct: 285 VHSLEIGQTIPFDVTPDDPFEVCCGGVPLARAQIGRQRNHVAIGIVDTIKQGQ 337


>gi|23015785|ref|ZP_00055552.1| COG1868: Flagellar motor switch protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 395

 Score =  228 bits (582), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 33/291 (11%), Positives = 101/291 (34%), Gaps = 4/291 (1%)

Query: 14  HPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHI 73
               +  +            +   +     + +    +     +V++S  +  S +F   
Sbjct: 101 DKSGIQAILNSALVSYERLPMLEVVFDRLVRMMSTSMRNFTSDNVEVSLDNILSLRFGDY 160

Query: 74  IHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGAS-HETIPQLYNRSLSTVEK 132
           ++S     + +      W +   +   ++L+ ++++ LLG        ++  R  +T+E+
Sbjct: 161 LNSIPLPAMLAVFKAEEWDNFGLLTVDSSLIYSIVDVLLGGRRGTAAMRIEGRPYTTIER 220

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            L +R +  + + L+         +   +        +  T    +       + + +E+
Sbjct: 221 NLVERMVHVVLSDLSAAFDPLSPVTFRFDRLET--NPRFATISRPSNAAIVAKLRIDMED 278

Query: 193 VASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
                 L++P  TL     + L     +   +        A + +   V ++  ++ +  
Sbjct: 279 RGGRLELLLPYATLEPVRELLLQMFMGEKFGRDSIWETHLAEELWLTEVELEAVLDEQVM 338

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
            L++V+  K G          +   +      ++   +GR G++  I++ +
Sbjct: 339 NLREVLNWKPGSKFMLNATADSQIDMRCGEVAMFRGRMGRKGQHIAIQVDE 389


>gi|87310525|ref|ZP_01092654.1| flagellar motor switch protein fliM [Blastopirellula marina DSM
           3645]
 gi|87286746|gb|EAQ78651.1| flagellar motor switch protein fliM [Blastopirellula marina DSM
           3645]
          Length = 376

 Score =  228 bits (582), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 46/297 (15%), Positives = 100/297 (33%), Gaps = 12/297 (4%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
           +  +P       R+       K   +   S+   + +         +   V++  TS   
Sbjct: 58  EKITPYDFKRPERVG------KEQMRALQSMHEGFGRNFGAALSGLLRNIVEVKLTSVDQ 111

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSL 127
             +S  I S +    F+  + S    N  +  + +++  +++ LLG   +    +  R L
Sbjct: 112 LTYSEFIFSLENPSCFNLLTASPLEGNLILDINPSILYPIIDRLLGG-GKESSPVSRRPL 170

Query: 128 STVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMN 187
           + +E  L  R        L        +   ++         +       NE +  I+  
Sbjct: 171 TEIELTLVARITNLFLRELRIAWENVLDLQLSVVRVE--SNPQLVQIVPPNEVIVLISFE 228

Query: 188 MTIENVASSFVLIIPQETLLKTTLIS---LSSQNKSENQSEDLIDPFARKTYQLNVNIDT 244
           +TI +V     L IP  ++ +              +   SE+     + +    +V +  
Sbjct: 229 LTIGDVRGMMNLCIPFNSIERIGGKLTANTWFAYGTSEVSEESRQALSTQIDGASVEVGV 288

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
            +   K T +D++ L++G VI      +    +S NG   +    G       I++ 
Sbjct: 289 TLAETKITTEDLLELRVGDVITTPKDSREPLKVSVNGVTKFLAFPGAFKGRKAIQVD 345


>gi|224419055|ref|ZP_03657061.1| flagellar motor switch protein FliM [Helicobacter canadensis MIT
           98-5491]
 gi|253827995|ref|ZP_04870880.1| flagellar motor switch protein [Helicobacter canadensis MIT
           98-5491]
 gi|313142563|ref|ZP_07804756.1| flagellar motor switch protein FliM [Helicobacter canadensis MIT
           98-5491]
 gi|253511401|gb|EES90060.1| flagellar motor switch protein [Helicobacter canadensis MIT
           98-5491]
 gi|313131594|gb|EFR49211.1| flagellar motor switch protein FliM [Helicobacter canadensis MIT
           98-5491]
          Length = 352

 Score =  228 bits (582), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 47/292 (16%), Positives = 98/292 (33%), Gaps = 6/292 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +    +     + L       M   V+I   S     +   + S      F+  S
Sbjct: 50  SKEQLRAFRGIHDKMARSLSSQISAIMRSIVEIQLHSVDQMTYGEFLMSLPSPTSFNVFS 109

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +        +  + ++   +++ LLG   +       R  S +E  L    + Q+   L 
Sbjct: 110 MKPLDGTGVLEINPSIAFPMIDRLLGGKGDPYEST--REFSDIELNLLDTILRQMMQNLK 167

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  +   E  PN++       +        NE V  + M + I + +    L  P  +L 
Sbjct: 168 EAWAPITEIFPNVDVKESSPNV--VQIVAQNEIVIMVVMEIIIGHSSGMMNLCYPVISLE 225

Query: 208 KTTLISLSS--QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVI 265
                  S        +  +              VN+   +   K TL++++ L++G ++
Sbjct: 226 SVLSRLASRDIMLSETSSKKSRNKELQALLGGAKVNVAAILGETKLTLREILDLEVGDIM 285

Query: 266 PFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLHK 317
                     I++ +G+E +   +G      TI I + I  ++  +K  L  
Sbjct: 286 RLDRPADDTVIINVDGREKFLASIGLHRYRKTIEIKEMIKTEKDQVKEILEM 337


>gi|255523752|ref|ZP_05390718.1| flagellar motor switch protein FliM [Clostridium carboxidivorans
           P7]
 gi|296186755|ref|ZP_06855157.1| flagellar motor switch protein FliM [Clostridium carboxidivorans
           P7]
 gi|255512621|gb|EET88895.1| flagellar motor switch protein FliM [Clostridium carboxidivorans
           P7]
 gi|296048792|gb|EFG88224.1| flagellar motor switch protein FliM [Clostridium carboxidivorans
           P7]
          Length = 332

 Score =  228 bits (581), Expect = 9e-58,   Method: Composition-based stats.
 Identities = 46/310 (14%), Positives = 104/310 (33%), Gaps = 14/310 (4%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           +   +   P       +        K   +    +   Y + +      ++  +V +   
Sbjct: 30  EEEKQKVKPYDFRSPQKF------SKDHIRTLELIHDNYARIISNYLTAQVRSNVKVKIE 83

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
           S Q   +   IHS     + +   +   S +     +      +++ LLG       +  
Sbjct: 84  SVQQITYEEFIHSVPNPTILTVFKMPPLSGSVLFETNPQFSFEIIDVLLGGKGT--GKYK 141

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  + ++K +       + + L        E +  +E          N     NE V  
Sbjct: 142 AREFTDIDKNIMMVINTGLISNLKLAWDDVLEVNTEIEGLET--NPALNQTLAPNEAVAL 199

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLIS---LSSQNKSENQS-EDLIDPFARKTYQLN 239
           I  ++ +   ++   + IP  ++ K           Q+ ++    E+      ++   +N
Sbjct: 200 ITFSVEMGKSSTFINICIPYLSIEKVLDKLVVQYWFQDTNDEAILEESRVKLRQRLNIVN 259

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           +N+   +     T+ D + L +G V+    +  T   L    K     + G +GKN  ++
Sbjct: 260 MNLTAVLGTTNITVDDFLRLGVGDVLTLNDKANTPIKLMVEDKPYCYGKPGVLGKNMGVQ 319

Query: 300 ITDRINFDQK 309
           I D I+ D +
Sbjct: 320 ILDIIDKDVE 329


>gi|75675317|ref|YP_317738.1| flagellar motor switch protein FliM [Nitrobacter winogradskyi
           Nb-255]
 gi|74420187|gb|ABA04386.1| Flagellar motor switch protein FliM [Nitrobacter winogradskyi
           Nb-255]
          Length = 401

 Score =  228 bits (581), Expect = 9e-58,   Method: Composition-based stats.
 Identities = 42/295 (14%), Positives = 103/295 (34%), Gaps = 4/295 (1%)

Query: 14  HPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHI 73
               +  +            +   +     + +    +     +V++S     S +F   
Sbjct: 88  DHSGIRAIIDSAMVSYERLPMLEIVFDRLVRLMTTSLRNFTSDNVEVSLDRITSVRFGDY 147

Query: 74  IHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGAS-HETIPQLYNRSLSTVEK 132
           ++S     V S      W +       ++L+ ++++ LLG    ++  ++  R  +T+E 
Sbjct: 148 LNSIPLPAVLSVFKAEEWENFGLAMVDSSLIYSMIDVLLGGRRGQSSLRIEGRPYTTIET 207

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            L KR +  + A   Q        S +++        +             + + + +E+
Sbjct: 208 NLVKRLVEVVLADAEQAFRPLSPVSFSIDRLET--NPRFAAITRPANAAILVRLRIDMED 265

Query: 193 VASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
              +  L++P  T+     + L     +   +        A +  Q  + +D  +   + 
Sbjct: 266 RGGTIELLLPYATIEPIRNVLLQMFMGEKFGRDPIWESHLATEIAQAQIAVDAVLYEAEI 325

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
            L+ ++TLK+G  +P   R      +      +    +GRVG    IR++  +  
Sbjct: 326 PLRQLMTLKVGDTLPLEMRPDASVAVRCGSVTLTEGRMGRVGDRVAIRVSRHLRK 380


>gi|229827387|ref|ZP_04453456.1| hypothetical protein GCWU000182_02775 [Abiotrophia defectiva ATCC
           49176]
 gi|229788325|gb|EEP24439.1| hypothetical protein GCWU000182_02775 [Abiotrophia defectiva ATCC
           49176]
          Length = 326

 Score =  228 bits (581), Expect = 9e-58,   Method: Composition-based stats.
 Identities = 43/292 (14%), Positives = 89/292 (30%), Gaps = 7/292 (2%)

Query: 20  RLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKE 79
                    K   +   S+   Y + L       +   V +     ++  +    +S   
Sbjct: 39  DFARPSKFSKDHLRTLESIFEHYGRLLSANLPAYLRKTVQVEVRGSEAITYQEFQNSLSN 98

Query: 80  NFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTI 139
             + +  +L     +  +  SNNL  T+++ LLG     I +   R  S +E  + +R +
Sbjct: 99  PVLLAIMNLPPLKGSCIMEMSNNLGYTIIDRLLGGEGNPIEKT--RDFSEIEIVVLERIL 156

Query: 140 AQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVL 199
              +  L +      E +P L         +        E    I +++ I  V      
Sbjct: 157 NTCTNYLEEPWHNVVEITPTLMRIET--NAQYAQIISPQEMTALITLSIKIGTVEGFMSF 214

Query: 200 IIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDV 256
            +P   L                 E    +  +       +  + I   +     ++ D 
Sbjct: 215 CLPFTALEDVMDRLNTKFWFSALQEKDDTNYGEQIEEIIDRAQIPIRAVLGKSVVSVNDF 274

Query: 257 VTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
           V L+ G V+    +      +     + +    G     Y +RIT  I  ++
Sbjct: 275 VNLQPGDVVRLNAKVDDELDVFVGNMKKFKALPGASSGVYALRITKVIREEE 326


>gi|148256789|ref|YP_001241374.1| flagellar motor switch protein FliM [Bradyrhizobium sp. BTAi1]
 gi|146408962|gb|ABQ37468.1| Flagellar motor switch protein FliM [Bradyrhizobium sp. BTAi1]
          Length = 400

 Score =  228 bits (581), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 45/295 (15%), Positives = 98/295 (33%), Gaps = 4/295 (1%)

Query: 14  HPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHI 73
               +  +            +   +     + +    +     +V++S     S +F   
Sbjct: 87  DHSGIRAIIDSAMVSYERLPMLEIVFDRLVRLMTTSLRNFTSDNVEVSLDRITSVRFGDY 146

Query: 74  IHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGAS-HETIPQLYNRSLSTVEK 132
           ++S     V S      W +       + L+ ++++ LLG     T  ++  R  +T+E 
Sbjct: 147 MNSIPLPAVLSVFKAEEWENFGLATVDSTLIYSIIDVLLGGRRGNTQLRVEGRPYTTIET 206

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            L KR I  + +   Q           ++        +             + + + +E+
Sbjct: 207 NLVKRLIEVVLSDAEQAFRPLSPVRFTIDRLET--NPRFAAISRPANAAILVKLRIDMED 264

Query: 193 VASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
              +  L++P  T+     + L     +   +       FA +  Q  V +D  +     
Sbjct: 265 RGGNIELLLPYATIEPIRPVLLQMFMGEKFGRDPVWEGHFATEIAQAEVAVDAVLYEADV 324

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
            LK ++ LK+G  +P   R      +      +    +GRVG    IR+T  +  
Sbjct: 325 PLKQLMRLKVGDTLPLDIRPDALVAVRCGSTMLTEGRMGRVGDRVAIRVTKNLRK 379


>gi|148380702|ref|YP_001255243.1| flagellar motor switch protein FliM [Clostridium botulinum A str.
           ATCC 3502]
 gi|153934250|ref|YP_001384986.1| flagellar motor switch protein FliM [Clostridium botulinum A str.
           ATCC 19397]
 gi|153934570|ref|YP_001388456.1| flagellar motor switch protein FliM [Clostridium botulinum A str.
           Hall]
 gi|170761147|ref|YP_001788060.1| flagellar motor switch protein FliM [Clostridium botulinum A3 str.
           Loch Maree]
 gi|226950156|ref|YP_002805247.1| flagellar motor switch protein FliM [Clostridium botulinum A2 str.
           Kyoto]
 gi|148290186|emb|CAL84305.1| flagellar motor switch protein FliM [Clostridium botulinum A str.
           ATCC 3502]
 gi|152930294|gb|ABS35794.1| flagellar motor switch protein FliM [Clostridium botulinum A str.
           ATCC 19397]
 gi|152930484|gb|ABS35983.1| flagellar motor switch protein FliM [Clostridium botulinum A str.
           Hall]
 gi|169408136|gb|ACA56547.1| flagellar motor switch protein FliM [Clostridium botulinum A3 str.
           Loch Maree]
 gi|226842452|gb|ACO85118.1| flagellar motor switch protein FliM [Clostridium botulinum A2 str.
           Kyoto]
 gi|322807053|emb|CBZ04627.1| flagellar motor switch protein FliM [Clostridium botulinum H04402
           065]
          Length = 331

 Score =  227 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 43/309 (13%), Positives = 103/309 (33%), Gaps = 13/309 (4%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           +   +   P       +        K   +    +   Y + +      ++  +V +   
Sbjct: 30  EEEKQKVKPYDFKRPQKF------SKDHIRTLELIHDNYARIISNYLTAQVRSNVKVKIE 83

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
           S Q   +   IHS     + +   +   + +     +   V  +++ LLG +     ++ 
Sbjct: 84  SVQQITYEEFIHSVPNPTILTIFKMPPLNGSILFETNPQFVFQMIDVLLGGNGNGTYKM- 142

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  + ++K + K+    +   L        E    +E          N      E V  
Sbjct: 143 -REFTDIDKNIMKQINTGLITNLKLAWEDVMEVDVEIESLET--NPALNQTLAPTEPVAL 199

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLIS---LSSQNKSENQSEDLIDPFARKTYQLNV 240
           I  ++ +    +   + IP  ++ K           +   E   E        +   +++
Sbjct: 200 ITFSVEMGKSNTFINICIPYLSIEKVLEKLVVQYWFRENDEESIEQSSSKIKERINIVSM 259

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            +   +     T+++ + L +G V+    R +    L    +  Y  + G +GKN  ++I
Sbjct: 260 ELTAELGRTSVTVEEFLRLAVGDVVALDTRTEEPVHLLIEEEPGYYAKPGIIGKNIGLQI 319

Query: 301 TDRINFDQK 309
            D+I+ D +
Sbjct: 320 LDQIDKDVE 328


>gi|295706274|ref|YP_003599349.1| flagellar motor switch protein FliM [Bacillus megaterium DSM 319]
 gi|294803933|gb|ADF40999.1| flagellar motor switch protein FliM [Bacillus megaterium DSM 319]
          Length = 333

 Score =  227 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 44/286 (15%), Positives = 103/286 (36%), Gaps = 7/286 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +  + +   Y + L  +F  ++   V +S  S     +   I S  +  + +  +
Sbjct: 49  SKDQIRSLTRIHENYARMLINVFSAQLRNVVQVSVVSVDQIPYEEFIRSVPKVTILNVIA 108

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +     +  +  + N+   +L+ LLG   E+  ++ N  L+ +E  L +  + +    + 
Sbjct: 109 VPPLEGHIIMEVNPNIAYAMLDRLLGGQGESGEEISN--LTEIETSLVRNLLEKTLDSMR 166

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  S+  E  P  E        +       NE V  I++N+ I +      L IP  TL 
Sbjct: 167 EAWSSIAEIEP--ETSEFEVNPQFLQVISPNEIVIVISLNVQIGDETGMINLCIPHVTLE 224

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                       Q+  +  +   ++    +     + +   +     +++D + L  G V
Sbjct: 225 PIVSKLSVHYWMQSSKKEPNVQEVEQLKEQINDAELQVVAELGKADISIEDFLALDAGDV 284

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
           I           +    +  +  + G+V +   ++I D +    + 
Sbjct: 285 IRLQTSVHNPLTIYVGEQPKFIAQPGKVSRKVAVQILDDVKRRNER 330


>gi|307720638|ref|YP_003891778.1| flagellar motor switch protein FliM [Sulfurimonas autotrophica DSM
           16294]
 gi|306978731|gb|ADN08766.1| flagellar motor switch protein FliM [Sulfurimonas autotrophica DSM
           16294]
          Length = 366

 Score =  227 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 54/315 (17%), Positives = 107/315 (33%), Gaps = 6/315 (1%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           +S  +N  P   + L          K   +    +     + L       M   V+I   
Sbjct: 26  ESDEENLLPQRQVTLYDFKRPNRVSKEQLRAFRGVHDKMARSLASQISSIMRSIVEIQLH 85

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
           S     +   + S      F+  S+     +  I  + ++   +L+ LLG   E      
Sbjct: 86  SVDQMTYGEFLMSLPNPTSFNVFSVKPLEGSGIIEINPSIAFPMLDRLLGGKGEPFD--A 143

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
           +R  S +E  L +  +  + + L +      E  P +E       +        NE V  
Sbjct: 144 SREFSDIELSLFETILRVMMSTLKEAWGPVMEIYPTIESKESSPNV--VQIVAQNEIVVM 201

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLSS--QNKSENQSEDLIDPFARKTYQLNVN 241
           + M + I + +    +  P  +L        S        +  +              VN
Sbjct: 202 VVMEIIIGHSSGMMNICYPVISLEPVLPKLASRDLMLNETSSKKSRNTELKVLLGGAKVN 261

Query: 242 IDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
           ++  +     ++ D++ LK+G VI           ++ +GKE +  E+G      +I IT
Sbjct: 262 VEANLGDADLSMHDILELKVGDVIRLSSAANDIVTVAVDGKERFRGEIGLRRFRKSISIT 321

Query: 302 DRINFDQKSLKNFLH 316
           + I  ++ ++K  L 
Sbjct: 322 EIIETEKDTVKRALE 336


>gi|3894104|emb|CAA11954.1| flagellar C-ring protein [Sinorhizobium meliloti]
          Length = 315

 Score =  227 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 92/312 (29%), Positives = 158/312 (50%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   N       L+AR+TG LGD K I + +  L  ++ + LP + + +   DV I+Y  
Sbjct: 4   STASNVHAFDRRLIARMTGALGDDKVIGRTALELAQVFDELLPGVLQSETGCDVTIAYAG 63

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            ++G  + +I +  +  +    SL +W ++F +GC + ++I L+E LLGA   +I +   
Sbjct: 64  FRTGLRNDLIAALGDGVLLGDFSLRNWCADFQVGCDSPVLIALVEALLGAEPTSIEEPAP 123

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           RSLS +E  +A      I+ VL   ++      P +   Y+     K    L + F  +I
Sbjct: 124 RSLSKIEIDVALPVFHGIAEVLRTAVNAPGGFEPVVGRPYNSAERAKPDPVLEDVFAASI 183

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDT 244
           +M + +  V S+F +I+PQ TLLKT ++S     +  N   +  +    +  +  V ++ 
Sbjct: 184 DMTIGLGPVLSTFSVIVPQSTLLKTRIVSRKGAGEDRNAKTEWTEQLEEQVRRSAVALEA 243

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
           RI L+  TL  +  L+ G VIPF   +     +SANG+++Y CE GR G  YT+R+ D  
Sbjct: 244 RIRLESLTLDTLSRLQAGDVIPFHDGQDVRVEVSANGRDLYVCEFGRSGSRYTVRVKDTH 303

Query: 305 NFDQKSLKNFLH 316
             +Q  L++ + 
Sbjct: 304 GSEQDILRHIMS 315


>gi|254785477|ref|YP_003072906.1| flagellar motor switch protein FliM [Teredinibacter turnerae T7901]
 gi|237685691|gb|ACR12955.1| flagellar motor switch protein FliM [Teredinibacter turnerae T7901]
          Length = 332

 Score =  227 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 41/277 (14%), Positives = 97/277 (35%), Gaps = 6/277 (2%)

Query: 31  IEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSS 90
                  +   + ++        +    D+S    Q  KF   +H+       +      
Sbjct: 48  RMPTLEMINERFARYTRISMFNLLRRTADVSVGGIQIQKFGEYVHTLYVPTSLNMVKFRP 107

Query: 91  WSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCI 150
                 I     LV  L++N  G       ++  R  +  E ++ +  + Q+   L++  
Sbjct: 108 LRGTALIILDAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVQMVLEQVFVDLHEAW 166

Query: 151 STTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTT 210
              +      E                +E V     ++ ++       + +P   +    
Sbjct: 167 KAVKLID--FEYINSEVNPSMANIVSPSEVVVVSTFHVELDGGGGELHITMPYSMVEPIR 224

Query: 211 LISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLH 269
            I  +  Q+ ++ + +  +        +  V+++  +  +  TL+++V LK+G +IP   
Sbjct: 225 EILDAGLQSDTDERDDRWVQALREDVMRARVDLECDVVRRDITLREIVDLKVGDIIPVTM 284

Query: 270 REKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
            E   A   ANG  ++  ++G+   N  +RI D ++ 
Sbjct: 285 PEVHIAT--ANGVPMFQAKIGQCNNNLALRILDYVDR 319


>gi|118475490|ref|YP_892646.1| flagellar motor switch protein FliM [Campylobacter fetus subsp.
           fetus 82-40]
 gi|118414716|gb|ABK83136.1| flagellar motor switch protein FliM [Campylobacter fetus subsp.
           fetus 82-40]
          Length = 363

 Score =  227 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 45/292 (15%), Positives = 100/292 (34%), Gaps = 6/292 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +    +     + L       M   V+I   S     +   + S      F+  S
Sbjct: 50  SKEQLRAIKGIHDKLARNLASQISSIMRSIVEIRLHSVDQMTYGEFLMSLPSPTSFNVFS 109

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +     N  +  + ++   +++ LLG + +      NR L+ +E  L    +  +   L 
Sbjct: 110 IKPLDGNCVLEINPSIAFPMIDRLLGGNGDGFE--SNRELTDIEINLLDAILRIMMQRLK 167

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  S   +  PN+E       +        NE V  + M + I N +    +  P   L 
Sbjct: 168 ESWSMITDMYPNVEAKESSPNV--VQIVSQNEIVIMVVMEIIIGNSSGMINICYPVIYLE 225

Query: 208 KTTLISLSS--QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVI 265
                  +        +  +           +  V  +  +     ++ + + L+ G ++
Sbjct: 226 PILSRLANRDIMLGETSAKKSRNKELKTLIGRAEVLYEAILGRTVISVNEFLNLQEGDIL 285

Query: 266 PFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLHK 317
                    AI+  + K+++  ++G      +I+I + I  D+  +KN L +
Sbjct: 286 RLDKSADDKAIVCIDKKDVFLAQIGLHRFRKSIKIEELIKTDKDEIKNILEQ 337


>gi|115523559|ref|YP_780470.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           BisA53]
 gi|115517506|gb|ABJ05490.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           BisA53]
          Length = 403

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 42/295 (14%), Positives = 105/295 (35%), Gaps = 4/295 (1%)

Query: 14  HPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHI 73
               +  +            +   +     + +    +     +V++S     S +FS  
Sbjct: 90  DHSGIRAIIDSAMVSYERLPMLEIVFDRLVRLMTTSLRNFTSDNVEVSLDRITSVRFSDY 149

Query: 74  IHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGAS-HETIPQLYNRSLSTVEK 132
           ++S     V S      W +       ++L+ ++++ LLG    +T  ++  R  +T+E 
Sbjct: 150 MNSIPLPAVLSVFKAEEWENFGLATVDSSLIYSMIDVLLGGRRGQTSMRIEGRPYTTIET 209

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            L KR +  + A   Q        +  ++        +             + +++ +E+
Sbjct: 210 NLVKRLVEVVLADAEQAFRPLSPVTFKIDRLET--NPRFAAITRPANAAILVRLHIDMED 267

Query: 193 VASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
              +  L++P  T+     + +     +   +        A +  Q  +++D  +   + 
Sbjct: 268 RGGNIELLLPYATIEPIRAVLMQMFMGEKFGRDPIWEGHLATEITQAQISVDAVLYEAEL 327

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
            LK +++LK+G  +P   R      +      +    +GRV     IR+T ++  
Sbjct: 328 PLKQLMSLKVGDTLPLEMRPDALVSVRCGSVILTEGRMGRVADRVAIRVTKQLRK 382


>gi|239906894|ref|YP_002953635.1| flagellar motor switch protein FliM [Desulfovibrio magneticus RS-1]
 gi|239796760|dbj|BAH75749.1| flagellar motor switch protein FliM [Desulfovibrio magneticus RS-1]
          Length = 326

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 39/297 (13%), Positives = 89/297 (29%), Gaps = 10/297 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
                        R+            +   +   + +         M    D++  S  
Sbjct: 32  DSGVVVFDLSNQDRIIRG------RMPVLEIINDRFARLASNAMANAMRKRADVNPISID 85

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
             KF   + S       +   L     N  +   + LV  ++E+  G +     ++  R 
Sbjct: 86  MSKFGDFMRSLPVPTSINIFKLDPLRGNAILVVDSRLVFAMVESFFGGAGSQP-KIEGRD 144

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            + +E+ +  R +      + +      E   ++E        +       ++ V  +  
Sbjct: 145 FTPIEQAIINRVVRIALENMEESWQPVHEV--HIELVRSEVNPQFAAIVPPSDVVVVVTF 202

Query: 187 NMTIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTR 245
            + +EN   S ++ +P  T+         S Q +        I  F  +  +  V +  R
Sbjct: 203 EVELENAIGSLIVCLPYATIEPIRSKLYASFQTERLEVDHAWIARFKERLMETPVELLVR 262

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
               + T + +++LK G ++   +           G   +    G V  N   +I  
Sbjct: 263 FGRSQITGRQLLSLKPGDILMLENDVDELLEAEIQGVRKFQGIPGLVKSNKAFQIVK 319


>gi|218886491|ref|YP_002435812.1| flagellar motor switch protein FliM [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218757445|gb|ACL08344.1| flagellar motor switch protein FliM [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 326

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 46/318 (14%), Positives = 95/318 (29%), Gaps = 22/318 (6%)

Query: 1   MRGQSIHKNTS---------PLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFK 51
           + G  I   T          P       R+            +   +   + +       
Sbjct: 17  LSGGEIESETDIPEDDSGIVPFDLANQDRIIRG------RMPVLEIVNDRFARLCTNALS 70

Query: 52  EKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENL 111
             +   V+++  S    KF   + S       +   +     N  I   + LV  L+EN 
Sbjct: 71  NTVRKRVELNPISIDMTKFGDFMRSLPVPTSINIFKMEPLRGNAIIVVDSRLVFALVENF 130

Query: 112 LGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKK 171
            G +     ++  R  + +E+ +  R I      + +      +   +LE        + 
Sbjct: 131 FGGAGSQP-KIEGREFTRIEQAIVDRVIKIALDNMEESWRPVHDV--SLELVRSEINPQF 187

Query: 172 NTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDP 230
                 ++ V  I   + +E    S V+ +P  T+         S Q +        +  
Sbjct: 188 AAIVPPSDVVVVITFEVELETAIGSMVICLPYATIEPIRSKLHASFQTERLEVDHAWVSR 247

Query: 231 FARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
              +  +  VN+       K T   ++ L++G V+            +  G   +    G
Sbjct: 248 LKERLLETPVNLKIHFGESKITGNQLLRLQVGDVLLLDTDTDDLLECTVQGVTKFWGISG 307

Query: 291 RVGKNYTIRITDRINFDQ 308
            V  N   +I   I  ++
Sbjct: 308 TVKANKAFQI---IKEEE 322


>gi|254459067|ref|ZP_05072490.1| flagellar motor switch protein FliM [Campylobacterales bacterium GD
           1]
 gi|207084338|gb|EDZ61627.1| flagellar motor switch protein FliM [Campylobacterales bacterium GD
           1]
          Length = 365

 Score =  227 bits (579), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 54/315 (17%), Positives = 110/315 (34%), Gaps = 6/315 (1%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           +S   N  P   + L          K   +    +     + L       M   V+I   
Sbjct: 26  ESSDDNMLPQRQVTLYDFKRPNRVSKEQLRAFRGVHDKMARSLASQISSIMRSIVEIQLH 85

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
           S     +   + S      F+  S+     +  I  + ++   +L+ LLG   E      
Sbjct: 86  SVDQMTYGEFLMSLPNPTSFNVFSVKPLEGSGVIEINPSIAFPMLDRLLGGKGEPFD--A 143

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
           +R  S +E  L +  +  + + L +      E  P +E       +        NE V  
Sbjct: 144 SREFSDIELSLFETILRVMMSTLKEAWGPVMEIYPTIESKESSPNV--VQIVAQNEIVVM 201

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLSS--QNKSENQSEDLIDPFARKTYQLNVN 241
           + M + I + +    +  P  +L        S        +  +              VN
Sbjct: 202 VVMEIIIGHSSGMMNICYPVISLEPILPKLASRDLMLNETSSKKSRNTELQVLLGGAKVN 261

Query: 242 IDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
           ++  +   + T++DV+ L+IG V+           +S +GKE +  ++G      +I+I+
Sbjct: 262 VEANLGDAELTMRDVLDLQIGDVVRLSSAANDIVTVSIDGKERFRGQIGLRRFRKSIQIS 321

Query: 302 DRINFDQKSLKNFLH 316
           + I+ ++ ++K  L 
Sbjct: 322 EIIDTEKDAVKRALE 336


>gi|153940240|ref|YP_001392022.1| flagellar motor switch protein FliM [Clostridium botulinum F str.
           Langeland]
 gi|170756595|ref|YP_001782350.1| flagellar motor switch protein FliM [Clostridium botulinum B1 str.
           Okra]
 gi|152936136|gb|ABS41634.1| flagellar motor switch protein FliM [Clostridium botulinum F str.
           Langeland]
 gi|169121807|gb|ACA45643.1| flagellar motor switch protein FliM [Clostridium botulinum B1 str.
           Okra]
 gi|295320037|gb|ADG00415.1| flagellar motor switch protein FliM [Clostridium botulinum F str.
           230613]
          Length = 331

 Score =  227 bits (579), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 42/309 (13%), Positives = 103/309 (33%), Gaps = 13/309 (4%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           +   +   P       +        K   +    +   Y + +      ++  +V +   
Sbjct: 30  EEEKQKVKPYDFKRPQKF------SKDHIRTLELIHDNYARIISNYLTAQVRSNVKVKIE 83

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
           S Q   +   IHS     + +   +   + +     +   V  +++ LLG +     ++ 
Sbjct: 84  SVQQITYEEFIHSVPNPTILTIFKMPPLNGSILFETNPQFVFQMIDVLLGGNGNGTYKM- 142

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  + ++K + K+    +   L        E    +E          N      E V  
Sbjct: 143 -REFTDIDKNIMKQINTGLITNLKLAWEDVMEVDVEIESLET--NPALNQTLAPTEPVAL 199

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLIS---LSSQNKSENQSEDLIDPFARKTYQLNV 240
           I  ++ +    +   + IP  ++ K           +   E   E        +   +++
Sbjct: 200 ITFSVEMGKSNTFINICIPYLSIEKVLEKLVVQYWFRENDEESIEQSSSKIKERINIVSM 259

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            +   +     T+++ + L +G V+    + +    L    +  Y  + G +GKN  ++I
Sbjct: 260 ELTAELGRTSVTVEEFLRLAVGDVVALETKTEEPVHLLIEEEPGYYAKPGIIGKNIGLQI 319

Query: 301 TDRINFDQK 309
            D+I+ D +
Sbjct: 320 LDQIDKDVE 328


>gi|150019115|ref|YP_001311369.1| flagellar motor switch protein FliM [Clostridium beijerinckii NCIMB
           8052]
 gi|149905580|gb|ABR36413.1| flagellar motor switch protein FliM [Clostridium beijerinckii NCIMB
           8052]
          Length = 332

 Score =  227 bits (579), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 40/283 (14%), Positives = 105/283 (37%), Gaps = 7/283 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +    +   Y + +      +   +V +   + +   +   IHS +   + +   
Sbjct: 48  SKEHIRTLELIHDNYARIISNYLTGQTRQNVKVKIETVEQITYEEFIHSVQNPTIITIFK 107

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           ++  S       +    + +++ LLG   +   +   +  + ++K + ++    + + L 
Sbjct: 108 MAPLSGTIIFETNPQFSLQVIDVLLGGKGDR--KAQAKEFTDIDKNIMRQVTTGMISNLK 165

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
               +  E  P +E          N     N+ V  I  ++ +   ++   + +P  ++ 
Sbjct: 166 LAWDSVLEVEPEVETIET--NPAINQTLSPNDPVALITFSVEMNKRSTFINMCLPYLSVE 223

Query: 208 KTTLIS---LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
           K         + +N +E    +  +   +   +++V I   +     T+ D + L +G V
Sbjct: 224 KILDKLVVQYAFKNDNEASMAESREKLEKGINKVDVEIVAELGTANITVDDFLKLTVGDV 283

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
           I   ++  +   +    +E Y  + G VGKN  + I D  + +
Sbjct: 284 IKLDNKSSSPIKVYVGNEECYYAKPGVVGKNAGVMILDITDKE 326


>gi|168183192|ref|ZP_02617856.1| flagellar motor switch protein FliM [Clostridium botulinum Bf]
 gi|237796179|ref|YP_002863731.1| flagellar motor switch protein FliM [Clostridium botulinum Ba4 str.
           657]
 gi|182673661|gb|EDT85622.1| flagellar motor switch protein FliM [Clostridium botulinum Bf]
 gi|229262117|gb|ACQ53150.1| flagellar motor switch protein FliM [Clostridium botulinum Ba4 str.
           657]
          Length = 331

 Score =  227 bits (579), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 43/309 (13%), Positives = 103/309 (33%), Gaps = 13/309 (4%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           +   +   P       +        K   +    +   Y + +      ++  +V +   
Sbjct: 30  EEEKQKVKPYDFKRPQKF------SKDHIRTLELIHDNYARIISNYLTAQVRSNVKVKIE 83

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
           S Q   +   IHS     + +   +   + +     +   V  +++ LLG +     ++ 
Sbjct: 84  SVQQITYEEFIHSVPNPTILTIFKMPPLNGSILFETNPQFVFQMIDVLLGGNGNGTYKM- 142

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  + ++K + K+    +   L        E    +E          N      E V  
Sbjct: 143 -REFTDIDKNIMKQINTGLITNLKLAWEDVMEVDVEIESLET--NPALNQTLAPTEPVAL 199

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLIS---LSSQNKSENQSEDLIDPFARKTYQLNV 240
           I  ++ +    +   + IP  ++ K           +   E   E        +   +++
Sbjct: 200 ITFSVEMGKSNTFINICIPYLSIEKVLEKLVVQYWFRENDEESIEQSSSKIKERINIVSM 259

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            +   +     T+++ + L +G V+    R +    L    +  Y  + G +GKN  ++I
Sbjct: 260 ELTAELGRTSVTVEEFLRLAVGDVVSLETRTEEPVHLLIEEEPGYYAKPGIIGKNIGLQI 319

Query: 301 TDRINFDQK 309
            D+I+ D +
Sbjct: 320 LDQIDKDVE 328


>gi|187933524|ref|YP_001885005.1| flagellar motor switch protein FliM [Clostridium botulinum B str.
           Eklund 17B]
 gi|187721677|gb|ACD22898.1| flagellar motor switch protein FliM [Clostridium botulinum B str.
           Eklund 17B]
          Length = 331

 Score =  227 bits (579), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 43/314 (13%), Positives = 105/314 (33%), Gaps = 11/314 (3%)

Query: 1   MRGQSIHKNTSPLHPIL----LARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDL 56
           +    +   T+P         L          K   +    +   + +        ++  
Sbjct: 17  LSTGELEPETAPKDDEKHKIKLYDFKSPQKFSKDHIRTLELIHDNFARITSNYLTGQIRK 76

Query: 57  DVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASH 116
           +V +   + +   +   IHS +   + +   +   + +     +      +++ LLG S 
Sbjct: 77  NVKVKIETVEQITYEEFIHSVQNPTIITIFKMPPLTGSIIFETNPQFSFQIIDILLGGSG 136

Query: 117 ETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRL 176
           +   ++ N+  S ++K + ++    + + L          SP +E          N    
Sbjct: 137 DR--KIGNKEFSDIDKNIIRQVTTGMISNLKLAWEDILNVSPEVEGIET--NPAINQTLA 192

Query: 177 SNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS---LSSQNKSENQSEDLIDPFAR 233
            NE V  I  ++     ++   + IP  ++ K           QN  E    +       
Sbjct: 193 PNEPVALITFSVEFGEHSTFMNMCIPYLSIEKVLDKLVVQYWFQNDDEALIAESRVKMEE 252

Query: 234 KTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVG 293
              ++++ +   +      + D + L  G +I   ++  +   +    +E Y  + G  G
Sbjct: 253 GIQKVDIEVFAELGNTNIIVDDFLKLTKGDIIKLDNKSSSPIKVYVGDEECYYAKPGVTG 312

Query: 294 KNYTIRITDRINFD 307
           KN  + I D I+ +
Sbjct: 313 KNMGVAILDIIDKE 326


>gi|15895484|ref|NP_348833.1| flagellar switch protein FliM [Clostridium acetobutylicum ATCC 824]
 gi|15025214|gb|AAK80173.1|AE007722_2 Flagellar switch protein FliM [Clostridium acetobutylicum ATCC 824]
 gi|325509631|gb|ADZ21267.1| Flagellar switch protein FliM [Clostridium acetobutylicum EA 2018]
          Length = 331

 Score =  227 bits (578), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 43/291 (14%), Positives = 98/291 (33%), Gaps = 7/291 (2%)

Query: 20  RLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKE 79
             T      K   +    +   Y + +      ++  +V +   + +   +   IHS   
Sbjct: 40  DFTSPQKFAKEHIRTLELIHDNYSRIMSNYLTAQLRDNVKVKIETVEQITYEEFIHSVPN 99

Query: 80  NFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTI 139
             + +   +     +     +   +   ++ LLG +     +   R ++ ++K +  +  
Sbjct: 100 PTILTIFRMPPLKGSILYETNPQFIYQAIDILLGGNG--AGKYKPREITDIDKNIIMKIN 157

Query: 140 AQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVL 199
             +   L           P +E          N     +E V  I  ++ + N  +   +
Sbjct: 158 QGLIDNLKLAWGEVINVEPEIESLET--NPALNQTLAPHEPVALITFSVDVGNSHTYINI 215

Query: 200 IIPQETLLKTTLIS---LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDV 256
            IP  ++ K           Q   E   ++      ++   + V +  ++   + T++D 
Sbjct: 216 CIPYLSIEKILDKLVVQYWYQENDEEIVKESRVELRKRLDVVEVPVIAKLGQTEITVEDF 275

Query: 257 VTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
           + L IG VI    +      +       Y    G +GKN  I+I D+I+ D
Sbjct: 276 LRLSIGDVITLNSKCSDPVPVYIYDNLHYLAAPGILGKNMGIKILDKIDKD 326


>gi|296531938|ref|ZP_06894735.1| flagellar motor switch protein FliM [Roseomonas cervicalis ATCC
           49957]
 gi|296267736|gb|EFH13564.1| flagellar motor switch protein FliM [Roseomonas cervicalis ATCC
           49957]
          Length = 355

 Score =  227 bits (578), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 40/300 (13%), Positives = 102/300 (34%), Gaps = 4/300 (1%)

Query: 18  LARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSF 77
           + ++  +         +   +     + +    +     +V++S     S +F   +++ 
Sbjct: 44  IEKVIARGLVSYERLPMLEIVFDRLVRIMSTSLRNFTSDNVEVSIEGITSLRFGDYLNTI 103

Query: 78  KENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGAS-HETIPQLYNRSLSTVEKKLAK 136
               +        W +   +   + L+ ++++ LLG     T  ++  R  +T+E+ L +
Sbjct: 104 PLPAMLVVFKAEEWDNYGLVVVDSALIYSVVDVLLGGRRGTTAMRIEGRPYTTIERGLIE 163

Query: 137 RTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASS 196
           R    +   L+       E     E        +       +       + + +E+    
Sbjct: 164 RLTEVVLKDLSDAFGPLAEVEFRFERLEV--NPRFAAISRPSNAAVLARLRVDMESRGGQ 221

Query: 197 FVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKD 255
             L++P  TL     + L     +   +        A +  Q  V +D  ++ +   L D
Sbjct: 222 LQLLLPYATLEPVRELLLQQFMGEKFGRDSIWETHLAEELRQTEVALDVVLDEQTMRLSD 281

Query: 256 VVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFL 315
           VV L++G +I           L      ++  ++G       +RI   +    + L++ +
Sbjct: 282 VVRLQVGDLITLGVGPGAPVRLRCGDTSLFEGQVGGRKGRLAVRIDRAMPRQAEGLRDPV 341


>gi|168180850|ref|ZP_02615514.1| flagellar motor switch protein FliM [Clostridium botulinum NCTC
           2916]
 gi|182668347|gb|EDT80326.1| flagellar motor switch protein FliM [Clostridium botulinum NCTC
           2916]
          Length = 331

 Score =  227 bits (578), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 43/309 (13%), Positives = 103/309 (33%), Gaps = 13/309 (4%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           +   +   P       +        K   +    +   Y + +      ++  +V +   
Sbjct: 30  EEEKQKVKPYDFKRPQKF------SKDHIRTLELIHDNYARIISNYLTAQVRSNVKVKIE 83

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
           S Q   +   IHS     + +   +   + +     +   V  +++ LLG +     ++ 
Sbjct: 84  SVQQITYEEFIHSVPNPTILTIFKMPPLNGSILFETNPQFVFQMIDVLLGGNGNGTYKM- 142

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  + ++K + K+    +   L        E    +E          N      E V  
Sbjct: 143 -REFTDIDKNIMKQINTGLITNLKLAWEDVMEVDVEIESLET--NPALNQTLAPTEPVAL 199

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLIS---LSSQNKSENQSEDLIDPFARKTYQLNV 240
           I  ++ +    +   + IP  ++ K           +   E   E        +   +++
Sbjct: 200 ITFSVEMGKSNTFINICIPYLSIEKVLEKLVVQYWFRENDEESIEQSSSKIKERINIVSM 259

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            +   +     T+++ + L +G V+    R +    L    +  Y  + G +GKN  ++I
Sbjct: 260 ELTAELGRTSVTVEEFLRLAVGDVVALETRTEEPVHLLIEEEPGYYAKPGIIGKNIGLQI 319

Query: 301 TDRINFDQK 309
            D+I+ D +
Sbjct: 320 LDQIDKDVE 328


>gi|152984239|ref|YP_001349238.1| flagellar motor switch protein FliM [Pseudomonas aeruginosa PA7]
 gi|150959397|gb|ABR81422.1| flagellar motor switch protein FliM [Pseudomonas aeruginosa PA7]
          Length = 323

 Score =  226 bits (577), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 39/304 (12%), Positives = 95/304 (31%), Gaps = 12/304 (3%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           ++   +          R+                +   + ++        +    D++  
Sbjct: 29  EATPGSVKSYDLTSQDRIVRG------RMPTLEMINERFARYTRISMFNLLRRSADVAVG 82

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
             Q  KF   +HS       +   +              LV  L++N  G       ++ 
Sbjct: 83  GVQVMKFGEYVHSLYVPTSLNLVKMKPLRGTALFILDAKLVFKLVDNFFGGDGR-HAKIE 141

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  +  E ++ +  + Q    L +      E +   E                +E V  
Sbjct: 142 GREFTPTELRVVRMVLEQAFVDLKEAWQAVLEMN--FEYVNSEVNPAMANIVSPSEVVVV 199

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQLNVNI 242
              ++ ++       + +P   +     +  +  Q+  ++Q E  I         + V +
Sbjct: 200 STFHIELDGGGGDLHITMPYSMIEPIREMLDAGFQSDHDDQDERWIKALREDVLDVQVPL 259

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
              +  ++  L+D++ ++ G VIP         ++ ANG   +  +LG    N  ++I +
Sbjct: 260 GATVVRRQLKLRDILHMQPGDVIPVEMP--EHMVMRANGVPAFKVKLGAHKGNLALQIVE 317

Query: 303 RINF 306
            +  
Sbjct: 318 AVER 321


>gi|326791530|ref|YP_004309351.1| flagellar motor switch protein FliM [Clostridium lentocellum DSM
           5427]
 gi|326542294|gb|ADZ84153.1| flagellar motor switch protein FliM [Clostridium lentocellum DSM
           5427]
          Length = 328

 Score =  226 bits (577), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 37/312 (11%), Positives = 97/312 (31%), Gaps = 13/312 (4%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           M+  +  K          ++        K   +    +   Y + +       +   V  
Sbjct: 27  MQEANEQKGVKSYDFARPSKF------SKEQLRTLEIIFESYGRAISTYLSGHLRTMVSA 80

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
              + ++  +S   ++     + +         +  +  S N+  T+++ +LG S   + 
Sbjct: 81  EVMNAEAVTYSEFSNALINPVILAVTDFRPLKGSILLELSPNMGYTIIDRVLGGSGSGLE 140

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
            +  R  + +E+ + ++   Q   +L +      E  P LE        +       NE 
Sbjct: 141 TI--REFTDIERVILEKIFIQFVQLLAEPWQNVVELDPMLEKIET--NSQVVQIISPNEI 196

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQ 237
           +  + +N+ I NVA    + IP   +               K +       +   +   +
Sbjct: 197 IALVTLNIKIGNVAGMMNICIPHLVIESIMDKLNTKFWFAQKEQELGPSYHEYIEKMIEK 256

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
             + I   +     T+++ + L    ++       +   +       ++   G       
Sbjct: 257 SRIPIKAILGKTHITVREFLELSRSDIVKLDKDIDSGLDIYVGNILKFTGSPGEYKNKVA 316

Query: 298 IRITDRINFDQK 309
           I+I   I  + +
Sbjct: 317 IKINHVIQREDE 328


>gi|118588708|ref|ZP_01546116.1| flagellar motor switch protein M [Stappia aggregata IAM 12614]
 gi|118438694|gb|EAV45327.1| flagellar motor switch protein M [Stappia aggregata IAM 12614]
          Length = 412

 Score =  226 bits (577), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 43/303 (14%), Positives = 101/303 (33%), Gaps = 4/303 (1%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
           ++T       +  L            +   +     +      +     +V++S  S  S
Sbjct: 95  EDTIAGDQSGIRALINSAMVSYERLPMLEIVFDRLVRLTTTSLRNFTSDNVEVSLDSISS 154

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGA-SHETIPQLYNRS 126
            +F   ++S     +        W     I   ++L+ ++++ LLG     +  ++  R 
Sbjct: 155 VRFGDYLNSIPLPAILGVFKAEEWDGFGLITVESSLIYSIIDVLLGGGRGTSAVRVEGRP 214

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +T+E  L ++ +A I        +       NLE        +             + +
Sbjct: 215 YTTIETGLVQQMVALILQDAEHAFAPLSPVHFNLERLET--NPRFAAISRPANAAILVEL 272

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTR 245
            + +E+   S  +++P  TL     + L     +   +        A + +   V +D  
Sbjct: 273 RIDMEDRGGSVEIMMPYATLEPIRDLLLQMFMGEKFGRDPIWEGHLATEIHAAEVEVDAV 332

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           +      L  V++L +GQ + F        ++      +    LG+V  +  IR+   + 
Sbjct: 333 LYETYLPLGRVLSLDVGQTLVFDKEPTDPVMIKCGNIPLTEGTLGKVDDSIAIRVAKNLR 392

Query: 306 FDQ 308
             +
Sbjct: 393 KPK 395


>gi|92116939|ref|YP_576668.1| flagellar motor switch protein FliM [Nitrobacter hamburgensis X14]
 gi|91799833|gb|ABE62208.1| flagellar motor switch protein FliM [Nitrobacter hamburgensis X14]
          Length = 401

 Score =  226 bits (577), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 42/295 (14%), Positives = 102/295 (34%), Gaps = 4/295 (1%)

Query: 14  HPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHI 73
               +  +            +   +     + +    +     +V++S     S +F   
Sbjct: 88  DNSGIRAIIDSAMVSYERLPMLEIVFDRLVRLMTTSLRNFTSDNVEVSLDRITSVRFGDY 147

Query: 74  IHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGAS-HETIPQLYNRSLSTVEK 132
           ++S     V S      W +       ++L+ ++++ LLG    +T  ++  R  +T+E 
Sbjct: 148 MNSIPLPAVLSVFKAEEWENFGLAMVDSSLIYSMIDVLLGGRRGQTSLRIEGRPYTTIET 207

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            L KR +  + A   Q        + +++        +             + + + +E+
Sbjct: 208 NLVKRLVEVVLADAEQAFRPLSPVTFSIDRLET--NPRFAAITRPANAAILVRLRIDMED 265

Query: 193 VASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
              +  L++P  T+     + L     +   +        A +  Q  + +D  +   + 
Sbjct: 266 RGGTIELLLPYATIEPIRNVLLQMFMGEKFGRDPIWESHLATEIAQAQIAVDAVLYEAEI 325

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
            LK ++ LK+G  +P   R      +      +    +GRVG    IR++  +  
Sbjct: 326 PLKQLMALKVGDTLPLDMRPDASVAVRCGSVTLTEGRMGRVGDRVAIRVSRHLRK 380


>gi|152997440|ref|YP_001342275.1| flagellar motor switch protein FliM [Marinomonas sp. MWYL1]
 gi|150838364|gb|ABR72340.1| flagellar motor switch protein FliM [Marinomonas sp. MWYL1]
          Length = 324

 Score =  226 bits (577), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 36/273 (13%), Positives = 91/273 (33%), Gaps = 6/273 (2%)

Query: 31  IEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSS 90
                  +   + ++        +    D+S    Q  KF   +H+       +      
Sbjct: 49  RMPTLEMINERFARYTRISLFNMLRRTADVSSGGLQVMKFGEYVHTLYVPTSLNLVKFRP 108

Query: 91  WSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCI 150
             S         LV  L++N  G       ++  R  +  E ++ +  + Q+   L +  
Sbjct: 109 LRSTALFILDAKLVFKLVDNFFGGDGR-HAKIEGREFTPTEIRIVQLMLEQVFKDLTEAW 167

Query: 151 STTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTT 210
           +   +    LE                +E V     ++ ++       + +P   +    
Sbjct: 168 APVLKLE--LEYISSEVNPAMANIVSPSEVVVVSTFHIELDGGGGELHITLPYSMIEPVR 225

Query: 211 LISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLH 269
            +  +  Q+  + + +       +    ++V +   +  +K +L +V+  K G +IP   
Sbjct: 226 ELLDAGVQSDVDEKDDRWGKSLEQDVKDIDVRLSVSVANRKISLGEVLKFKAGDIIPIEM 285

Query: 270 REKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
                  + ANG   +  +LG   + Y++++ +
Sbjct: 286 P--EFVTVRANGVPTFKGKLGVSNERYSVQMQE 316


>gi|328543159|ref|YP_004303268.1| flagellar motor switch protein FliM [polymorphum gilvum
           SL003B-26A1]
 gi|326412905|gb|ADZ69968.1| Flagellar motor switch protein FliM [Polymorphum gilvum
           SL003B-26A1]
          Length = 411

 Score =  226 bits (577), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 44/297 (14%), Positives = 100/297 (33%), Gaps = 4/297 (1%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
           ++T       +  L            +   +     +      +     +V++S  S  S
Sbjct: 94  EDTIAGDQSGIRALINSAMVSYERLPMLEIVFDRLVRLTTTSLRNFTSDNVEVSLDSISS 153

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLL-GASHETIPQLYNRS 126
            +F   ++S     +        W     +   ++L+ ++++ LL G    T  ++  R 
Sbjct: 154 VRFGDYLNSIPLPAILGVFKAEEWDGFGLVTVESSLIYSIIDVLLGGGRGTTAVRVEGRP 213

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +T+E  L +R +  I A   Q  +       NLE        +             + +
Sbjct: 214 YTTIETNLVRRMVEIILADAEQAFAPLSPVHFNLERLET--NPRFAAISRPANAAILVEL 271

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTR 245
            + +E+   +  +++P  TL     + L     +   +        A + +   + +D  
Sbjct: 272 RIDMEDRGGTIEIMMPYATLEPIRDLLLQMFMGEKFGRDPIWEGHLASEIHAAEIEVDAV 331

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
           +      L  V++L +GQ + F         +      +    LG+V  +  IR+T 
Sbjct: 332 LYETHLPLGRVLSLDVGQTLIFDVDPHDPITIKCGNVPLTEGTLGKVEDSIAIRVTR 388


>gi|15964406|ref|NP_384759.1| flagellar motor switch transmembrane protein [Sinorhizobium
           meliloti 1021]
 gi|307318903|ref|ZP_07598334.1| surface presentation of antigens (SPOA) protein [Sinorhizobium
           meliloti AK83]
 gi|17380372|sp|O54246|FLIM_RHIME RecName: Full=Flagellar motor switch protein FliM
 gi|15073583|emb|CAC45225.1| Flagellar motor switch transmembrane protein [Sinorhizobium
           meliloti 1021]
 gi|306895317|gb|EFN26072.1| surface presentation of antigens (SPOA) protein [Sinorhizobium
           meliloti AK83]
          Length = 315

 Score =  226 bits (577), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 92/312 (29%), Positives = 158/312 (50%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   N       L+AR+TG LGD K I + +  L  ++ + LP + + +   DV I+Y  
Sbjct: 4   STASNVHAFDRRLIARMTGALGDDKVIGRTALELAQVFDELLPGVLQSETGCDVTIAYAG 63

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            ++G  + +I +  +  +    SL +W ++F +GC + ++I L+E LLGA   +I +   
Sbjct: 64  FRTGLRNELIAALGDGVLLGDLSLRNWCADFQVGCDSPVLIALVEALLGAEPTSIEEPAP 123

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           RSLS +E  +A      I+ VL   ++      P +   Y+     K    L + F  +I
Sbjct: 124 RSLSKIEIDVALPVFHGIAEVLRTAVNAPGGFEPVVGRPYNSAERAKPDPVLQDVFAASI 183

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDT 244
           +M + +  V S+F +I+PQ TLLKT ++S     +  N   +  +    +  +  V ++ 
Sbjct: 184 DMTIGLGPVLSTFSVIVPQSTLLKTRVVSRKGAGEDRNAKTEWTEQLEEQVRRSAVALEA 243

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
           RI L+  TL  +  L+ G VIPF   +     +SANG+++Y CE GR G  YT+R+ D  
Sbjct: 244 RIRLESLTLDTLSRLQAGDVIPFHDGQDVRVEVSANGRDLYVCEFGRSGSRYTVRVKDTH 303

Query: 305 NFDQKSLKNFLH 316
             +Q  L++ + 
Sbjct: 304 GSEQDILRHIMS 315


>gi|289523560|ref|ZP_06440414.1| flagellar motor switch protein FliM [Anaerobaculum hydrogeniformans
           ATCC BAA-1850]
 gi|289503252|gb|EFD24416.1| flagellar motor switch protein FliM [Anaerobaculum hydrogeniformans
           ATCC BAA-1850]
          Length = 342

 Score =  226 bits (577), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 39/283 (13%), Positives = 102/283 (36%), Gaps = 7/283 (2%)

Query: 29  KTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASL 88
           K   +    +   + + L   F   +   V +   S +   +   I S  +  V     +
Sbjct: 50  KDQLRAIQMIHEFFSRQLTTAFSSFVRTMVSVEVASVEQLSYDEFIKSLVQPTVIVVMEM 109

Query: 89  SSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQ 148
              SSN  +  +  LV  +++ +LG + +T  +   R L+ +E+ + +R + ++  +L +
Sbjct: 110 YPLSSNALLEINPRLVFAIIDRMLGGAGKTTYK--ARELTDIERTVTERVVMRMLELLEE 167

Query: 149 CISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLK 208
             +T  +    +++              +++ V  I + + I +V     + IP   +  
Sbjct: 168 SWATIVDLRFRIQN--MESNPYFAQICPASDVVVVITLQVKIGDVDGFINICIPYFAIEP 225

Query: 209 TTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVI 265
                       +    + +   +    +  ++ V +   I      LKD++ L++G VI
Sbjct: 226 VIDQLSSQRWFVSTGSREDDASQERIIERLSKVKVPVTVEIGHVDVMLKDILKLRVGDVI 285

Query: 266 PFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
                      +    +  +    G     ++++I      ++
Sbjct: 286 KLEETYSEPVKVRVGERVKFLGHAGIYNNKHSVQIIKTFISEK 328


>gi|15596640|ref|NP_250134.1| flagellar motor switch protein FliM [Pseudomonas aeruginosa PAO1]
 gi|107100877|ref|ZP_01364795.1| hypothetical protein PaerPA_01001907 [Pseudomonas aeruginosa PACS2]
 gi|116049388|ref|YP_791809.1| flagellar motor switch protein FliM [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218892684|ref|YP_002441553.1| flagellar motor switch protein FliM [Pseudomonas aeruginosa LESB58]
 gi|254234542|ref|ZP_04927865.1| flagellar motor switch protein FliM [Pseudomonas aeruginosa C3719]
 gi|254239793|ref|ZP_04933115.1| flagellar motor switch protein FliM [Pseudomonas aeruginosa 2192]
 gi|296390190|ref|ZP_06879665.1| flagellar motor switch protein FliM [Pseudomonas aeruginosa PAb1]
 gi|313106442|ref|ZP_07792673.1| flagellar motor switch protein FliM [Pseudomonas aeruginosa 39016]
 gi|12230925|sp|Q51465|FLIM_PSEAE RecName: Full=Flagellar motor switch protein FliM
 gi|9947394|gb|AAG04832.1|AE004574_3 flagellar motor switch protein FliM [Pseudomonas aeruginosa PAO1]
 gi|115584609|gb|ABJ10624.1| flagellar motor switch protein FliM [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126166473|gb|EAZ51984.1| flagellar motor switch protein FliM [Pseudomonas aeruginosa C3719]
 gi|126193171|gb|EAZ57234.1| flagellar motor switch protein FliM [Pseudomonas aeruginosa 2192]
 gi|218772912|emb|CAW28724.1| flagellar motor switch protein FliM [Pseudomonas aeruginosa LESB58]
 gi|310879175|gb|EFQ37769.1| flagellar motor switch protein FliM [Pseudomonas aeruginosa 39016]
          Length = 323

 Score =  226 bits (576), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 39/304 (12%), Positives = 95/304 (31%), Gaps = 12/304 (3%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           ++   +          R+                +   + ++        +    D++  
Sbjct: 29  EATPGSVKSYDLTSQDRIVRG------RMPTLEMINERFARYTRISMFNLLRRSADVAVG 82

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
             Q  KF   +HS       +   +              LV  L++N  G       ++ 
Sbjct: 83  GVQVMKFGEYVHSLYVPTSLNLVKMKPLRGTALFILDAKLVFKLVDNFFGGDGR-HAKIE 141

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  +  E ++ +  + Q    L +      E +   E                +E V  
Sbjct: 142 GREFTPTELRVVRMVLEQAFVDLKEAWQAVLEMN--FEYVNSEVNPAMANIVSPSEVVVV 199

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQLNVNI 242
              ++ ++       + +P   +     +  +  Q+  ++Q E  I         + V +
Sbjct: 200 STFHIELDGGGGDLHITMPYSMIEPIREMLDAGFQSDHDDQDERWIKALREDVLDVQVPL 259

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
              +  ++  L+D++ ++ G VIP         ++ ANG   +  +LG    N  ++I +
Sbjct: 260 GATVVRRQLKLRDILHMQPGDVIPVEMP--EHMVMRANGVPAFKVKLGAHKGNLALQILE 317

Query: 303 RINF 306
            +  
Sbjct: 318 AVER 321


>gi|28211379|ref|NP_782323.1| flagellar motor switch protein fliM [Clostridium tetani E88]
 gi|28203820|gb|AAO36260.1| flagellar motor switch protein fliM [Clostridium tetani E88]
          Length = 332

 Score =  226 bits (576), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 44/285 (15%), Positives = 97/285 (34%), Gaps = 6/285 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +    +   Y + +       M  ++     S Q   +   IHS     V +   
Sbjct: 48  SKDHIRTLELIHDNYARIMSNYLTAHMRKNIKAKIESVQQITYEEFIHSIPNPTVLTVFK 107

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
               +       +   V  +++ LLG + E   +   R  + ++K + K+    +   + 
Sbjct: 108 APPLNGTVLFETNPKFVFEVMDVLLGGNAEG-REYKLREFTDIDKNIIKQVNEGLIEGIK 166

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
                  E  P +E          N     NE V  I  ++ +   ++   + IP  ++ 
Sbjct: 167 LAWEDILELYPEIESIET--NPALNQTLAPNEPVALITFSVDMGKSSTFINICIPYLSIE 224

Query: 208 KTTLIS---LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
           K           Q  +E   E+       +   +   +   +   K T+++ + L +G V
Sbjct: 225 KILDKLVIQYWFQENNEAVREESNKQLRDRINIVETELVAVLGGAKITVEEFLRLSLGDV 284

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
           +   ++      ++   +     + G V KN  I+I D ++ D +
Sbjct: 285 LILDNQIDKPISINVENQLYAYGKPGVVDKNMGIQILDILDKDVE 329


>gi|327481259|gb|AEA84569.1| flagellar motor switch protein FliM [Pseudomonas stutzeri DSM 4166]
          Length = 323

 Score =  226 bits (576), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 40/275 (14%), Positives = 93/275 (33%), Gaps = 6/275 (2%)

Query: 31  IEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSS 90
                  +   + ++        +    D+S    Q  KF   +HS       +   +  
Sbjct: 50  RMPTLEMINERFARYTRISMFNLLRRSADVSVGGVQVMKFGEYVHSLYVPTSLNLVKMKP 109

Query: 91  WSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCI 150
                       LV  L++N  G       ++  R  +  E ++ +  + Q  A L +  
Sbjct: 110 LRGTALFILDAKLVFKLVDNFFGGDGR-HAKIEGREFTPTELRVVRMVLDQAFADLKEAW 168

Query: 151 STTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTT 210
               + +   E                +E V     ++ +++      + +P   +    
Sbjct: 169 HAVLDVN--FEYVNSEVNPALANIVSPSEVVVVSTFHIELDSGGGDLHVTMPYSMIEPIR 226

Query: 211 LISLS-SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLH 269
            +  +  Q+   +Q E  +         +NV +   +  ++  L+D++ ++ G VIP   
Sbjct: 227 EMLDAGFQSDVSDQDERWVKALREDILDVNVPLGATVVRRQLKLRDILNMQPGDVIPVEM 286

Query: 270 REKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
            E    I+ ANG   +  +LG    N  +++ + +
Sbjct: 287 PED--MIMRANGMPAFKVKLGAHKGNLALQVLEPV 319


>gi|88800464|ref|ZP_01116028.1| flagellar motor switch protein FliM [Reinekea sp. MED297]
 gi|88776794|gb|EAR08005.1| flagellar motor switch protein FliM [Reinekea sp. MED297]
          Length = 360

 Score =  226 bits (575), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 36/315 (11%), Positives = 98/315 (31%), Gaps = 12/315 (3%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
            +  +           R+                +   + ++        +    D++  
Sbjct: 27  GADAEGVKSYDLTSQDRIVRG------RMPTLEMINERFARYTRISMFNFLRRSADVATG 80

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
             Q  KF   +H+       +   +              LV  L++N  G       ++ 
Sbjct: 81  GIQILKFGEYVHTLYVPTSLNLVKVRPLRGTALFILDAKLVFKLVDNFFGGDGR-HAKIE 139

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  +  E ++ +  ++Q+   + +      +     E                +E V  
Sbjct: 140 GREFTPTEIRVVQMILSQVFQDMKEAWGAVLDVD--FEYMSSEVNPAMANIVSPSEVVVV 197

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNI 242
              ++ ++       + +P   +     +  +  Q+  +   E  ++          V  
Sbjct: 198 STFHIELDGGGGDLHMTLPYSMIEPVRDVLDAGVQSDVDEIDERWVESLRHDILGAKVPT 257

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
           +  +  ++  L+++V L+ G VIP           +ANG  ++  +LG+ G N  +R+  
Sbjct: 258 NAVVAEREIKLRELVDLQAGDVIPIDLP--ETIKFTANGIPLFETKLGQCGDNLALRVER 315

Query: 303 RINFDQKSLKNFLHK 317
            +    + + +   +
Sbjct: 316 PVRKMSRDIGDMKTR 330


>gi|307311548|ref|ZP_07591189.1| surface presentation of antigens (SPOA) protein [Sinorhizobium
           meliloti BL225C]
 gi|306899565|gb|EFN30194.1| surface presentation of antigens (SPOA) protein [Sinorhizobium
           meliloti BL225C]
          Length = 315

 Score =  226 bits (575), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 92/312 (29%), Positives = 158/312 (50%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   N       L+AR+TG LGD K I + +  L  ++ + LP + + +   DV I+Y  
Sbjct: 4   STASNVHAFDRRLIARMTGALGDDKVIGRTALELAQVFDELLPGVLQSETGCDVTIAYAG 63

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            ++G  + +I +  +  +    SL +W ++F +GC + ++I L+E LLGA   +I +   
Sbjct: 64  FRTGLRNELIAALGDGVLLGDLSLRNWCADFQVGCDSPVLIALVEALLGAEPTSIEEPAP 123

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           RSLS +E  +A      I+ VL   ++      P +   Y+     K    L + F  +I
Sbjct: 124 RSLSKIEIDVALPVFHGIAEVLRTAVNAPGGFEPVVGRPYNSAERGKPDPVLQDVFAASI 183

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDT 244
           +M + +  V S+F +I+PQ TLLKT ++S     +  N   +  +    +  +  V ++ 
Sbjct: 184 DMTIGLGPVLSTFSVIVPQSTLLKTRVVSRKGAGEDRNAKTEWTEQLEEQVRRSAVALEA 243

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
           RI L+  TL  +  L+ G VIPF   +     +SANG+++Y CE GR G  YT+R+ D  
Sbjct: 244 RIRLESLTLDTLSRLQAGDVIPFHDGQDVRVEVSANGRDLYVCEFGRSGSRYTVRVKDTH 303

Query: 305 NFDQKSLKNFLH 316
             +Q  L++ + 
Sbjct: 304 GSEQDILRHIMS 315


>gi|125972998|ref|YP_001036908.1| flagellar motor switch protein FliM [Clostridium thermocellum ATCC
           27405]
 gi|256004795|ref|ZP_05429770.1| flagellar motor switch protein FliM [Clostridium thermocellum DSM
           2360]
 gi|281417209|ref|ZP_06248229.1| flagellar motor switch protein FliM [Clostridium thermocellum JW20]
 gi|125713223|gb|ABN51715.1| flagellar motor switch protein FliM [Clostridium thermocellum ATCC
           27405]
 gi|255991245|gb|EEU01352.1| flagellar motor switch protein FliM [Clostridium thermocellum DSM
           2360]
 gi|281408611|gb|EFB38869.1| flagellar motor switch protein FliM [Clostridium thermocellum JW20]
 gi|316940766|gb|ADU74800.1| flagellar motor switch protein FliM [Clostridium thermocellum DSM
           1313]
          Length = 328

 Score =  226 bits (575), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 41/294 (13%), Positives = 92/294 (31%), Gaps = 7/294 (2%)

Query: 19  ARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFK 78
                     K   +  + +   Y + +       +   V +   S +   +    +S  
Sbjct: 39  HDFRRPSKFAKDHVRTLNVIHDNYARIITNFLSGYLRTLVQVEVISVEPIAYYEFNNSIS 98

Query: 79  ENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRT 138
              V +    +  + +  +  +  +   L++ +LG     I ++  R  + VE  + +R 
Sbjct: 99  NPAVLAVIDFAPLTGSIILEMAPPVAYALIDRILGGKGLPIERV--REFTEVEIAIIERI 156

Query: 139 IAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFV 198
           I Q+  ++ +      E  P LE        +      +NE V  I +   I  V     
Sbjct: 157 IIQLVNLMREPWENVVELKPRLEKIET--NAQFAQIVSANETVALITLGAKIGEVEGMIN 214

Query: 199 LIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKD 255
           L IP   +              +  +  +++  +   +K     V +   +      + D
Sbjct: 215 LCIPHIVVEPIVSKLNTKFWFSSVEKEATKEDKETIQKKIEYTKVPVRAILGRATIQVAD 274

Query: 256 VVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
            + L+ G VI           +       +    G       I+IT+ I  + +
Sbjct: 275 FLELQPGDVITLDSNVNGNLDVLVGDLLKFRGSPGVKKNRNAIKITEVIRREDE 328


>gi|188588470|ref|YP_001920165.1| flagellar motor switch protein FliM [Clostridium botulinum E3 str.
           Alaska E43]
 gi|251780168|ref|ZP_04823088.1| flagellar motor switch protein FliM [Clostridium botulinum E1 str.
           'BoNT E Beluga']
 gi|188498751|gb|ACD51887.1| flagellar motor switch protein FliM [Clostridium botulinum E3 str.
           Alaska E43]
 gi|243084483|gb|EES50373.1| flagellar motor switch protein FliM [Clostridium botulinum E1 str.
           'BoNT E Beluga']
          Length = 331

 Score =  225 bits (574), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 44/314 (14%), Positives = 105/314 (33%), Gaps = 11/314 (3%)

Query: 1   MRGQSIHKNTSPLHPIL----LARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDL 56
           +    +   T P         L          K   +    +   + +        ++  
Sbjct: 17  LSTGELEPETVPKDDEKHKIKLYDFKSPQKFSKDHIRTLELIHDNFARITSNYLTGQIRK 76

Query: 57  DVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASH 116
           +V +   + +   +   IHS +   + +   +   + +     +  L   +++ LLG S 
Sbjct: 77  NVKVKIETVEQITYEEFIHSVQNPTIITIFKMPPLTGSIIFETNPQLSFQIIDILLGGSG 136

Query: 117 ETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRL 176
           +   ++ N+  S ++K + ++    + + L          SP +E          N    
Sbjct: 137 DR--KIGNKEFSDIDKNIIRQVTTGMISNLKLAWEDILNVSPEVEGIET--NPAINQTLA 192

Query: 177 SNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS---LSSQNKSENQSEDLIDPFAR 233
            NE V  I  ++     ++   + IP  ++ K           QN  E    +       
Sbjct: 193 PNEPVALITFSVEFGEHSTFMNMCIPYLSIEKVLDKLVVQYWFQNDDEALIAESRVKMEE 252

Query: 234 KTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVG 293
              ++++ +   +      + D + L  G +I   ++  +   +    +E Y  + G  G
Sbjct: 253 GIQKVDIEVFAELGNTNIIVDDFLKLTKGDIIKLDNKSSSPIKVYVGDEECYYAKPGVTG 312

Query: 294 KNYTIRITDRINFD 307
           KN  + I D I+ +
Sbjct: 313 KNMGVAILDIIDKE 326


>gi|307945662|ref|ZP_07660998.1| flagellar motor switch protein FliM [Roseibium sp. TrichSKD4]
 gi|307771535|gb|EFO30760.1| flagellar motor switch protein FliM [Roseibium sp. TrichSKD4]
          Length = 410

 Score =  225 bits (574), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 40/303 (13%), Positives = 98/303 (32%), Gaps = 4/303 (1%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
           ++T       +  L            +   +     +      +     +V++S  S  S
Sbjct: 92  EDTIAGDQSGIRALINSAMVSYERLPMLEIVFDRLVRLTTTSLRNFTSDNVEVSLDSISS 151

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLL-GASHETIPQLYNRS 126
            +F   ++S     +        W     I   ++L+ ++++ LL G    T  ++  R 
Sbjct: 152 VRFGDYLNSIPLPAILGVFKAEEWDGFGMITVESSLIYSIIDVLLGGGRGATAVRVEGRP 211

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +T+E  L ++ ++ I     Q  +        +E        +             + +
Sbjct: 212 YTTIETNLVQQMVSLILQDAEQAFAPLSPVHFTMERLET--NPRFAAISRPANAAILVEL 269

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTR 245
            + +E+   +  +++P  TL     + L     +   +        A + +   V +D  
Sbjct: 270 RIDMEDRGGTVEIMMPYATLEPIRDLLLQMFMGEKFGRDPIWEGHLATEVHAAEVEVDAV 329

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           +      L  V+ L +GQ + F         L      +    +G+      I++T  + 
Sbjct: 330 LYETHLPLGRVMNLDVGQTLVFDIEPTDPVTLKCGNVPLTEGTMGKAEDAIAIQVTKNLR 389

Query: 306 FDQ 308
             +
Sbjct: 390 KPK 392


>gi|34557954|ref|NP_907769.1| flagellar motor switch protein FliM [Wolinella succinogenes DSM
           1740]
 gi|34483672|emb|CAE10669.1| FLAGELLAR MOTOR SWITCH PROTEIN FLIM [Wolinella succinogenes]
          Length = 354

 Score =  225 bits (574), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 48/304 (15%), Positives = 98/304 (32%), Gaps = 6/304 (1%)

Query: 16  ILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIH 75
           + L          K   +    +     + L       M   V+I   S     +   + 
Sbjct: 37  VTLYDFKRPNRVSKEQLRAFRGIHDKMARNLSSQISAIMRSIVEIQLHSVDQMTYGEFLM 96

Query: 76  SFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLA 135
           S      F+  S+        +  + ++   +++ LLG   +       R  S +E  L 
Sbjct: 97  SLPSPTSFNVFSMKPLDGTGVLEINPSIAFPMIDRLLGGKGDPYE--ATREFSDIELNLL 154

Query: 136 KRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVAS 195
              + Q+   L +  +   E  P+++       +        NE V  + M + I + + 
Sbjct: 155 DTILRQMMQNLKEAWAPVAEIFPSVDAKESSPNV--VQIVAQNEIVIMVVMEIIIGHSSG 212

Query: 196 SFVLIIPQETLLKTTLISLSS--QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTL 253
              L  P  +L        S        +  +              VNI   +      L
Sbjct: 213 MMNLCYPVISLESVLSRLASRDLMLSETSSKKSRNRELQALLGGAAVNISAVLGGTSLDL 272

Query: 254 KDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKN 313
           K+V+ L +G ++          I++ +G+E Y   +G      T++I + I  ++  +K 
Sbjct: 273 KEVLELGVGDIVRLDRPADDTVIVNVDGREKYIATIGLQRYRKTVKIKEVIKTEKDQVKE 332

Query: 314 FLHK 317
            L  
Sbjct: 333 ILEM 336


>gi|90021820|ref|YP_527647.1| flagellar motor switch protein FliM [Saccharophagus degradans 2-40]
 gi|89951420|gb|ABD81435.1| flagellar motor switch protein FliM [Saccharophagus degradans 2-40]
          Length = 333

 Score =  225 bits (573), Expect = 8e-57,   Method: Composition-based stats.
 Identities = 42/299 (14%), Positives = 100/299 (33%), Gaps = 12/299 (4%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
                      R+                +   + ++        +    D+S    Q  
Sbjct: 32  GVRAYDLTSQDRIVRG------RMPTLEMINERFARYTRISMFNLLRRTADVSVGGIQIQ 85

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           KF   +H+       +            I     LV  L++N  G       ++  R  +
Sbjct: 86  KFGEYVHTLYVPTSLNMVKFRPLRGTALIILDAKLVFKLVDNFFGGDGR-HAKIEGREFT 144

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
             E ++ +  + Q+   L +     +      E                +E V     ++
Sbjct: 145 PTELRVVQMVLEQVFIDLKEAWKAVKAID--FEYINSEVNPSMANIVSPSEVVVVSTFHV 202

Query: 189 TIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
            ++       + +P   +     +  +  Q+ ++ + +  +        +  V+++  + 
Sbjct: 203 ELDGGGGELHITMPYSMVEPIREVLDAGLQSDTDERDDRWVRALQEDVMEARVDLEADLV 262

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
            ++ TL+D+V L+ G +IP    E    IL+ANG  ++  +LG++  N  +RI   ++ 
Sbjct: 263 RREVTLRDIVDLREGDIIPITMPEYN--ILTANGVPMFKTQLGQLNDNLAMRILGFVDR 319


>gi|86750893|ref|YP_487389.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           HaA2]
 gi|86573921|gb|ABD08478.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           HaA2]
          Length = 401

 Score =  225 bits (573), Expect = 8e-57,   Method: Composition-based stats.
 Identities = 39/295 (13%), Positives = 105/295 (35%), Gaps = 4/295 (1%)

Query: 14  HPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHI 73
               +  +            +   +     + +    +     +V++S     S +FS  
Sbjct: 88  ENSGIRAIIDSAMVSYERLPMLEIVFDRLVRLMTTSLRNFTSDNVEVSLDRITSVRFSDY 147

Query: 74  IHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGAS-HETIPQLYNRSLSTVEK 132
           ++S     V        W +       ++L+ ++++ LLG    +   ++  R  +T+E 
Sbjct: 148 MNSIPLPAVLCVFKAEEWQNFGLATVDSSLIYSMIDVLLGGRRGQAAIRIEGRPYTTIET 207

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            L KR +  + A   Q        + +++        +             + +++ +E+
Sbjct: 208 NLVKRLLEVVLADAEQAFRPLSPVAFSIDRLET--NPRFAAISRPANAAILVRLHIDMED 265

Query: 193 VASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
              +  L++P  T+     + +     +   + +      A +  Q ++++D  +   + 
Sbjct: 266 RGGNIELLLPYATIEPIRGVLMQMFMGEKFGRDQVWEGHLATEIGQADISVDAVLYEAEV 325

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
            L+ ++ L++G  +P   R      +      +    +GRVG    IR+T  +  
Sbjct: 326 PLRQLMALQVGDTLPLDLRADALVAVRCGSVTLTEGRMGRVGDRVAIRVTKPLRK 380


>gi|304316897|ref|YP_003852042.1| flagellar motor switch protein FliM [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302778399|gb|ADL68958.1| flagellar motor switch protein FliM [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 329

 Score =  225 bits (573), Expect = 9e-57,   Method: Composition-based stats.
 Identities = 39/310 (12%), Positives = 94/310 (30%), Gaps = 11/310 (3%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           ++         P       +        K   +    +     +         +   V +
Sbjct: 27  IKESQQETRIKPYDFRRPNKF------SKEQLRTLQMIFENMSRSFTTFLSGYLRTLVQV 80

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           S  S +   +    +S       +            +  +NN   T+++ +LG       
Sbjct: 81  SIVSVEQITYYEFSNSLTNPVFIAVIDAKPLDGPIILEFNNNTTFTIIDKILGGIGTADT 140

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
               R  + +E  L  R   Q+  ++        E +P +         + +     NE 
Sbjct: 141 V--ERDYTEIEMGLLSRITTQLLPLIKDAWINVIELNPEITRIET--NSQFSQIISPNET 196

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSED-LIDPFARKTYQLN 239
           +    M++ I +        +P  T++    +  +    S  + +   I     K     
Sbjct: 197 IALCTMSLKINDNEGLINFCLPHITIVPILPLLTTKTWFSNAEKQSCDIGIIKDKISNTY 256

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           + +   I + K T++D++    G ++    + K    +  N +  +    G   K Y ++
Sbjct: 257 IPLKAVIGMSKITVRDLLNFNKGDILEINKKYKDPIEIKINDETKFLGVPGIKNKKYCVQ 316

Query: 300 ITDRINFDQK 309
           IT+  +    
Sbjct: 317 ITEICSEGDD 326


>gi|39936958|ref|NP_949234.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           CGA009]
 gi|192292786|ref|YP_001993391.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           TIE-1]
 gi|39650815|emb|CAE29338.1| possible flagellar motor switch protein FliM [Rhodopseudomonas
           palustris CGA009]
 gi|192286535|gb|ACF02916.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           TIE-1]
          Length = 400

 Score =  224 bits (572), Expect = 9e-57,   Method: Composition-based stats.
 Identities = 39/295 (13%), Positives = 104/295 (35%), Gaps = 4/295 (1%)

Query: 14  HPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHI 73
               +  +            +   +     + +    +     +V++S     S +F   
Sbjct: 87  ENSGIRAIIDSAMVSYERLPMLEIVFDRLVRLMTTSLRNFTSDNVEVSLDRITSVRFGDY 146

Query: 74  IHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGAS-HETIPQLYNRSLSTVEK 132
           ++S     V        W +       ++L+ ++++ LLG    +   ++  R  +T+E 
Sbjct: 147 MNSIPLPAVLCVFKAEEWQNFGLATVDSSLIYSMIDVLLGGRRGQAALRIEGRPYTTIET 206

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            L KR +  + A   Q        S +++        +             + +++ +E+
Sbjct: 207 NLVKRLLEVVLADAEQAFRPLSPVSFSIDRLET--NPRFAAISRPANAAILVRLHIDMED 264

Query: 193 VASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
              +  L++P  T+     + +     +   + +      A +  Q ++++D  +   + 
Sbjct: 265 RGGNIELLLPYATIEPIRGVLMQMFMGEKFGRDQVWEGHLATEIVQADISVDAVLYEAEL 324

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
            L+ ++ L++G  +P   R      +      +    +GRVG    IR+T  +  
Sbjct: 325 PLRQLMALQVGDTLPLELRADATVAVRCGSVVLTEGRMGRVGDRVAIRVTKPLRK 379


>gi|237753388|ref|ZP_04583868.1| flagellar motor switch protein flim [Helicobacter winghamensis ATCC
           BAA-430]
 gi|229375655|gb|EEO25746.1| flagellar motor switch protein flim [Helicobacter winghamensis ATCC
           BAA-430]
          Length = 352

 Score =  224 bits (572), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 43/292 (14%), Positives = 96/292 (32%), Gaps = 6/292 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +    +     + L       M   V+I   S     +   + S      F+  S
Sbjct: 50  SKEQLRAFRGIHDKMARSLSSQISAIMRSIVEIQLHSVDQMTYGEFLMSLPSPTSFNVFS 109

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +        +  + ++   +++ LLG   +       R  S +E  L    + Q+   L 
Sbjct: 110 MKPLDGTGVLEINPSIAFPMIDRLLGGKGDPYEST--REFSDIELNLLDTILRQMMQNLK 167

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  +   E  P ++       +        NE V  + M + I + +    L  P  +L 
Sbjct: 168 EAWAPITEIFPTVDVKESSPNV--VQIVAQNEIVIMVVMEIIIGHSSGMMNLCYPVISLE 225

Query: 208 KTTLISLSS--QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVI 265
                  S        +  +              VN+   +   K ++ +++ L++G ++
Sbjct: 226 SVLSRLASRDIMLSETSAKKSRNKELQALLGGAKVNVAAVLGETKLSMHEILDLEVGDIV 285

Query: 266 PFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLHK 317
                     I++ +G+E +   +G      TI + + I  ++  +K  L  
Sbjct: 286 RLDRPADDTVIINVDGREKFLASIGLHRYRKTIEVKEMIKTEKDQVKEILEM 337


>gi|170747253|ref|YP_001753513.1| flagellar motor switch protein FliM [Methylobacterium radiotolerans
           JCM 2831]
 gi|170653775|gb|ACB22830.1| flagellar motor switch protein FliM [Methylobacterium radiotolerans
           JCM 2831]
          Length = 404

 Score =  224 bits (572), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 37/285 (12%), Positives = 101/285 (35%), Gaps = 4/285 (1%)

Query: 30  TIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLS 89
               +   +     + L    +     +V+++  +  S +F   +++     +       
Sbjct: 110 ERLPMLEIVFDRMIRLLSTSLRNLFQDNVEVTLDNITSVRFGDYLNAIPLPTLLGVFRAE 169

Query: 90  SWSSNFFIGCSNNLVITLLENLLGA-SHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQ 148
            W ++  +   +NL     + LLG     +  +L  R  + +E  L +R +  +   L  
Sbjct: 170 QWENSGLVTVDSNLAYATFDLLLGGKRGGSSSRLDGRPFTAIEMTLVRRLVEIVLGDLEM 229

Query: 149 CISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLK 208
                   S  ++        +  T          I++ + ++       ++ P  T+  
Sbjct: 230 SFQPLSPVSFGIDRIET--NPRFATITRPGNAAILISLRLDVDGRGGMLQILFPYATIEP 287

Query: 209 TTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPF 267
              +   S   +   +        A + +Q +V +D  ++     LK V++LK+G+ + F
Sbjct: 288 IRELLTQSFMGEKLGRDHVWEGHLATEIWQADVTMDAVLHEMMLPLKQVMSLKVGETLMF 347

Query: 268 LHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLK 312
             +      +      +    +GRV  +  +++T  +   + +++
Sbjct: 348 DAKPSDLITVRCGDWALTQGRIGRVDGHIAVQVTRPLRRSRTTIQ 392


>gi|242309556|ref|ZP_04808711.1| flagellar motor switch protein FliM [Helicobacter pullorum MIT
           98-5489]
 gi|239524127|gb|EEQ63993.1| flagellar motor switch protein FliM [Helicobacter pullorum MIT
           98-5489]
          Length = 352

 Score =  224 bits (571), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 47/304 (15%), Positives = 99/304 (32%), Gaps = 6/304 (1%)

Query: 16  ILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIH 75
           + L          K   +    +     + L       M   V+I   S     +   + 
Sbjct: 38  VTLYDFKRPNRVSKEQLRAFRGIHDKMARSLSSQISAIMRSIVEIQLHSVDQMTYGEFLM 97

Query: 76  SFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLA 135
           S      F+  S+        +  + ++   +++ LLG   +       R  S +E  L 
Sbjct: 98  SLPSPTSFNVFSMKPLDGTGVLEINPSIAFPMIDRLLGGKGDPYEST--REFSDIELNLL 155

Query: 136 KRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVAS 195
              + Q+   L +  +   E  PN++       +        NE V  + M + I + + 
Sbjct: 156 DTILRQMMQNLKEAWAPITEIFPNVDVKESSPNV--VQIVAQNEIVIMVVMEIIIGHSSG 213

Query: 196 SFVLIIPQETLLKTTLISLSS--QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTL 253
              L  P  +L        S        +  +              VN+   +   K TL
Sbjct: 214 MMNLCYPVISLESVLSRLASRDIMLSETSSKKSRNKELQALLGGAKVNVTAMLGETKLTL 273

Query: 254 KDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKN 313
           ++++ L+ G ++          I++ +G+E +   +G      TI + + I  ++  +K 
Sbjct: 274 REILELESGDIVRLDRPADDTVIINVDGREKFLASIGLHRYRKTIEVKEMIKTEKDQVKE 333

Query: 314 FLHK 317
            L  
Sbjct: 334 ILEM 337


>gi|331006682|ref|ZP_08329960.1| Flagellar motor switch protein FliM [gamma proteobacterium
           IMCC1989]
 gi|330419514|gb|EGG93902.1| Flagellar motor switch protein FliM [gamma proteobacterium
           IMCC1989]
          Length = 340

 Score =  224 bits (571), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 46/308 (14%), Positives = 99/308 (32%), Gaps = 12/308 (3%)

Query: 2   RGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDIS 61
            G +     S        R+                +   + ++        +    D+S
Sbjct: 25  SGDTSAGGVSSYDLTTQDRIVRG------RMPTLEMINERFARYTRISMFNLLRRTADVS 78

Query: 62  YTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQ 121
                  KF   +H+       +            +     LV  L++N  G       +
Sbjct: 79  VGGINIQKFGEYVHTLYVPTSLNMVKFRPLRGTALVVFDAKLVFKLVDNFFGGDGR-HAK 137

Query: 122 LYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFV 181
           +  R  +  E ++ +  + Q    + +            E                +E V
Sbjct: 138 IEGREFTPTELRVVRMVLEQAFIDMKEAWRAVLPID--FEHVNSEVNPSMANIVSPSEVV 195

Query: 182 TTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNV 240
              + ++ ++       + IP   +     +  +  Q+ S+ + +  ++       Q NV
Sbjct: 196 VVSSFHVELDGGGGEMHITIPYSMIEPIREMLDAGLQSDSDERDDRWVNSLREDIMQANV 255

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            +DT     K  LKD+V LK G VIP         I +ANG  ++  ++G+   N+ +++
Sbjct: 256 RLDTNFVQSKILLKDIVDLKEGDVIPIELP--EEYITNANGVPMFKVDIGQSNGNFALKV 313

Query: 301 TDRINFDQ 308
            + I   +
Sbjct: 314 NEVIERTK 321


>gi|254504876|ref|ZP_05117027.1| flagellar motor switch protein FliM [Labrenzia alexandrii DFL-11]
 gi|222440947|gb|EEE47626.1| flagellar motor switch protein FliM [Labrenzia alexandrii DFL-11]
          Length = 412

 Score =  224 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 41/303 (13%), Positives = 101/303 (33%), Gaps = 4/303 (1%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
           ++T       +  L            +   +     +      +     +V++S  S  S
Sbjct: 95  EDTIAGDQSGIRALINSAMVSYERLPMLEIVFDRLVRLTTTSLRNFTSDNVEVSLDSISS 154

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLL-GASHETIPQLYNRS 126
            +F   ++S     +     +  W     I   ++L+ ++++ LL G    T  ++  R 
Sbjct: 155 VRFGDYLNSIPLPAILGVFKVEEWDGFGLITVESSLIYSIIDVLLGGGRGTTAARVEGRP 214

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +T+E  L ++ +  I     Q  +       NLE        +             + +
Sbjct: 215 YTTIETNLVQQMVQLILQDAEQAFAPLSPVHFNLERLET--NPRFAAISRPANAAILVEL 272

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTR 245
            + +E+   +  +++P  TL     + L     +   +        A + +   + +D  
Sbjct: 273 RIDMEDRGGTVEIMMPYATLEPIRDLLLQMFMGEKFGRDPIWEGHLATEIHAAEIEVDAV 332

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           +      L  V++L +GQ + F        ++      +    LG+   +  IR+   + 
Sbjct: 333 LYETYLPLGRVLSLDVGQTLVFDVAPTDPVLVKCGNIPLTEGTLGKTEDSIAIRVAKNLR 392

Query: 306 FDQ 308
             +
Sbjct: 393 KPK 395


>gi|316932826|ref|YP_004107808.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           DX-1]
 gi|315600540|gb|ADU43075.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           DX-1]
          Length = 400

 Score =  224 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 39/295 (13%), Positives = 104/295 (35%), Gaps = 4/295 (1%)

Query: 14  HPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHI 73
               +  +            +   +     + +    +     +V++S     S +F   
Sbjct: 87  ENSGIRAIIDSAMVSYERLPMLEIVFDRLVRLMTTSLRNFTSDNVEVSLDRITSVRFGDY 146

Query: 74  IHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGAS-HETIPQLYNRSLSTVEK 132
           ++S     V        W +       ++L+ ++++ LLG    +   ++  R  +T+E 
Sbjct: 147 MNSIPLPAVLCVFKAEEWQNFGLATVDSSLIYSMIDVLLGGRRGQAALRIEGRPYTTIET 206

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            L KR +  + A   Q        S +++        +             + +++ +E+
Sbjct: 207 NLVKRLLEVVLADAEQAFRPLSPVSFSIDRLET--NPRFAAISRPANAAILVRLHIDMED 264

Query: 193 VASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
              +  L++P  T+     + +     +   + +      A +  Q ++++D  +   + 
Sbjct: 265 RGGNIELLLPYATIEPIRGVLMQMFMGEKFGRDQVWEGHLATEIVQADISVDAVLYEAEL 324

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
            L+ ++ L++G  +P   R      +      +    +GRVG    IR+T  +  
Sbjct: 325 PLRQLMALQVGDTLPLELRADATVAVRCGSVVLTEGRMGRVGDRVAIRVTKPLRR 379


>gi|188582489|ref|YP_001925934.1| flagellar motor switch protein FliM [Methylobacterium populi BJ001]
 gi|179345987|gb|ACB81399.1| flagellar motor switch protein FliM [Methylobacterium populi BJ001]
          Length = 405

 Score =  224 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 36/285 (12%), Positives = 97/285 (34%), Gaps = 4/285 (1%)

Query: 30  TIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLS 89
               +   +     + L    +     +V+++  +  S +F   +++     +       
Sbjct: 111 ERLPMLEIVFDRMIRLLSTSLRNFFQDNVEVTLDNITSVRFGDYLNAIPLPTLLGVFKAD 170

Query: 90  SWSSNFFIGCSNNLVITLLENLLGA-SHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQ 148
           SW  +  +     L  + ++ LLG     +  +L  R  +T+E  L +R +  I   L  
Sbjct: 171 SWEGSGLVTVEQTLAYSTMDLLLGGKRGGSSSRLDGRPFTTIEMSLVRRLVEIILTDLEM 230

Query: 149 CISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLK 208
                      ++        +  T          I + + ++       ++ P  T+  
Sbjct: 231 SFQPLSPVRFGIDRIET--NPRFATITRPGNAAILITLKLDMDGRGGGMQILFPYATVEP 288

Query: 209 TTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPF 267
              +   S   +   + +      A + +Q +V ++  ++     LK V+ LK+G  + F
Sbjct: 289 IRDLLMQSFMGERLGRDQVWESHLATEIWQADVEMEAVLHEVTLPLKRVLNLKVGDTLMF 348

Query: 268 LHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLK 312
             +      +      +    +GR+     +++   +   + +L+
Sbjct: 349 DRKPSDLITVRCGDWALTQGRIGRIDDAIAVQVARPLRQSRTTLQ 393


>gi|78776906|ref|YP_393221.1| flagellar motor switch protein FliM [Sulfurimonas denitrificans DSM
           1251]
 gi|78497446|gb|ABB43986.1| Surface presentation of antigens (SPOA) protein:Flagellar motor
           switch protein FliM [Sulfurimonas denitrificans DSM
           1251]
          Length = 372

 Score =  224 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 48/303 (15%), Positives = 101/303 (33%), Gaps = 6/303 (1%)

Query: 16  ILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIH 75
           + L          K   +    +     + L       M   V+I   S     +   + 
Sbjct: 41  VTLYDFKRPNRVSKEQLRAFKGIHDKMARSLSSQISSIMRSIVEIQLHSVDQMTYGEFLM 100

Query: 76  SFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLA 135
           S      F+  S+     +  I  + ++   +L+ LLG   E      +R  S +E  L 
Sbjct: 101 SLPNPTSFNVFSMKPLEGSGVIEINPSIAFPMLDRLLGGKGEPFD--ASREFSDIELSLF 158

Query: 136 KRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVAS 195
           +  +  + + L        E  PN+E       +        NE V  + M + I   + 
Sbjct: 159 ETILRVMMSTLKDAWGPVMEIFPNIESKESSPNV--VQIVAQNEIVVMVVMEIIIGQSSG 216

Query: 196 SFVLIIPQETLLKTTLISLSS--QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTL 253
              +  P   L        S        +  +              V I+  +   + TL
Sbjct: 217 MMNICYPVIALEPVLPKLASRDLMLNETSTKKSRNTELHVLLGGAKVGIEAMLGNAELTL 276

Query: 254 KDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKN 313
           +DV+ L+ G ++           +  +GK+ +  ++G      ++++T+ I+ ++ ++K 
Sbjct: 277 RDVLDLQAGDIVRLTSPADDIVTICVDGKDRFRGKIGLRRFRKSVQVTEIIDTERDAVKR 336

Query: 314 FLH 316
            L 
Sbjct: 337 ALE 339


>gi|222100881|ref|YP_002535449.1| Flagellar motor switch protein FliM [Thermotoga neapolitana DSM
           4359]
 gi|221573271|gb|ACM24083.1| Flagellar motor switch protein FliM [Thermotoga neapolitana DSM
           4359]
          Length = 328

 Score =  224 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 46/301 (15%), Positives = 99/301 (32%), Gaps = 15/301 (4%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           +   K   P      ++        K   +    +   + + L      ++   VD+   
Sbjct: 30  EEGEKKVKPYDFKRPSKF------SKEQLRTFQMIHENFGRALSTYLSGRLRTFVDVEI- 82

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
           S     +   I S          +   +  +       +L  T+L+ ++G          
Sbjct: 83  SIDQLTYEEFIRSVMIPSFIVIFTGDVFEGSAIFEMRLDLFYTILDIIMGGPG---DNPP 139

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
           NR+ + +E  + +R +  I  +L Q  S  Q   P++E+       +       NE V  
Sbjct: 140 NRTPTDIETSIMRREVTNILTLLAQAWSDFQYFIPSIENIET--NPQFVQIVPPNEIVLL 197

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQLNV 240
           +  +++     S   +  P   L               +   + E+ ++     +  + +
Sbjct: 198 VTASVSWGEFTSFINVCWPFSLLEPFLEKLSNRFWMMGRKPERIEERVEELKVASQSVPL 257

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            +   I     TL++V+ L+ G VI      K    +   GK  +    G+    Y ++I
Sbjct: 258 TVQAVIGEAWLTLREVLNLQEGDVIRLNTHYKDEIRIDVEGKPKFRGIPGKYKGKYAVKI 317

Query: 301 T 301
           T
Sbjct: 318 T 318


>gi|258511384|ref|YP_003184818.1| flagellar motor switch protein FliM [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
 gi|257478110|gb|ACV58429.1| flagellar motor switch protein FliM [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
          Length = 331

 Score =  223 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 41/314 (13%), Positives = 101/314 (32%), Gaps = 18/314 (5%)

Query: 10  TSPLHPILLAR-----------LTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDV 58
           T  + P    R               +   K   ++   +   + + L      ++    
Sbjct: 19  TGEIDPAAEQRANAHPRVRVYDFRRAMRFSKDHLRVLRRMHEHFCRLLTSQLSGQLRSVP 78

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
            I   S     +   I S     V     +        +  +  +V  +L+  +G     
Sbjct: 79  QIQVESVDQVPYDEFIRSIPPLTVLQVYDMHPLEGRMVMEMNPQVVFAMLDKYMGGDSAG 138

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSN 178
             ++  R L+ +E  L +R    + ++L +   +  +  P           +       N
Sbjct: 139 PYRV--RELTDIEVSLFRRLFENVPSILAEAWKSVIDLDPQFVSLE--SNPQFLQLTTPN 194

Query: 179 EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS--QNKSENQSEDLI-DPFARKT 235
           E V  + +++ +        L IP  T+        +    + +       + D    K 
Sbjct: 195 ETVLVVTISVRVGETTGLINLCIPHVTIEPVLSKLSNRYYMDPAFQSGRRQVNDELRAKL 254

Query: 236 YQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKN 295
             + V++   +   + T+++V+ L  G  I      +  A++  +G+  +   +G+  + 
Sbjct: 255 LSVPVDVRVEVGQAELTVREVLDLCEGDTIVLRQTIRDPALVYVDGRPAFWGSVGKRNRV 314

Query: 296 YTIRITDRINFDQK 309
           Y ++I  +   D  
Sbjct: 315 YAVKIVGQWEADAD 328


>gi|296103632|ref|YP_003613778.1| Flagellar motor switch protein fliM [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295058091|gb|ADF62829.1| Flagellar motor switch protein fliM [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 330

 Score =  223 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 41/301 (13%), Positives = 91/301 (30%), Gaps = 10/301 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
                P  P    R+       +        +   + +         +    DI+  + +
Sbjct: 31  DAGIKPYDPHTQRRVI------RERLHSLEIINERFARQFRMGLFNLLRRSPDITAGNIK 84

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
              +     +       +   L+       +  S  LV   ++NL G       +   R 
Sbjct: 85  IQPYHEFARNLPVPTNLNLLHLNPLRGTSLMAFSPGLVFMAVDNLFGGDGRFPTKADGRE 144

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            +  E+++  R ++          S+  +          I     N     N+ V T   
Sbjct: 145 FTPTEQRVIHRMLSMAREAYEFAWSSIYKIKTEYIRSE-IQVKFTNITSSPNDVVVTTPF 203

Query: 187 NMTIENVASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQLNVNIDTR 245
           ++ I +    F + IP  T+     +  +   + S ++        A +  +  + +  R
Sbjct: 204 SVEIGSHRGEFNICIPFSTIEPLRELLSNPPMDNSRHEDSHWRGLLASQMRETELELTAR 263

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
                T L  V+ +K G +I      +     S  G  +++   G V   Y +++   I 
Sbjct: 264 FADIGTRLSRVMQMKKGDIIALDK--QEFIEASVGGVPVFTARYGAVNNQYALKVEQMIQ 321

Query: 306 F 306
            
Sbjct: 322 P 322


>gi|281411906|ref|YP_003345985.1| flagellar motor switch protein FliM [Thermotoga naphthophila
           RKU-10]
 gi|281373009|gb|ADA66571.1| flagellar motor switch protein FliM [Thermotoga naphthophila
           RKU-10]
          Length = 328

 Score =  223 bits (568), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 43/297 (14%), Positives = 99/297 (33%), Gaps = 15/297 (5%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
           K   P      ++        K   +    +   + + L      ++   VD+   S   
Sbjct: 34  KKVKPYDFKRPSKF------SKEQLRTFQMIHENFGRALSTYLSGRLRTFVDVEI-SIDQ 86

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSL 127
             +   I S          +   +  +       +L  T+L+ ++G          NR  
Sbjct: 87  LTYEEFIRSVMIPSFIVIFTGDIFEGSAIFEMRLDLFYTMLDIIMGGPG---DNPPNRPP 143

Query: 128 STVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMN 187
           + +E  + ++ +  +  +L Q  S  Q   P++E+       +       NE V  +  +
Sbjct: 144 TEIETSIMRKEVTNMLTLLAQAWSDFQYFIPSIENVET--NPQFVQIVPPNEIVLLVTAS 201

Query: 188 MTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDT 244
           ++     S   +  P   L               +   + E+ I+   + + ++ V +  
Sbjct: 202 VSWGEFTSFINVCWPFSLLEPLLEKLSDRFWMMGRKPERVEERIEELKKASQKVPVTVQA 261

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
            I   +  LK+++ L++G VI      K    +   G+  +    G     Y +++T
Sbjct: 262 VIGETELRLKEILDLEVGDVIRLGTHYKDEIRIDVEGRPKFRGIPGVFKGKYAVKVT 318


>gi|91976164|ref|YP_568823.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           BisB5]
 gi|91682620|gb|ABE38922.1| flagellar motor switch protein FliM [Rhodopseudomonas palustris
           BisB5]
          Length = 400

 Score =  223 bits (568), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 39/295 (13%), Positives = 103/295 (34%), Gaps = 4/295 (1%)

Query: 14  HPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHI 73
               +  +            +   +     + +    +     +V++S     S +F   
Sbjct: 87  ENSGIRAIIDSAMVSYERLPMLEIVFDRLVRLMTTSLRNFTSDNVEVSLDRITSVRFGDY 146

Query: 74  IHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGAS-HETIPQLYNRSLSTVEK 132
           ++S     V        W +       ++L+ ++++ LLG    +   ++  R  +T+E 
Sbjct: 147 MNSIPLPAVLCVFKAEEWQNFGLATVDSSLIYSMIDVLLGGRRGQAALRIEGRPYTTIET 206

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            L KR +  + A   Q        + +++        +             + +++ +E+
Sbjct: 207 NLVKRLLQVVLADAEQAFRPLSPVAFSIDRLET--NPRFAAISRPANAAILVRLHIDMED 264

Query: 193 VASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
              +  L++P  T+     + +     +   + +      A +  Q  +++D  +   + 
Sbjct: 265 RGGNIELLLPYATIEPIRGVLMQMFMGEKFGRDQVWEGHLATEVVQAEISVDAVLYEAEV 324

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
            LK ++ L++G  +P   R      +      +    +GRVG    IR+T  +  
Sbjct: 325 PLKQLMALQVGDTLPLDLRADALVAVRCGSVTLTEGRMGRVGDRVAIRVTKPLRR 379


>gi|149194333|ref|ZP_01871430.1| flagellar motor switch protein M [Caminibacter mediatlanticus TB-2]
 gi|149135508|gb|EDM23987.1| flagellar motor switch protein M [Caminibacter mediatlanticus TB-2]
          Length = 356

 Score =  223 bits (568), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 45/304 (14%), Positives = 97/304 (31%), Gaps = 6/304 (1%)

Query: 16  ILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIH 75
           + L          K   +   ++     + L       M   V+I   S     +   + 
Sbjct: 39  VTLYDFKRPNRVSKEQLRSIRAIHDKMVRNLASDISSLMRSIVEIHLHSVDQMTYGEFLM 98

Query: 76  SFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLA 135
           S      F+  SL        I  + ++V  +++ LLG           R  + +E  L 
Sbjct: 99  SLPSPTSFNVFSLKPLDGKGVIELNPSIVFPMIDRLLGGPGLPFENT--REFTDIELNLL 156

Query: 136 KRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVAS 195
            + +  I+  + +  +   E  P +E       +        NE V  I M + I   + 
Sbjct: 157 DQILRTITQNMKEAWAPIMEMYPVIEAKESSPNV--VQIVAQNEIVVMIVMEIVIGQTSG 214

Query: 196 SFVLIIPQETLLKTTLISLSS--QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTL 253
              +  P  T+        S        +  +              V ++  +     T+
Sbjct: 215 MMNICYPVITIESLLPKLASRDLMLSETSSRKSRNKELRALLGGAKVELEAVLGYANLTM 274

Query: 254 KDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKN 313
           ++++ L +G +I          ++  +G+E +  + G       I+I + +  +   +K 
Sbjct: 275 QEILDLVVGDIIKLNRPADDTVVVKVDGREKFIADFGIKRFRRAIKIREILKTEHDEVKE 334

Query: 314 FLHK 317
            L K
Sbjct: 335 ILSK 338


>gi|187778682|ref|ZP_02995155.1| hypothetical protein CLOSPO_02277 [Clostridium sporogenes ATCC
           15579]
 gi|187772307|gb|EDU36109.1| hypothetical protein CLOSPO_02277 [Clostridium sporogenes ATCC
           15579]
          Length = 331

 Score =  223 bits (568), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 43/309 (13%), Positives = 104/309 (33%), Gaps = 13/309 (4%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           +   +   P       +        K   +    +   Y + +      ++  +V +   
Sbjct: 30  EEEKQKVKPYDFKRPQKF------SKDHIRTLELIHDNYARIISNYLTAQVRSNVKVKIE 83

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
           S Q   +   IHS     + +   +   + +     +   V  +++ LLG +     ++ 
Sbjct: 84  SVQQITYEEFIHSVPNPTILTIFKMPPLNGSVLFETNPQFVFQMIDVLLGGNGNGNYKM- 142

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  + ++K + K+    +   L        E    +E          N      E V  
Sbjct: 143 -REFTDIDKNIMKQINTGLITNLKLAWEDVMEVDVEIESLET--NPALNQTLAPTEPVAL 199

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLIS---LSSQNKSENQSEDLIDPFARKTYQLNV 240
           I  ++ +    +   + IP  ++ K           +   E   E+       +   +++
Sbjct: 200 ITFSVEMGKSNTFINICIPYLSIEKVLEKLVVQYWFRENDEESIEESSSKIKERINIVSM 259

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            +   +     T++D + L +G V+    + +    L    +  Y  + G +GKN  ++I
Sbjct: 260 ELTAELGRTSVTVEDFLRLSVGDVVALDTKTEEPVHLLIEKEPGYYAKPGVIGKNIGLQI 319

Query: 301 TDRINFDQK 309
            D+I+ D +
Sbjct: 320 LDQIDKDVE 328


>gi|163852467|ref|YP_001640510.1| flagellar motor switch protein FliM [Methylobacterium extorquens
           PA1]
 gi|218531223|ref|YP_002422039.1| flagellar motor switch protein FliM [Methylobacterium
           chloromethanicum CM4]
 gi|240139804|ref|YP_002964281.1| flagellar motor switch protein FliM [Methylobacterium extorquens
           AM1]
 gi|254562219|ref|YP_003069314.1| flagellar motor switch protein FliM [Methylobacterium extorquens
           DM4]
 gi|163664072|gb|ABY31439.1| flagellar motor switch protein FliM [Methylobacterium extorquens
           PA1]
 gi|218523526|gb|ACK84111.1| flagellar motor switch protein FliM [Methylobacterium
           chloromethanicum CM4]
 gi|240009778|gb|ACS41004.1| flagellar motor switch protein FliM [Methylobacterium extorquens
           AM1]
 gi|254269497|emb|CAX25463.1| flagellar motor switch protein FliM [Methylobacterium extorquens
           DM4]
          Length = 406

 Score =  223 bits (568), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 36/285 (12%), Positives = 98/285 (34%), Gaps = 4/285 (1%)

Query: 30  TIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLS 89
               +   +     + L    +     +V+++  +  S +F   +++     +       
Sbjct: 112 ERLPMLEIVFDRMIRLLSTSLRNFFQDNVEVTLDNITSVRFGDYLNAIPLPTLLGVFKAD 171

Query: 90  SWSSNFFIGCSNNLVITLLENLLGA-SHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQ 148
           +W  +  +     L  + ++ LLG     +  +L  R  +T+E  L +R +  I   L  
Sbjct: 172 AWEGSGLVTVEQTLAYSTMDLLLGGKRGGSSSRLDGRPFTTIEMSLVRRLVEIILTDLEL 231

Query: 149 CISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLK 208
                      ++        +  T          I + + ++       ++ P  T+  
Sbjct: 232 SFQPLSPVRFGIDRIET--NPRFATITRPGNAAILITLKLDMDGRGGGMQILFPYATVEP 289

Query: 209 TTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPF 267
              +   S   +   + +      A + +Q +V+++  ++     LK V+ LK+G  + F
Sbjct: 290 IRDLLMQSFMGERLGRDQVWESHLATEIWQADVDMEAVLHEVTLPLKRVLNLKVGDTLMF 349

Query: 268 LHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLK 312
             +      +      +    +GR+     ++I   +   + +L+
Sbjct: 350 DRKPSDLITVRCGDWALTQGRIGRIDDAIAVQIARPLRQSRTTLQ 394


>gi|254519440|ref|ZP_05131496.1| flagellar motor switch protein FliM [Clostridium sp. 7_2_43FAA]
 gi|226913189|gb|EEH98390.1| flagellar motor switch protein FliM [Clostridium sp. 7_2_43FAA]
          Length = 331

 Score =  222 bits (567), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 40/283 (14%), Positives = 96/283 (33%), Gaps = 7/283 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +    +   + + +      ++   V +   S +   +   +HS     + +   
Sbjct: 48  SKDHIRTLEMVHDAFARIISNYLSGQLRKHVKVDIQSVEQITYEEFVHSIANPTILTIFK 107

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +     N  +  +      +L+ LLG + +   +   +  S ++K +     +++   L 
Sbjct: 108 MPPLQGNILLEMNPQFSFQILDILLGGTGDRDEK--AKEFSEIDKNILANITSEMIKSLI 165

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
                  E  P  E          N     NE V  ++  + +    +   L IP  ++ 
Sbjct: 166 LAWDGILEVKPEFEGLET--NPSANQTLAPNEPVALLSFLVELGKSTTYMNLCIPYLSVE 223

Query: 208 KTTLIS---LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
           K           +       ++  +   +    + VN+   +   + T+ D + L  G V
Sbjct: 224 KVLDKLVVQYWFKTDESELEDEAREKLKKGLDPVKVNMHVELGKTEITVDDFLELVNGDV 283

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
           +    +      +    +E +  + G VGKN  I++ D ++ D
Sbjct: 284 LVLNSQYSDPVRVFVENEECFIAKPGIVGKNMGIQLLDILDKD 326


>gi|218288306|ref|ZP_03492605.1| flagellar motor switch protein FliM [Alicyclobacillus
           acidocaldarius LAA1]
 gi|218241665|gb|EED08838.1| flagellar motor switch protein FliM [Alicyclobacillus
           acidocaldarius LAA1]
          Length = 331

 Score =  222 bits (567), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 41/314 (13%), Positives = 101/314 (32%), Gaps = 18/314 (5%)

Query: 10  TSPLHPILLAR-----------LTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDV 58
           T  + P    R               +   K   ++   +   + + L      ++    
Sbjct: 19  TGEIDPAAEQRANAHPRVRVYDFRRAMRFSKDHLRVLRRMYEHFCRLLTSQLSGQLRSVP 78

Query: 59  DISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHET 118
            I   S     +   I S     V     +        +  +  +V  +L+  +G     
Sbjct: 79  QIQVESVDQVPYDEFIRSIPPLTVLQVYDMHPLEGRMVMEMNPQVVFAMLDKYMGGDSAG 138

Query: 119 IPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSN 178
             ++  R L+ +E  L +R    + ++L +   +  +  P           +       N
Sbjct: 139 PYRV--RELTDIEVSLFRRLFENVPSILAEAWKSVIDLDPQFVSLE--SNPQFLQLTTPN 194

Query: 179 EFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS--QNKSENQSEDLI-DPFARKT 235
           E V  + +++ +        L IP  T+        +    + +       + D    K 
Sbjct: 195 ETVLVVTISVRVGETTGLINLCIPHVTIEPVLSKLSNRYYMDPAFQSGRRQVNDELRAKL 254

Query: 236 YQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKN 295
             + V++   +   + T+++V+ L  G  I      +  A++  +G+  +   +G+  + 
Sbjct: 255 LSVPVDVRVEVGQAELTVREVLDLCEGDTIVLRQTIRDPALVYVDGRPAFWGSVGKRNRV 314

Query: 296 YTIRITDRINFDQK 309
           Y ++I  +   D  
Sbjct: 315 YAVKIVGQWEADAD 328


>gi|85715055|ref|ZP_01046040.1| flagellar motor switch protein [Nitrobacter sp. Nb-311A]
 gi|85698252|gb|EAQ36124.1| flagellar motor switch protein [Nitrobacter sp. Nb-311A]
          Length = 400

 Score =  222 bits (566), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 43/295 (14%), Positives = 102/295 (34%), Gaps = 4/295 (1%)

Query: 14  HPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHI 73
               +  +            +   +     + +    +     +V++S     S +F   
Sbjct: 87  DNSGIRAIIDSAMVSYERLPMLEIVFDRLVRLMTTSLRNFTSDNVEVSLDRITSVRFGDY 146

Query: 74  IHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGAS-HETIPQLYNRSLSTVEK 132
           ++S     V S      W +       ++L+ ++++ LLG    +T  ++  R  +T+E 
Sbjct: 147 LNSIPLPAVLSVFKAEEWENFGLAMVDSSLIYSMIDVLLGGRRGQTSLRIEGRPYTTIET 206

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            L KR +  + A   Q        S +++        +             + + + +E+
Sbjct: 207 NLVKRLVEVVLADAEQAFRPLSPVSFSIDRLET--NPRFAAITRPANAAILVRLRIDMED 264

Query: 193 VASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
              +  L++P  T+     + L     +   +        A +  Q  + +D  +   + 
Sbjct: 265 RGGTIELLLPYATIEPIRNVLLQMFMGEKFGRDPIWESHLATEIAQAQIAVDAVLYEAEI 324

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
            LK ++TLK+G  +    R      +      +    +GRVG    IR++  +  
Sbjct: 325 PLKQLMTLKVGDTLALEMRPDASVAVRCGSVTLTEGRMGRVGDRVAIRVSRNLRK 379


>gi|78357750|ref|YP_389199.1| flagellar motor switch protein FliM [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|78220155|gb|ABB39504.1| flagellar motor switch protein FliM [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 326

 Score =  222 bits (566), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 41/289 (14%), Positives = 87/289 (30%), Gaps = 10/289 (3%)

Query: 13  LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSH 72
                  R+            +   +   + +         +   V+++  S    KF  
Sbjct: 38  FDLANQDRIIRG------RMPVLEIVNDRFARLCTNALSNAVRKRVELNPISIDMTKFGD 91

Query: 73  IIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEK 132
            + S       +   +     N  I   + LV  L+EN  G +     ++  R  + +E+
Sbjct: 92  FMRSLPVPTSINIFKMEPLRGNAIIVVDSRLVFALVENFFGGAGSQP-KIEGREFTRIEQ 150

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            +  R I      + +      E +  L         +       ++ V  I   + +E+
Sbjct: 151 AIVDRVIKIALDNMEESWRPVHEVNLELVR--SEINPQFAAIVPPSDVVVVITFEVELES 208

Query: 193 VASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
              S V+ +P  T+         S Q +        +     +  +  V +  R    K 
Sbjct: 209 AIGSLVMCLPYATIEPIRSKLHASFQTERLEVDHAWVARLKERLLETPVEMKIRFGETKI 268

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
           T   ++ LK+G V+            +  G   +    G V  N   ++
Sbjct: 269 TGNQLLRLKVGDVLLLDTDTDDLLEGTVEGVRKFWGISGIVKANKAFQV 317


>gi|315498450|ref|YP_004087254.1| flagellar motor switch protein flim [Asticcacaulis excentricus CB
           48]
 gi|315416462|gb|ADU13103.1| flagellar motor switch protein FliM [Asticcacaulis excentricus CB
           48]
          Length = 387

 Score =  222 bits (566), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 38/307 (12%), Positives = 105/307 (34%), Gaps = 5/307 (1%)

Query: 14  HPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHI 73
               +  +            +   +     + +    +     +V++S  +  S +F   
Sbjct: 83  ERSGIRAIINSAMVSYERLPMLEIVFDRLVRLMTTSLRNFTSDNVEVSLDNISSIRFGDY 142

Query: 74  IHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGAS-HETIPQLYNRSLSTVEK 132
           ++S     + +        +   +   +NL+ ++++ LLG        ++  R  +T+E+
Sbjct: 143 LNSIPLPAILAVFRAEELDNYGLLTVDSNLIYSIVDVLLGGRRGTAALRIEGRPYTTIER 202

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            L +R +  I              + NL+        +             + + + +E+
Sbjct: 203 VLVQRMVEVILHDAKMAFEPLTPVNFNLDRLET--NPRFAAIARPANAAILVKLRIDMED 260

Query: 193 VASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
                 L++P  TL     ++      +   +        A + +   + +   ++ ++ 
Sbjct: 261 RGGRVELLLPYATLEPIRKMLLQQFMGEKFGRDNIWESHLATELWTTQMEVRAVLDEQQM 320

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI-NFDQKS 310
            L +V+ LK+G+ I       +   L      + + ++GR G N  +R+   +    ++ 
Sbjct: 321 PLSEVLNLKVGETIVLNATADSPIELRCGTIPLTNGKMGRKGHNIAVRVDHPLAASTKRR 380

Query: 311 LKNFLHK 317
           L     K
Sbjct: 381 LTQIRKK 387


>gi|295097219|emb|CBK86309.1| flagellar motor switch protein FliM [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 330

 Score =  222 bits (565), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 38/304 (12%), Positives = 94/304 (30%), Gaps = 10/304 (3%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           + G        P  P    R+       +        +   + +         +    DI
Sbjct: 25  LHGSMGDAGIKPYDPNTQRRVI------RERLHSLEIINERFARQFRMGLFNLLRRSSDI 78

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           +  + +   +     +       +   L+       +  S+ LV   ++NL G       
Sbjct: 79  TAGNIKIQPYHEFARNLPVPTNLNLLHLNPLRGTALMAFSSGLVFMAVDNLFGGDGRFPT 138

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           +   R  +  E+++  R +            +  +          I     N     N+ 
Sbjct: 139 KADGREFTPTEQRVIHRMLTMAREAYEFAWGSIYKIKTEYIRSE-IQVKFTNITSSPNDV 197

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQLN 239
           V T   ++ I +    F + IP  T+     +  +   + S ++  +     A +  +  
Sbjct: 198 VVTTPFSVEIGSHRGEFNICIPFSTIEPLRELLSNPPMDNSRHEDSEWRSMLASQMRETE 257

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           + +  +     T L +V+ +K G +IP     +     +     +++ + G V   Y ++
Sbjct: 258 LELVAQFADINTRLSNVMKMKKGDIIPLDK--QEFIEANVGSVPVFTAKYGSVNNQYALK 315

Query: 300 ITDR 303
           +   
Sbjct: 316 VDRM 319


>gi|157164910|ref|YP_001467212.1| flagellar motor switch protein FliM [Campylobacter concisus 13826]
 gi|112799933|gb|EAT97277.1| flagellar motor switch protein FliM [Campylobacter concisus 13826]
          Length = 367

 Score =  222 bits (565), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 48/303 (15%), Positives = 100/303 (33%), Gaps = 6/303 (1%)

Query: 17  LLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHS 76
           ++          K   +    +     + L       M   V++   S     +   + S
Sbjct: 40  IIYDFKRPNRVSKEQLRAIKGIHDKLARNLASQISSVMRSIVELRLHSVDQMTYGEFLMS 99

Query: 77  FKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAK 136
                 F+  S+     N  +  + ++   +++ LLG + E      NR L+ +E  L  
Sbjct: 100 LPSPTSFNVFSIKPLDGNCILEINPSIAFPMIDRLLGGTGENFE--ANRELTDIEVNLLD 157

Query: 137 RTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASS 196
             +  I   L +  S   +  PN+E       +        NE V  + M + +   +  
Sbjct: 158 AVLRMIMQRLKESWSMITDMYPNVEAKESSPNV--VQIVSQNEIVIMVVMEIIVGGSSGM 215

Query: 197 FVLIIPQETLLKTTLISLSS--QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLK 254
             L  P   L        +        +  +           +  V  +  +     ++ 
Sbjct: 216 INLCYPVIYLEPILSRLANRDIMLGETSAKKSRNKELKTLIGRAEVLYEAILGKSIVSVN 275

Query: 255 DVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
           + + LK G ++         AI+  + KE++  E+G      +I+I   I  D+  +K+ 
Sbjct: 276 EFLNLKEGDILRLDRGADDKAIVCIDKKEVFLAEVGLHRFRKSIKIEQLIRSDKDEIKHI 335

Query: 315 LHK 317
           L K
Sbjct: 336 LEK 338


>gi|57168742|ref|ZP_00367873.1| flagellar motor switch protein FliM [Campylobacter coli RM2228]
 gi|305432516|ref|ZP_07401678.1| flagellar motor switch protein FliM [Campylobacter coli JV20]
 gi|57019789|gb|EAL56472.1| flagellar motor switch protein FliM [Campylobacter coli RM2228]
 gi|304444555|gb|EFM37206.1| flagellar motor switch protein FliM [Campylobacter coli JV20]
          Length = 358

 Score =  221 bits (564), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 46/292 (15%), Positives = 99/292 (33%), Gaps = 6/292 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +    +     + L       M   V+    S     +   + S      F+  S
Sbjct: 49  SKEQLRTIKGIHDKLARNLASQISSMMRSIVETKLHSVDQMTYGEFLMSLPSPTSFNVFS 108

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +     N  +  + ++   +++ LLG   ++     +R L+ +E  L    +  I   L 
Sbjct: 109 IKPLDGNCVLEINPSIAFPMIDRLLGGQGDSYE--ASRELTDIELNLLDSILRIIMQRLK 166

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  +T  E  P++E       +        NE V  + M + I N +    +  P   L 
Sbjct: 167 ESWATVTEIYPSIEAKESSPNV--VQIVSQNEIVIMVVMEIIIGNSSGMVNICYPVVHLE 224

Query: 208 KTTLISLSS--QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVI 265
                  +        +  +           +  V  +  +      + + + LK G ++
Sbjct: 225 SILSRLANRDIMMGETSAKKSRNKELKTLIGRAEVVYEAILGKTLINVHEFLELKQGDIL 284

Query: 266 PFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLHK 317
                    AI+S + K+++  ++G      +I+I + I  D+  +K  L K
Sbjct: 285 RLDREADDKAIVSIDKKDVFLAQIGLHRFRKSIKILELIRTDKDEIKEILEK 336


>gi|259907613|ref|YP_002647969.1| flagellar motor switch protein FliM [Erwinia pyrifoliae Ep1/96]
 gi|224963235|emb|CAX54719.1| Flagellar motor switch protein FliM [Erwinia pyrifoliae Ep1/96]
 gi|310764881|gb|ADP09831.1| Flagellar motor switch protein FliM [Erwinia sp. Ejp617]
          Length = 332

 Score =  221 bits (564), Expect = 9e-56,   Method: Composition-based stats.
 Identities = 40/304 (13%), Positives = 90/304 (29%), Gaps = 10/304 (3%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
            S+ +   P  P    R+       +        +   + +         +    DI+  
Sbjct: 30  GSVTREAQPYDPHTQRRVI------RERLHSLEIINERFARQFRMGLFNLLRRSPDITAG 83

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
           + +   +     +       +   L+       +  S  +V   ++NL G       +  
Sbjct: 84  NIKIQPYHEFARNLPVPTNLNLLHLNPLRGTSLMAFSPGVVFMAVDNLFGGDGRFPTKAD 143

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  +  E+++  R +           ST  +          I     N     N+ V T
Sbjct: 144 GREFTPTEQRVIHRMLTMAQEAYEFAWSTIFKIKTEYIRSE-IQVKFTNITSSPNDVVVT 202

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQLNVNI 242
              ++ I +    F + IP  ++     +  +     S  +          +  +  + +
Sbjct: 203 TPFSIEIGSHQGEFNICIPFSSIEPLRELLSNPPMENSGQEDTQWRGLLVSQMRETELEL 262

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
                   T L +V+  K G VIP           S  G  +++ + G V   + +++  
Sbjct: 263 VATFPDVPTRLTNVMKFKKGDVIPLDKP--ELIAASVGGVPVFTAKYGSVNNQFALKVEQ 320

Query: 303 RINF 306
            I  
Sbjct: 321 MIPS 324


>gi|283477455|emb|CAY73371.1| Flagellar motor switch protein FliM [Erwinia pyrifoliae DSM 12163]
          Length = 334

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 40/304 (13%), Positives = 90/304 (29%), Gaps = 10/304 (3%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
            S+ +   P  P    R+       +        +   + +         +    DI+  
Sbjct: 32  GSVTREAQPYDPHTQRRVI------RERLHSLEIINERFARQFRMGLFNLLRRSPDITAG 85

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
           + +   +     +       +   L+       +  S  +V   ++NL G       +  
Sbjct: 86  NIKIQPYHEFARNLPVPTNLNLLHLNPLRGTSLMAFSPGVVFMAVDNLFGGDGRFPTKAD 145

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  +  E+++  R +           ST  +          I     N     N+ V T
Sbjct: 146 GREFTPTEQRVIHRMLTMAQEAYEFAWSTIFKIKTEYIRSE-IQVKFTNITSSPNDVVVT 204

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQLNVNI 242
              ++ I +    F + IP  ++     +  +     S  +          +  +  + +
Sbjct: 205 TPFSIEIGSHQGEFNICIPFSSIEPLRELLSNPPMENSGQEDTQWRGLLVSQMRETELEL 264

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
                   T L +V+  K G VIP           S  G  +++ + G V   + +++  
Sbjct: 265 VATFPDVPTRLTNVMKFKKGDVIPLDKP--ELIAASVGGVPVFTAKYGSVNNQFALKVEQ 322

Query: 303 RINF 306
            I  
Sbjct: 323 MIPS 326


>gi|292489155|ref|YP_003532042.1| flagellar motor switch protein FliM [Erwinia amylovora CFBP1430]
 gi|292900273|ref|YP_003539642.1| flagellar motor switch protein [Erwinia amylovora ATCC 49946]
 gi|291200121|emb|CBJ47247.1| flagellar motor switch protein [Erwinia amylovora ATCC 49946]
 gi|291554589|emb|CBA22223.1| Flagellar motor switch protein FliM [Erwinia amylovora CFBP1430]
 gi|312173313|emb|CBX81568.1| Flagellar motor switch protein FliM [Erwinia amylovora ATCC
           BAA-2158]
          Length = 334

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 41/304 (13%), Positives = 90/304 (29%), Gaps = 10/304 (3%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
            S+ +   P  P    R+       +        +   + +         +    DI+  
Sbjct: 32  GSVAREAQPYDPHTQRRVI------RERLHSLEIINERFARQFRMGLFNLLRRSPDITAG 85

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
           + +   +     +       +   L+       +  S  +V   ++NL G       +  
Sbjct: 86  NIKIQPYHEFARNLPVPTNLNLLHLNPLRGTSLMAFSPGVVFMAVDNLFGGDGRFPTKAD 145

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  +  E+++  R +           ST  +          I     N     N+ V T
Sbjct: 146 GREFTPTEQRVIHRMLTMAQEAYEFAWSTIFKIKTEYIRSE-IQVKFTNITSSPNDVVVT 204

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQLNVNI 242
               + I +    F + IP  ++     +  +     S  +          +  +  + +
Sbjct: 205 TPFFIEIGSHQGEFNICIPFSSIEPLRELLSNPPMENSGQEDTQWRGLLVSQMRETELEL 264

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
                   T L +V+ LK G VIP           S  G  +++ + G V   + +++  
Sbjct: 265 VATFPDLPTRLTNVMKLKKGDVIPLDKP--ELIAASVGGVPVFTAKYGSVNNQFALKVEQ 322

Query: 303 RINF 306
            I  
Sbjct: 323 MIPS 326


>gi|169831883|ref|YP_001717865.1| flagellar motor switch protein FliM [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169638727|gb|ACA60233.1| flagellar motor switch protein FliM [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 332

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 37/301 (12%), Positives = 97/301 (32%), Gaps = 8/301 (2%)

Query: 15  PILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHII 74
           P  L          K   +   ++   Y + L       +   + +   S     F   +
Sbjct: 35  PYKLYDFRRPNKFSKEQLRTLQTVHEGYARILSNFLSGYLRSTIVVRVASVDQFTFDDFV 94

Query: 75  HSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKL 134
            S     V +  +L        +  +   +  +++ L G   E   ++  R L+ +E  +
Sbjct: 95  RSVPIPTVLTIITLKPLKGMAVMETNPQFLFPIIDLLFGGPGEPPKRV--RELTDIELSV 152

Query: 135 AKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVA 194
            ++   ++               P +E        + +     +E V  I +   +   A
Sbjct: 153 VRKLNKKLLENFQLAWQDIYRMEPEIESVET--NPRLHQIISPSEIVAVITLTAVVGATA 210

Query: 195 -SSFVLIIPQETLLKTTLISLSS---QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKK 250
                + +P   L    +   S     + +                +  V +   +   +
Sbjct: 211 RGLINICLPHIMLDPVLMHLSSFYRHVHGALVPDGTEGKRMEYWIERAPVELSAVVGESE 270

Query: 251 TTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
            T++D++ L++G V+P   R      L  + +  +  + G +G+   +++T  +    ++
Sbjct: 271 ITVQDLLQLQVGDVVPLSRRVTQDLDLYVSDQLKFKAQAGVLGRYLAVQVTSLVEGGDRA 330

Query: 311 L 311
           +
Sbjct: 331 V 331


>gi|51894145|ref|YP_076836.1| flagellar motor switch protein [Symbiobacterium thermophilum IAM
           14863]
 gi|51857834|dbj|BAD41992.1| flagellar motor switch protein [Symbiobacterium thermophilum IAM
           14863]
          Length = 308

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 42/278 (15%), Positives = 89/278 (32%), Gaps = 6/278 (2%)

Query: 29  KTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASL 88
           K + +    +     + L       +   V I+  S     FS          +     L
Sbjct: 34  KDLIRTLVLVHENLARLLQSYLSAGLRTWVQITVRSTNQYTFSEFTQLLPNPTIALSFRL 93

Query: 89  SSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQ 148
           +       +  S+N+   ++E + G           R L+ +E  + +R +      + +
Sbjct: 94  NPLPGMCLLEISHNIAFAIVERVFGGPGS--DLQPQRELTEIELGIIQRVVRDTFGPMKE 151

Query: 149 CISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLK 208
                 E  P +E                 E V  I + + I           P  T+  
Sbjct: 152 AWRNVAEIDPAIEAVET--NPVFIQIENPTEVVAAITLAVEIGEHLGHMTFAFPYSTVEP 209

Query: 209 T--TLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIP 266
               L   S   +++++S    +   R   +  + +   +   +  L + + L++G VI 
Sbjct: 210 VLSRLSPQSWLAETKHKSPSDEESLRRAVQEAPLPVKALLGKTRMRLGEFLALQVGDVIR 269

Query: 267 FLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
              R      +    K  +  + G VG+   ++IT R+
Sbjct: 270 LDARVGGELPVFVGNKLAFQAKPGVVGERMAVQITRRV 307


>gi|153951200|ref|YP_001397325.1| flagellar motor switch protein FliM [Campylobacter jejuni subsp.
           doylei 269.97]
 gi|152938646|gb|ABS43387.1| flagellar motor switch protein FliM [Campylobacter jejuni subsp.
           doylei 269.97]
          Length = 359

 Score =  221 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 46/292 (15%), Positives = 99/292 (33%), Gaps = 6/292 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +    +     + L       M   V+    S     +   + S      F+  S
Sbjct: 50  SKEQLRTIKGIHDKLARNLASQISSMMRSIVETKLHSVDQMTYGEFLMSLPSPTSFNVFS 109

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +     N  +  + ++   +++ LLG   ++     +R L+ +E  L    +  I   L 
Sbjct: 110 IKPLDGNCVLEINPSIAFPMIDRLLGGQGDSYE--ASRELTDIELNLLDSILRIIMQRLK 167

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  +T  E  P++E       +        NE V  + M + I N +    +  P   L 
Sbjct: 168 ESWATVTEIYPSIEAKESSPNV--VQIVSQNEIVIMVVMEIIIGNSSGMVNICYPVVHLE 225

Query: 208 KTTLISLSS--QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVI 265
                  +        +  +           +  V  +  +      + + + LK G ++
Sbjct: 226 SILSRLANRDIMMGETSAKKSRNKELKTLIGRAEVVYEAILGKTLINVHEFLELKQGDIL 285

Query: 266 PFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLHK 317
                    AI+S + K+++  ++G      +I+I + I  D+  +K  L K
Sbjct: 286 RLDREADDKAIVSIDKKDVFLAQIGLHRFRKSIKILELIRTDKDEIKEILEK 337


>gi|260772330|ref|ZP_05881246.1| flagellar motor switch protein FliM [Vibrio metschnikovii CIP
           69.14]
 gi|260611469|gb|EEX36672.1| flagellar motor switch protein FliM [Vibrio metschnikovii CIP
           69.14]
          Length = 281

 Score =  221 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 34/257 (13%), Positives = 84/257 (32%), Gaps = 5/257 (1%)

Query: 53  KMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLL 112
            +    ++S    Q  KF    ++       +            +     LV  L+EN  
Sbjct: 1   MLRKTAEVSINGVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALVTMEARLVFILVENFF 60

Query: 113 GASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKN 172
           G       ++  R  +  E+++ +  +  + A   +  S         E           
Sbjct: 61  GGDGRYHARIEGREFTPTERRVIQLLLKIVFADYKEAWSPVMGVE--FEYLDSEVNPSMA 118

Query: 173 TNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPF 231
                 E +   + ++ ++     F +++P   +     +  +  Q+             
Sbjct: 119 NIVSPTEVIVVCSFHIEVDGGGGDFHMVMPYSMVEPIRELLDAGVQSDKMETDVRWSSAL 178

Query: 232 ARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGR 291
             +   + +N    +  +   L+D++ L++G +IP        AI+       Y  ++GR
Sbjct: 179 RDEIMDVPINFRVNLLEQDIALRDLMDLQVGDIIPIKMP--EHAIMFVEELPTYRVKMGR 236

Query: 292 VGKNYTIRITDRINFDQ 308
            G    ++I+ +I   +
Sbjct: 237 SGDKLAVQISQKIKRPE 253


>gi|57237070|ref|YP_178082.1| flagellar motor switch protein FliM [Campylobacter jejuni RM1221]
 gi|86149575|ref|ZP_01067805.1| flagellar motor switch protein FliM [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|86151492|ref|ZP_01069707.1| flagellar motor switch protein FliM [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|86154028|ref|ZP_01072229.1| flagellar motor switch protein FliM [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|88597737|ref|ZP_01100970.1| flagellar motor switch protein FliM [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|121613064|ref|YP_999786.1| flagellar motor switch protein FliM [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|148926866|ref|ZP_01810544.1| flagellar motor switch protein [Campylobacter jejuni subsp. jejuni
           CG8486]
 gi|157414374|ref|YP_001481630.1| flagellar motor switch protein FliM [Campylobacter jejuni subsp.
           jejuni 81116]
 gi|167004761|ref|ZP_02270519.1| flagellar motor switch protein [Campylobacter jejuni subsp. jejuni
           81-176]
 gi|205356443|ref|ZP_03223207.1| flagellar motor switch protein [Campylobacter jejuni subsp. jejuni
           CG8421]
 gi|218561745|ref|YP_002343524.1| flagellar motor switch protein FliM [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|283955504|ref|ZP_06372999.1| flagellar motor switch protein FliM [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|315123665|ref|YP_004065669.1| flagellar motor switch protein [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
 gi|57165874|gb|AAW34653.1| flagellar motor switch protein FliM [Campylobacter jejuni RM1221]
 gi|85839843|gb|EAQ57102.1| flagellar motor switch protein FliM [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|85841839|gb|EAQ59086.1| flagellar motor switch protein FliM [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|85842442|gb|EAQ59656.1| flagellar motor switch protein FliM [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|87248986|gb|EAQ71948.1| flagellar motor switch protein FliM [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|88190041|gb|EAQ94017.1| flagellar motor switch protein FliM [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|112359451|emb|CAL34234.1| flagellar motor switch protein [Campylobacter jejuni subsp. jejuni
           NCTC 11168]
 gi|145844443|gb|EDK21551.1| flagellar motor switch protein [Campylobacter jejuni subsp. jejuni
           CG8486]
 gi|157385338|gb|ABV51653.1| flagellar motor switch protein [Campylobacter jejuni subsp. jejuni
           81116]
 gi|205345630|gb|EDZ32269.1| flagellar motor switch protein [Campylobacter jejuni subsp. jejuni
           CG8421]
 gi|283792965|gb|EFC31739.1| flagellar motor switch protein FliM [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|284925356|gb|ADC27708.1| flagellar motor switch protein FliM [Campylobacter jejuni subsp.
           jejuni IA3902]
 gi|307747020|gb|ADN90290.1| Flagellar motor switch protein FliM [Campylobacter jejuni subsp.
           jejuni M1]
 gi|315017387|gb|ADT65480.1| flagellar motor switch protein [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
 gi|315057501|gb|ADT71830.1| Flagellar motor switch protein FliM [Campylobacter jejuni subsp.
           jejuni S3]
 gi|315927743|gb|EFV07070.1| flagellar motor switch protein FliM [Campylobacter jejuni subsp.
           jejuni DFVF1099]
 gi|315929164|gb|EFV08389.1| flagellar motor switch protein FliM [Campylobacter jejuni subsp.
           jejuni 305]
 gi|315931622|gb|EFV10587.1| Flagellar motor switch protein FliM [Campylobacter jejuni subsp.
           jejuni 327]
          Length = 359

 Score =  221 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 46/292 (15%), Positives = 99/292 (33%), Gaps = 6/292 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +    +     + L       M   V+    S     +   + S      F+  S
Sbjct: 50  SKEQLRTIKGIHDKLARNLASQISSMMRSIVETKLHSVDQMTYGEFLMSLPSPTSFNVFS 109

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +     N  +  + ++   +++ LLG   ++     +R L+ +E  L    +  I   L 
Sbjct: 110 IKPLDGNCVLEINPSIAFPMIDRLLGGQGDSYE--ASRELTDIELNLLDSILRIIMQRLK 167

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  +T  E  P++E       +        NE V  + M + I N +    +  P   L 
Sbjct: 168 ESWATVTEIYPSIEAKESSPNV--VQIVSQNEIVIMVVMEIIIGNSSGMVNICYPVVHLE 225

Query: 208 KTTLISLSS--QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVI 265
                  +        +  +           +  V  +  +      + + + LK G ++
Sbjct: 226 SILSRLANRDIMMGETSAKKSRNKELKTLIGRAEVVYEAILGKTLINVHEFLELKQGDIL 285

Query: 266 PFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLHK 317
                    AI+S + K+++  ++G      +I+I + I  D+  +K  L K
Sbjct: 286 RLDREADDKAIVSIDKKDVFLAQIGLHRFRKSIKILELIRTDKDEIKEILEK 337


>gi|302383953|ref|YP_003819776.1| flagellar motor switch protein FliM [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302194581|gb|ADL02153.1| flagellar motor switch protein FliM [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 356

 Score =  221 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 36/282 (12%), Positives = 98/282 (34%), Gaps = 4/282 (1%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
                 +   +     + +    +     +V++S  +  S +F   ++S     + +   
Sbjct: 67  SYERLPMLEIVFDRLVRLMTTSLRNFTSDNVEVSLDNISSIRFGDYLNSIPLPAILAVFR 126

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGAS-HETIPQLYNRSLSTVEKKLAKRTIAQISAVL 146
                +   +   +NL+ ++++ LLG        ++  R  +T+E+ L +R +  I A  
Sbjct: 127 AEELDNYGLLTVDSNLIYSIVDVLLGGRRGTAALRIEGRPYTTIERVLVQRMVEVILADA 186

Query: 147 NQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL 206
                       NL+        +             + + + +E+      L++P  TL
Sbjct: 187 QAAFEPLTPVHFNLDRLET--NPRFAAIARPANAAILVKLRIDMEDRGGRVELLLPYATL 244

Query: 207 LKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVI 265
                ++      +   +        A + +  +  +   ++ +   L  V+ LK+G  +
Sbjct: 245 EPIRKMLLQQFMGEKFGRDNIWEGHLATELWTTDTEVRAVLDEQSCPLSTVLNLKVGDTL 304

Query: 266 PFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
                  +   +      + +  +GR G++  IR+   I+ +
Sbjct: 305 MLNATPDSDISIRCGSIPVTTGRMGRKGQHIAIRVEGPISVE 346


>gi|154253006|ref|YP_001413830.1| flagellar motor switch protein FliM [Parvibaculum lavamentivorans
           DS-1]
 gi|154156956|gb|ABS64173.1| flagellar motor switch protein FliM [Parvibaculum lavamentivorans
           DS-1]
          Length = 374

 Score =  221 bits (562), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 38/280 (13%), Positives = 101/280 (36%), Gaps = 4/280 (1%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
                 +   +     + +    +     +V++S  +  S +F   ++S     + +   
Sbjct: 63  SYERLPMLEIVFDRLVRLMTVSLRNFTSDNVEVSLDNVSSIRFGDYLNSIPLPAILAVFR 122

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGAS-HETIPQLYNRSLSTVEKKLAKRTIAQISAVL 146
              W +       +NL+ ++++ LLG        ++  R  +T+E  L +R I  +   +
Sbjct: 123 AKQWDNYGMFTVDSNLIYSIVDVLLGGRRGTAAMRIEGRPYTTIELNLVQRMIEVVLQDV 182

Query: 147 NQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL 206
                     +  L+        +             + + + +E+      L++P  TL
Sbjct: 183 QSAFEPLSPVTLELDRMET--NPRFAAIARPANAAILVKLRVDMEDRGGRIELLLPYATL 240

Query: 207 LKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVI 265
                + L     +   +        A + +   V ++  ++ ++ +L++V+  ++GQ +
Sbjct: 241 EPIRELLLQMFMGEKFGRDTIWESHLATELWATKVPLEAVLDEQQLSLREVMDFRVGQTL 300

Query: 266 PFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
                 +    L   G  +   ++GRVG +  +R+   I 
Sbjct: 301 MLNSGPEGAIDLRCGGVRLGKGKMGRVGNHVAVRVEQAIK 340


>gi|301165893|emb|CBW25466.1| flagellar motor switch protein FliM [Bacteriovorax marinus SJ]
          Length = 343

 Score =  221 bits (562), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 34/296 (11%), Positives = 89/296 (30%), Gaps = 9/296 (3%)

Query: 9   NTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSG 68
           N          R+            I   +   + +         +     IS  S    
Sbjct: 43  NIQAYDLTNQDRVIRG------RMPILEIISERFIRSFRVSLSNSLRKISTISMISTDLL 96

Query: 69  KFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           KF   +++            +       +   + L   ++++  G +     ++  +  +
Sbjct: 97  KFGEFVNTLPIPSCMCIMRFNELRGPALLVFESKLAYAIIDSYFGGTDRPFTKIEGKEFT 156

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
            +E    K+ +      L +  +                  +       ++ +    + +
Sbjct: 157 MIELSFMKKVMDMAINDLEEAWAPVHRIDAQ--YLRTEINPQFVGVVPPSDVIIATTLEV 214

Query: 189 TIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRIN 247
             E+ + + ++++P  T+         S Q  ++               Q +  +  ++ 
Sbjct: 215 EFESASGTIMIVVPYSTIEPIKQKLSSSFQTDNDMADSIWTQAMNEHIKQAHATMVVKLG 274

Query: 248 LKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
               T+ D+VTL+ G +IP         ++   G E   C +G    N  ++IT+ 
Sbjct: 275 ETNITVGDLVTLEKGDIIPLNQEASGEVVVEVEGVEKMKCLIGTHKGNRAVQITNV 330


>gi|283955445|ref|ZP_06372943.1| flagellar motor switch protein [Campylobacter jejuni subsp. jejuni
           414]
 gi|283793072|gb|EFC31843.1| flagellar motor switch protein [Campylobacter jejuni subsp. jejuni
           414]
          Length = 359

 Score =  221 bits (562), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 46/292 (15%), Positives = 99/292 (33%), Gaps = 6/292 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +    +     + L       M   V+    S     +   + S      F+  S
Sbjct: 50  SKEQLRTIKGIHDKLARNLASQISSMMRSIVETKLHSVDQMTYGEFLMSLPSPTSFNVFS 109

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +     N  +  + ++   +++ LLG   ++     +R L+ +E  L    +  I   L 
Sbjct: 110 IKPLDGNCVLEINPSIAFPMIDRLLGGQGDSYE--ASRELTDIELNLLDSILRIIMQRLK 167

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  +T  E  P++E       +        NE V  + M + I N +    +  P   L 
Sbjct: 168 ESWATVTEIYPSIEAKESSPNV--VQIVSQNEIVIMVVMEIIIGNSSGMVNICYPVVHLE 225

Query: 208 KTTLISLSS--QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVI 265
                  +        +  +           +  V  +  +      + + + LK G ++
Sbjct: 226 SILSRLANRDIMMGETSAKKSRNKELKTLIGRAEVVYEAILGKTLINVHEFLELKQGDIL 285

Query: 266 PFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLHK 317
                    AI+S + K+++  ++G      +I+I + I  D+  +K  L K
Sbjct: 286 RLDREADDKAIVSIDKKDVFLAQIGLHRFRKSIKILELIRTDKDEIKEILEK 337


>gi|317133477|ref|YP_004092791.1| flagellar motor switch protein FliM [Ethanoligenens harbinense
           YUAN-3]
 gi|315471456|gb|ADU28060.1| flagellar motor switch protein FliM [Ethanoligenens harbinense
           YUAN-3]
          Length = 335

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 42/305 (13%), Positives = 104/305 (34%), Gaps = 15/305 (4%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S  K   P    +  +        K   K  S +   Y + L       +     +   +
Sbjct: 31  STEKKVRPYDFKIPKKF------NKEQMKTLSIIYENYGRLLSSYLSGTLRSYCKVEVLT 84

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            +  +F    ++ + N +     +     +  +  S ++   +++ LLG   E      +
Sbjct: 85  IEEQRFFEYSNALESNVLMGVLDMKPLEGSSMVTLSQSVAFGIIDRLLGGPGEIYE--AD 142

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  + +E +L ++ +  +  ++           P+       +  +++     NE V  +
Sbjct: 143 RDYTDIEMQLLRQVVQTVCRLVGDAWENVYALQPDFVRLE--NNSRQSQLVSPNETVVIV 200

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSS-----QNKSENQSEDLIDPFARKTYQLN 239
            +++ I +V  +    IP   L        +              +   +   RK  Q+ 
Sbjct: 201 MLDVEIRDVVGNISFCIPYVILEPVLEHLNTRYWFTESRSKTGDEQASRENLLRKVRQIP 260

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           + +   +   + TL + + L++G V+P        A + +  ++ +   LG    N  IR
Sbjct: 261 IELRAVLGTARITLHEALQLQVGDVVPLDQHLDEKAAVYSGKEKWFEGTLGTWHNNRAIR 320

Query: 300 ITDRI 304
           +   +
Sbjct: 321 VDRIM 325


>gi|220924581|ref|YP_002499883.1| flagellar motor switch protein FliM [Methylobacterium nodulans ORS
           2060]
 gi|219949188|gb|ACL59580.1| flagellar motor switch protein FliM [Methylobacterium nodulans ORS
           2060]
          Length = 403

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 37/281 (13%), Positives = 98/281 (34%), Gaps = 4/281 (1%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
                 +   +     + L    +     +V+++  +  S +F   +++     +     
Sbjct: 107 SYERLPMLEIVFDRMIRLLSTSLRNFFQDNVEVTLDNITSVRFGDYLNAIPMPTLLGVFK 166

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGA-SHETIPQLYNRSLSTVEKKLAKRTIAQISAVL 146
              W ++  +   ++L    L+ LLG     T  +L  R  +++E  L +R +  I   L
Sbjct: 167 ADLWENSGLLTVDSSLAYATLDLLLGGKRGTTTIRLDGRPFTSIEMSLVRRMLEIILGDL 226

Query: 147 NQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL 206
                        ++        +  T          I++ + +E       ++ P  T+
Sbjct: 227 EASFQPLSPVRFQIDRIE--SNPRFATITRPANAAILIDLKLDMEGRGGLLQILFPYATI 284

Query: 207 LKTTLISL-SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVI 265
                + L S   +   +        A + +Q ++ ++  ++     L+ V++L++G  I
Sbjct: 285 EPIRDLLLQSFMGEKLGRDHVWEGHLATEIWQADLAVEAVLHEMTLPLRRVLSLEVGDTI 344

Query: 266 PFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
            F  +      L      +    +GR+  +  +++T  +  
Sbjct: 345 MFDAKPTDLITLRCGDWALTQGRIGRLDDSIAVQVTRPLRR 385


>gi|223041119|ref|ZP_03611374.1| flagellar motor switch protein FliM [Campylobacter rectus RM3267]
 gi|222877613|gb|EEF12739.1| flagellar motor switch protein FliM [Campylobacter rectus RM3267]
          Length = 367

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 48/304 (15%), Positives = 104/304 (34%), Gaps = 6/304 (1%)

Query: 16  ILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIH 75
           +++          K   +    +     + L       M   V+I   S     +   + 
Sbjct: 37  VIIYDFKRPNRVSKEQLRAIKGIHDKLARNLASQISSVMRSIVEIRLHSVDQMTYGEFLM 96

Query: 76  SFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLA 135
           S      F+  S+     N  +  + ++   +++ LLG + E      +R L+ +E  L 
Sbjct: 97  SLPSPTSFNVFSIKPLDGNCVLEINPSIAFPMIDRLLGGNGEGFE--ASRELTDIEVNLL 154

Query: 136 KRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVAS 195
              +  +   L +  S   +  PN+E       +        NE V  + M + + N + 
Sbjct: 155 DAILRMMMQRLKESWSMITDMYPNVEAKESSPNV--VQIVSQNEIVIMVVMEIIVGNSSG 212

Query: 196 SFVLIIPQETLLKTTLISLSS--QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTL 253
              +  P   L        +        +  +           +  V  +  +     ++
Sbjct: 213 MINICYPVIYLEPILSRLANRDIMLGETSAKKSRNKELKTLIGRAEVLYEAILGKSVVSV 272

Query: 254 KDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKN 313
            + + LK G ++         AI++ + KE++  E+G      +IRI + I  D+  +KN
Sbjct: 273 NEFLNLKEGDILRLDRSANDKAIVTIDKKEVFLAEVGLHRFRKSIRIEELIRSDKDEIKN 332

Query: 314 FLHK 317
            L +
Sbjct: 333 ILEQ 336


>gi|325288785|ref|YP_004264966.1| flagellar motor switch protein FliM [Syntrophobotulus glycolicus
           DSM 8271]
 gi|324964186|gb|ADY54965.1| flagellar motor switch protein FliM [Syntrophobotulus glycolicus
           DSM 8271]
          Length = 332

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 45/313 (14%), Positives = 111/313 (35%), Gaps = 10/313 (3%)

Query: 1   MRGQSIHKNT---SPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLD 57
           +   S+ +     S  H + L          K       ++   + + L       M   
Sbjct: 17  LSDGSVDEEAIALSNSHKVRLYDFKRPNKFSKGQLNSLRNIHENFCRNLVTYLAGAMHTV 76

Query: 58  VDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHE 117
           ++    S +   +     S     +    S+     N  I  S  L   +++ LLG   +
Sbjct: 77  IEAKVLSTEQVTYDEYTRSLPYPSILGIYSMDPLEGNALIELSPGLGFHMVDRLLGGYGK 136

Query: 118 TIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLS 177
               + NR L+ +E+++ +  + ++ +V+ +  S     +P   D      ++       
Sbjct: 137 --DAMKNRDLTEIERRIVQGMLRKMISVIGEAWSEIYTITPQYVDMET--NVQFIQIVAP 192

Query: 178 NEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLS---SQNKSENQSEDLIDPFARK 234
           NE V  + M + IE+      + +P   +        +     +  + Q+ +      RK
Sbjct: 193 NEMVVVVTMEVKIEDSIGMINICLPYIVMKPILDKLNNILLFSSAGKAQNPEDQRTIRRK 252

Query: 235 TYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGK 294
             ++ V +   +   + T+++++ L+ G VIP     +    +     + ++   G    
Sbjct: 253 IERVRVPLKVFLGQTQITVRELLGLEKGDVIPLQQHIQEPLDIYVGKFKKFAGIPGLHSN 312

Query: 295 NYTIRITDRINFD 307
              ++I+  +N +
Sbjct: 313 RLAVQISGVLNEE 325


>gi|170288054|ref|YP_001738292.1| flagellar motor switch protein FliM [Thermotoga sp. RQ2]
 gi|170175557|gb|ACB08609.1| flagellar motor switch protein FliM [Thermotoga sp. RQ2]
          Length = 328

 Score =  220 bits (560), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 41/295 (13%), Positives = 98/295 (33%), Gaps = 15/295 (5%)

Query: 10  TSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGK 69
             P      ++        K   +    +   + + L      ++   VD+   S     
Sbjct: 36  VKPYDFKRPSKF------SKEQLRTFQMIHENFGRALSTYLSGRLRTFVDVEI-SIDQLT 88

Query: 70  FSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLST 129
           +   I S          +   +  +       +L  T+L+ ++G          NR  + 
Sbjct: 89  YEEFIRSVMIPSFIVIFTGDVFEGSAIFEMRLDLFYTMLDIIMGGPG---DNPPNRPPTE 145

Query: 130 VEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMT 189
           +E  + ++ +  +  +L Q  S  Q   P++E+       +       NE V  +  +++
Sbjct: 146 IETSIMRKEVTNMLTLLAQAWSDFQYFIPSIENVET--NPQFVQIVPPNEIVLLVTASVS 203

Query: 190 IENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRI 246
                S   +  P   L               +   + E+ ++   + + ++ V +   I
Sbjct: 204 WGEFTSFINVCWPFSLLEPLLEKLSDRFWMMGRKPEKVEERMEELRKASQKIPVTVQAVI 263

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
              +  LK+++ L++G VI      K    +   G+  +    G     Y +++T
Sbjct: 264 GETELRLKEILDLEVGDVIRLGTHYKDEIRIDVEGRPKFRGIPGTFKGKYAVKVT 318


>gi|170742328|ref|YP_001770983.1| flagellar motor switch protein FliM [Methylobacterium sp. 4-46]
 gi|168196602|gb|ACA18549.1| flagellar motor switch protein FliM [Methylobacterium sp. 4-46]
          Length = 403

 Score =  219 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 40/281 (14%), Positives = 96/281 (34%), Gaps = 4/281 (1%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
                 +   +     + L    +     +V+++  +  S +F   +++     +     
Sbjct: 107 SYERLPMLEIIFDRMIRLLSTSLRNFFQDNVEVTLDNITSVRFGDYLNAIPLPTLLGVFK 166

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGA-SHETIPQLYNRSLSTVEKKLAKRTIAQISAVL 146
              W ++  +   +NL    L+ LLG     T  +L  R  +++E  L +R +  I   L
Sbjct: 167 ADLWENSGLVTVDSNLAYATLDLLLGGKRGTTTIRLDGRPFTSIEMSLVRRMLEIILGDL 226

Query: 147 NQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL 206
                        ++        +  T          I++ + +E       ++ P  T+
Sbjct: 227 EASFQPLSPVRFQIDRLE--SNPRFATITRPANAAILIDLKLDMEGRGGLLQILFPYATI 284

Query: 207 LKTTLISL-SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVI 265
                + L S   +   +        A + +Q  V ++  ++     LK V+ L++G  I
Sbjct: 285 EPIRDLLLQSFMGEKLGRDHVWEGHLATEIWQAEVEVEAVLHQMTLPLKRVLALEVGDTI 344

Query: 266 PFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
            F  +      L      +    +GR+  +  +++T  +  
Sbjct: 345 LFDAKPTDLITLRCGDWALSQGRIGRLEDSIAVQVTRPLRR 385


>gi|329888223|ref|ZP_08266821.1| flagellar motor switch protein FliM [Brevundimonas diminuta ATCC
           11568]
 gi|328846779|gb|EGF96341.1| flagellar motor switch protein FliM [Brevundimonas diminuta ATCC
           11568]
          Length = 352

 Score =  219 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 37/296 (12%), Positives = 102/296 (34%), Gaps = 4/296 (1%)

Query: 14  HPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHI 73
               +  +            +   +     + +    +     +V++S  +  S +F   
Sbjct: 49  ERSGIRAIINSALVSYERLPMLEIVFDRLVRLMTTSLRNFTSDNVEVSLDTISSIRFGDY 108

Query: 74  IHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGAS-HETIPQLYNRSLSTVEK 132
           ++S     + +        +   +   +NL+ ++++ LLG        ++  R  +T+E+
Sbjct: 109 LNSIPLPAILAVFRAEELDNYGLLTVDSNLIYSIVDVLLGGRRGTAALRIEGRPYTTIER 168

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            L +R +  I     Q          NL+        +             + + + +E+
Sbjct: 169 VLVQRMVEVILNDARQAFEPLTPVHFNLDRLET--NPRFAAIARPANAAILVKLRIDMED 226

Query: 193 VASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
                 L++P  TL     ++      +   +        A + +     +   ++ ++ 
Sbjct: 227 RGGRVELLLPYSTLEPIRKMLLQQFMGEKFGRDNIWEGHLATELWTTETEVRCVLDEQQM 286

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
            L  V+ LK+G  +      ++   + A    + +  +GR G++  +R+   I+ D
Sbjct: 287 PLSKVLDLKVGDTLMLNVTPESEVSVRAGSIPLTTGRMGRKGQHIAVRVEGPISTD 342


>gi|118589946|ref|ZP_01547350.1| flagellar motor switch protein FliM [Stappia aggregata IAM 12614]
 gi|118437443|gb|EAV44080.1| flagellar motor switch protein FliM [Stappia aggregata IAM 12614]
          Length = 319

 Score =  219 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 45/303 (14%), Positives = 116/303 (38%), Gaps = 4/303 (1%)

Query: 17  LLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHS 76
           +  RL    G       +   +     + +    ++K      IS +  ++ +   ++  
Sbjct: 19  IADRLLDAAGISVDRLPMLPVVFDRMARLMADAMRQKSPSPSYISVSYVENNRIGDVLDE 78

Query: 77  FKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAK 136
           F+ N + +      W +   +G   + + TL++ L GA     P    R  S +E ++A+
Sbjct: 79  FESNALVAVLYSPEWDARVLVGFDRDFIFTLVDVLFGADGTEPPIDDERPFSNIETRIAR 138

Query: 137 RTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASS 196
                 +  L +  +   E++  +E       +        N       +          
Sbjct: 139 TMFEVAAKALAESFAPIAETTLKIERIE--SRMDFAVVGRRNNPAVVARLLQQAIGRGGE 196

Query: 197 FVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKD 255
             +++P  TL             +  ++ +     F  +  +  V ++  +  ++ +L D
Sbjct: 197 VFIVMPHSTLNPLRQRLSQVLSGEMSSRDKQWTQHFHNEIQRTEVKLEAILEEREMSLGD 256

Query: 256 VVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI-NFDQKSLKNF 314
           +  L++GQVI      ++   L+ N + +++C+LG++  +YT++I + I   ++    + 
Sbjct: 257 LANLRVGQVIELQATARSPVTLACNDQPVFTCQLGQLNGSYTLQIDELIHEEEKDLFDDL 316

Query: 315 LHK 317
            ++
Sbjct: 317 RNR 319


>gi|227820849|ref|YP_002824819.1| Flagellar motor switch protein FliM [Sinorhizobium fredii NGR234]
 gi|227339848|gb|ACP24066.1| Flagellar motor switch protein FliM [Sinorhizobium fredii NGR234]
          Length = 315

 Score =  219 bits (559), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 91/312 (29%), Positives = 157/312 (50%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   N       LLAR+TG LGD KTI + +  LG+++ + LP++ K++   D+ I Y  
Sbjct: 4   STDSNVYAFDKKLLARMTGALGDDKTIGRTALELGHVFSERLPEMLKQETGRDIAIGYAG 63

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
            + G  + +I    E  + S  SL +W + F IGC + ++I L+E LLGA    I +   
Sbjct: 64  VKMGFRNELIADLGEAVLLSDVSLRNWCAEFQIGCDSPVLIALVEALLGAEPIDIEEPLP 123

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R+LS +E  +A     +I+  +   +       P +   ++          L + +  +I
Sbjct: 124 RALSKIEIDVAVPVFERIAEAVRMAVDAPGGFEPVVGRPHNGAERLPPDPALEDVYAASI 183

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDT 244
           +M   +  V S+F +IIPQ  LLKT ++   +  ++E+   D  +    +  +  V ++ 
Sbjct: 184 DMTFGLGPVLSTFSVIIPQNVLLKTQIVPPGNAGRNESMKTDWSEQLEEQIRRSAVTLEA 243

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
           RI L+  TL  +  L+ G VIPF   +     ++ANG+++Y CE GR G  YT+R+ D  
Sbjct: 244 RIQLESLTLDTISRLQPGDVIPFHDGQDVRVEVNANGRDLYVCEFGRSGSRYTVRVKDTH 303

Query: 305 NFDQKSLKNFLH 316
             +Q  L++ + 
Sbjct: 304 GSEQDILRHIMS 315


>gi|15643443|ref|NP_228487.1| flagellar motor switch protein FliM [Thermotoga maritima MSB8]
 gi|4981202|gb|AAD35762.1|AE001740_8 flagellar motor switch protein FliM [Thermotoga maritima MSB8]
          Length = 328

 Score =  219 bits (559), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 43/295 (14%), Positives = 100/295 (33%), Gaps = 15/295 (5%)

Query: 10  TSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGK 69
             P      ++        K   +    +   + + L      ++   VD+   S     
Sbjct: 36  VKPYDFKRPSKF------SKEQLRTFQMIHENFGRALSTYLSGRLRTFVDVEI-SIDQLT 88

Query: 70  FSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLST 129
           +   I S          +   +  +       +L  T+L+ ++G   E  P   NR  + 
Sbjct: 89  YEEFIRSVMIPSFIVIFTGDVFEGSAIFEMRLDLFYTMLDIIMGGPGENPP---NRPPTE 145

Query: 130 VEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMT 189
           +E  + ++ +  +  +L Q  S  Q   P++E+       +       NE V  +  +++
Sbjct: 146 IETSIMRKEVTNMLTLLAQAWSDFQYFIPSIENVET--NPQFVQIVPPNEIVLLVTASVS 203

Query: 190 IENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRI 246
                S   +  P   L               +   + E+ ++   + + ++ V +   I
Sbjct: 204 WGEFTSFINVCWPFSLLEPLLEKLSDRFWMMGRKPEKVEERMEELRKASQKIPVTVQAVI 263

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
              +  LK+++ L++G VI      K    +   G+  +    G     Y +++T
Sbjct: 264 GETELRLKEILDLEVGDVIRLGTHYKDEIRIDVEGRPKFRGIPGVFKGKYAVKVT 318


>gi|23009967|ref|ZP_00050822.1| COG1868: Flagellar motor switch protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 316

 Score =  219 bits (558), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 36/285 (12%), Positives = 98/285 (34%), Gaps = 4/285 (1%)

Query: 30  TIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLS 89
               +   +     + L    +     +V+++  +  S +F   +++     +       
Sbjct: 22  ERLPMLEIVFDRMIRLLSTSLRNFFQDNVEVTLDNITSVRFGDYLNAIPLPTLLGVFKAD 81

Query: 90  SWSSNFFIGCSNNLVITLLENLLGA-SHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQ 148
            W  +  +     L  + ++ LLG     +  +L  R  +T+E  L +R I  I + L  
Sbjct: 82  PWEGSGIVTVEQTLAYSTMDLLLGGKRGGSSSRLDGRPFTTIEMNLVRRLIDIILSDLEL 141

Query: 149 CISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLK 208
                      ++        +  T          I++ + ++       ++ P  T+  
Sbjct: 142 SFQPLSPVRFGIDRLET--NPRFATITRPGNAAILISLKLDMDGRGGGMQILFPYATVES 199

Query: 209 TTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPF 267
              +   S   +   + +      A + +Q ++ ++  ++     LK V+ LK+G  + F
Sbjct: 200 IRDLLMQSFMGERLGRDQVWESHLATEIWQADLEMEAVLHEVTLPLKRVLGLKVGDTLMF 259

Query: 268 LHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLK 312
             +      +      +    +GR+     ++I   +   + +L+
Sbjct: 260 DRKPTDLITVRCGDWALTQGRIGRIDDAIAVQIARPLRQSRTTLQ 304


>gi|78044874|ref|YP_359866.1| flagellar motor switch protein FliM [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|77996989|gb|ABB15888.1| flagellar motor switch protein FliM [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 335

 Score =  219 bits (558), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 37/284 (13%), Positives = 96/284 (33%), Gaps = 7/284 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +    +   Y + +       +  ++ +   S     +   + S     + +   
Sbjct: 53  SKENLRTLHLIHDNYARLISNFLTGYLRTNISVKVASVDQATYEDFLVSVPTPTLITTFK 112

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           L     +  +  +   +  ++  L G S +  P++  R L+ +E  + K+   ++   L 
Sbjct: 113 LHPLKGSMVMETNLQFIFPIISLLFGGSGDMPPEV--RELTDIELAVIKKLNYRLLENLA 170

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           Q  +   +  P +E     +  + +     NE V  I     I        L +P E L 
Sbjct: 171 QAWAEIIKVEPEIEALE--NNPRLHQVLSPNEIVAIITFTTEILGNNGLINLCLPFEVLD 228

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                        + +    E           +  + +   +   +  +++ + +++G +
Sbjct: 229 PLLAKLSASYWFSHATAADREAFARHMEGFLAESELEVSAILGGTELRVREFLKIEVGDI 288

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
           +    +      L    ++++  + GRVG+    +IT  I  D+
Sbjct: 289 VVLNRKVDEELELFVEDQKLFKVQPGRVGEKLCCQITGMIERDE 332


>gi|291277482|ref|YP_003517254.1| flagellar motor switch protein [Helicobacter mustelae 12198]
 gi|290964676|emb|CBG40531.1| flagellar motor switch protein [Helicobacter mustelae 12198]
          Length = 357

 Score =  219 bits (558), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 52/319 (16%), Positives = 105/319 (32%), Gaps = 6/319 (1%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           +   +  +  SP   I L          K   +    +     + L       M   V+I
Sbjct: 22  VDSSANEQGISPKRQITLYDFKRPNRVSKEQLRAFKGIHDKMARNLSSQISAIMRSIVEI 81

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
              S     +   + S      F+  S+        +  + ++V ++++ LLG   ET  
Sbjct: 82  QLHSVDQMTYGEFLMSLPSPTSFNVFSMKPMDGTGVLEINPSIVFSMIDRLLGGKGETYD 141

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
               R  S +E  L    + QI   L        E  P+++       +        NE 
Sbjct: 142 H--QREFSDIELNLLDTILRQIMQTLKDAWGPVAEIFPSVDAKESSPNV--VQIVAQNEV 197

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSS--QNKSENQSEDLIDPFARKTYQL 238
           V  + M M I + +    L  P  +L        S        +  +             
Sbjct: 198 VIMVVMEMIIGHSSGMLSLCYPVISLEAVLSRLGSRDLVLSETSSKKSRNKELQALIGGA 257

Query: 239 NVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTI 298
            +++   +     +L++++ L+ G +I           ++ +GK+ +  ++G      TI
Sbjct: 258 GISLSAFLGGANLSLREILELQRGDIIRLDRVADDTVFVAIDGKDKFLADIGLQRYRKTI 317

Query: 299 RITDRINFDQKSLKNFLHK 317
           RI + I  ++  +K  L  
Sbjct: 318 RIKEAIRTEKDQVKEILEM 336


>gi|225181581|ref|ZP_03735022.1| flagellar motor switch protein FliM [Dethiobacter alkaliphilus AHT
           1]
 gi|225167689|gb|EEG76499.1| flagellar motor switch protein FliM [Dethiobacter alkaliphilus AHT
           1]
          Length = 325

 Score =  219 bits (557), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 44/307 (14%), Positives = 97/307 (31%), Gaps = 6/307 (1%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           +  +  +   P+ +          K   +    +   + + L       +   V ++  S
Sbjct: 23  AEEEPQTSDTPVQVYDFRRPNKFSKDQMRTLQIVHENFARILSNFLTAYLRTPVQVTLAS 82

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
                F   I S     + S    S    +  +  +   V  +++ L G   +T  Q+  
Sbjct: 83  VSQVTFEEFIFSLPTPTLMSIFKASDNMGSAMLETNPQFVFPIIDLLFGGEGKTPKQI-- 140

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R L+ +E  + +R + +I   L        E SP +E+       + N    SNE V  +
Sbjct: 141 RELTEIELTVMRRIVNKILENLRYAWEDINELSPQIENMDT--NPQFNQMIASNETVALL 198

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSSQ--NKSENQSEDLIDPFARKTYQLNVNI 242
            ++  I +      +  P  TL        +    + S+                ++V +
Sbjct: 199 TLSTKIRDSEGLINVCFPFITLEPVIANLTAQHWFSNSQISGGVHSRMLETGLEDVDVEL 258

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
              +      ++D +  + G VI    R      L    K ++  + G       ++   
Sbjct: 259 TAVLGSSTVQMEDFLQFEEGDVILLDQRVDCPMTLLVEEKPMFKIQAGVSKGRRAVQFLH 318

Query: 303 RINFDQK 309
               + +
Sbjct: 319 AEGGEAE 325


>gi|221235077|ref|YP_002517513.1| flagellar motor switch protein FliM [Caulobacter crescentus NA1000]
 gi|300680949|sp|B8GXB5|FLIM_CAUCN RecName: Full=Flagellar motor switch protein FliM
 gi|220964249|gb|ACL95605.1| flagellar motor switch protein fliM [Caulobacter crescentus NA1000]
          Length = 374

 Score =  219 bits (557), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 33/288 (11%), Positives = 96/288 (33%), Gaps = 4/288 (1%)

Query: 14  HPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHI 73
               +  +            +   +     + +    +     +V++S  +  S +F   
Sbjct: 72  DRTGIRAIINSALVSYERLPMLEIVFDRLVRLMTTSLRNFTSDNVEVSLDNISSIRFGDY 131

Query: 74  IHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGA-SHETIPQLYNRSLSTVEK 132
           ++S     + +        +   +   +NL+ ++++ LLG        ++  R  +T+E+
Sbjct: 132 LNSIPLPAILAVFRAEELDNYGLLTVDSNLIYSIVDVLLGGRRGTAAMRIEGRPYTTIER 191

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            L +R I  +   L          S +L+        +             + + + +E+
Sbjct: 192 VLVQRMIEVVLHDLKSAFEPLHPVSFSLDRLET--NPRFAAIARPANAAILVKLRIDMED 249

Query: 193 VASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
                 L++P  TL     ++      +   +        A + +   + +   ++ ++ 
Sbjct: 250 RGGRIELLLPYATLEPIRKMLLQQFMGEKFGRDNIWEGHLATELWTTQMEVRAVLDEQQV 309

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
            L  V+ +++G  +       +   L A    +    +GR   +  +R
Sbjct: 310 PLSRVLNMQVGDTLMLNATPDSLVELRAGAIPLTRGRMGRRNHSIAVR 357


>gi|254418956|ref|ZP_05032680.1| flagellar motor switch protein FliM [Brevundimonas sp. BAL3]
 gi|196185133|gb|EDX80109.1| flagellar motor switch protein FliM [Brevundimonas sp. BAL3]
          Length = 346

 Score =  219 bits (557), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 36/282 (12%), Positives = 98/282 (34%), Gaps = 4/282 (1%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
                 +   +     + +    +     +V++S  +  S +F   ++S     + +   
Sbjct: 58  SYERLPMLEIVFDRLVRLMTTSLRNFTSDNVEVSLDNISSIRFGDYLNSIPLPAILAVFR 117

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGAS-HETIPQLYNRSLSTVEKKLAKRTIAQISAVL 146
                +   +   +NL+ ++++ LLG        ++  R  +T+E+ L +R +  +    
Sbjct: 118 AEELDNYGLLTVDSNLIYSIVDVLLGGRRGTAALRIEGRPYTTIERVLVQRMVEVVLNDA 177

Query: 147 NQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL 206
                     + NL+        +             I + + +E+      L++P  TL
Sbjct: 178 RLAFEPLTPVTFNLDRLET--NPRFAAIARPANAAILIKLRIDMEDRGGRIELLLPYATL 235

Query: 207 LKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVI 265
                ++      +   +        A + +     +   ++ +   L  V+ LK+G  +
Sbjct: 236 EPIRKMLLQQFMGEKFGRDNIWEGHLATELWTTETEVRAVLDEQMMPLSTVLNLKVGDTM 295

Query: 266 PFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
                  +   + A    + +  +GR G++  +RI   +N +
Sbjct: 296 MLNATPDSEVSIRAGAIPLTTGRMGRKGQHIAVRIEGPVNPE 337


>gi|154175307|ref|YP_001408769.1| flagellar motor switch protein FliM [Campylobacter curvus 525.92]
 gi|153793210|gb|EAT99984.2| flagellar motor switch protein FliM [Campylobacter curvus 525.92]
          Length = 366

 Score =  219 bits (557), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 50/303 (16%), Positives = 101/303 (33%), Gaps = 6/303 (1%)

Query: 17  LLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHS 76
           ++          K   +    +     + L       M   V+I   S     +   + S
Sbjct: 40  IIYDFKRPNRVSKEQLRAIKGIHDKLARNLASQISSVMRSIVEIRLHSVDQMTYGEFLMS 99

Query: 77  FKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAK 136
                 F+  S+     N  +  + ++   +++ LLG + E      NR L+ +E  L  
Sbjct: 100 LPSPTSFNVFSIKPLDGNCILEINPSIAFPMIDRLLGGTGENFET--NRELTDIEVNLLD 157

Query: 137 RTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASS 196
             +  I   L +  +   +  PN+E       +        NE V  + M + + N +  
Sbjct: 158 AVLRMIMQRLKESWAMITDMYPNVEAKESSPNV--VQIVSQNEIVIMVVMEIIVGNSSGM 215

Query: 197 FVLIIPQETLLKTTLISLSS--QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLK 254
             L  P   L        +        +  +           +  V  +  +     ++ 
Sbjct: 216 INLCYPVIYLEPILSRLANRDIMLGETSAKKSRNKELKTLIGRAEVLYEAILGKAIVSVS 275

Query: 255 DVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
           + + LK G ++         AI+  + KE++  E+G      +I+I   I  D+  +KN 
Sbjct: 276 EFLDLKEGDIVRLDRSADDKAIVCIDKKEVFLAEVGLHRFRKSIKIEQLIRSDKDEIKNI 335

Query: 315 LHK 317
           L K
Sbjct: 336 LEK 338


>gi|330961230|gb|EGH61490.1| flagellar motor switch protein FliM [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 252

 Score =  219 bits (557), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 40/254 (15%), Positives = 89/254 (35%), Gaps = 6/254 (2%)

Query: 52  EKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENL 111
             +    D++    Q  KF   +HS       + A +              LV  L++N 
Sbjct: 1   NLLRRSADVAVGGVQVMKFGEYVHSLYVPTSLNLAKIKPLRGTALFILDAKLVFKLVDNF 60

Query: 112 LGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKK 171
            G       ++  R  +  E ++ +  + Q    L +      E +   E          
Sbjct: 61  FGGDGR-HAKIEGREFTPTELRVVRMVLDQAFIDLKEAWQAIMEVN--FEYINSEVNPAM 117

Query: 172 NTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLS-SQNKSENQSEDLIDP 230
                 +E V     ++ ++       + +P   +     +  +  Q+  ++Q E  ++ 
Sbjct: 118 ANIVGPSEAVVISTFHIELDGGGGDLHVTMPYSMIEPIREMLDAGFQSDLDDQDERWVNA 177

Query: 231 FARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELG 290
                  +NV + T I  ++  L+D++ ++ G VIP         ++ ANG   +  +LG
Sbjct: 178 LKEDVLDVNVPLTTTIAQRQLPLRDILHMRPGDVIPVEL--SDSLVMRANGVPSFKVKLG 235

Query: 291 RVGKNYTIRITDRI 304
                  +++ + I
Sbjct: 236 SHKGKMALQVIEPI 249


>gi|148269397|ref|YP_001243857.1| flagellar motor switch protein FliM [Thermotoga petrophila RKU-1]
 gi|147734941|gb|ABQ46281.1| flagellar motor switch protein FliM [Thermotoga petrophila RKU-1]
          Length = 328

 Score =  219 bits (557), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 41/295 (13%), Positives = 98/295 (33%), Gaps = 15/295 (5%)

Query: 10  TSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGK 69
             P      ++        K   +    +   + + L      ++   VD+   S     
Sbjct: 36  VKPYDFKRPSKF------SKEQLRTFQMIHENFGRALSTYLSGRLRTFVDVEI-SIDQLT 88

Query: 70  FSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLST 129
           +   I S          +   +  +       +L  T+L+ ++G          NR  + 
Sbjct: 89  YEEFIRSVMIPSFIVIFTGDIFEGSAIFEMRLDLFYTMLDIIMGGPG---DNPPNRPPTE 145

Query: 130 VEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMT 189
           +E  + ++ +  +  +L Q  S  Q   P++E+       +       NE V  +  +++
Sbjct: 146 IETSIMRKEVTNMLTLLAQAWSDFQYFIPSIENVET--NPQFVQIVPPNEIVLLVTASVS 203

Query: 190 IENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRI 246
                S   +  P   L               +   + E+ ++   + + ++ V +   I
Sbjct: 204 WGEFTSFINVCWPFSLLEPLLEKLSDRFWMMGRKPERVEERMEELKKVSQKVPVTVQAVI 263

Query: 247 NLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
              +  LK+++ L++G VI      K    +   G+  +    G     Y +++T
Sbjct: 264 GETELRLKEILDLEVGDVIRLGTHYKDEIRIDVEGRPKFRGIPGVFKGKYAVKVT 318


>gi|150395476|ref|YP_001325943.1| surface presentation of antigens (SPOA) protein [Sinorhizobium
           medicae WSM419]
 gi|150026991|gb|ABR59108.1| surface presentation of antigens (SPOA) protein [Sinorhizobium
           medicae WSM419]
          Length = 315

 Score =  219 bits (557), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 91/311 (29%), Positives = 156/311 (50%)

Query: 6   IHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSC 65
              N       LLAR+ G LGD K I++++  L  ++ + LP + + +   DV I+Y   
Sbjct: 5   TASNIHAFDKRLLARMIGALGDDKVIDRLALELAQIFDELLPGVLRSETGCDVTIAYAGF 64

Query: 66  QSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNR 125
           ++G  + ++    +  +    SL +W ++F IGC + ++I L+E LLGA    I +   R
Sbjct: 65  RAGLRNELVAGLGDGVLIGDLSLRNWCTDFQIGCDSPVLIALVEALLGAEPAGIEEPAPR 124

Query: 126 SLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTIN 185
           SLS +E  +A      I+ VL   ++      P +   Y+     K    L + +  +I+
Sbjct: 125 SLSKIEIDVALPVFHGIAEVLRIAVNAPGGFEPVVGRPYNSAERAKPDPALEDVYAASID 184

Query: 186 MNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTR 245
           M + +  V S+F +I+PQ TLLKT  +S     K +N   +  +    +  +  V ++ R
Sbjct: 185 MTIGLGPVLSTFSVIVPQSTLLKTRFVSPKGAGKDQNAKTEWTEQLEEQVRRSAVALEAR 244

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           I L+  TL  +  L+ G VIPF   +     +SANG+++Y CE GR G  YT+R+ D   
Sbjct: 245 IRLESLTLDTIARLQAGDVIPFHDGQDVRVEVSANGRDLYVCEFGRSGSKYTVRVKDTHG 304

Query: 306 FDQKSLKNFLH 316
            +Q  L++ + 
Sbjct: 305 SEQDILRHIMS 315


>gi|224437150|ref|ZP_03658131.1| flagellar motor switch protein FliM [Helicobacter cinaedi CCUG
           18818]
 gi|313143613|ref|ZP_07805806.1| flagellar motor switch protein FliM [Helicobacter cinaedi CCUG
           18818]
 gi|313128644|gb|EFR46261.1| flagellar motor switch protein FliM [Helicobacter cinaedi CCUG
           18818]
          Length = 353

 Score =  219 bits (557), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 50/318 (15%), Positives = 106/318 (33%), Gaps = 11/318 (3%)

Query: 2   RGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDIS 61
           +    H+       + L          K   +   S+     + L       M   V+I 
Sbjct: 28  KQGITHQKQ-----VTLYDFKRPNRVSKEQLRAFKSIHDKMARSLSSQVSAVMRSIVEIQ 82

Query: 62  YTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQ 121
             S     +   + S      F+  S+        +  + ++   +++ LLG   +    
Sbjct: 83  LHSVDQMTYGEFLMSLPSPTSFNIFSMKPLEGAAILEINPSIAFPMIDRLLGGKGDPYEN 142

Query: 122 LYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFV 181
             +R  S +E  L    + QI   L +  S+  E  P+++       +        NE V
Sbjct: 143 --SREFSDIELNLLDTLLRQIMQNLKEAWSSITEIFPSVDAKESSPNV--VQIVAQNEIV 198

Query: 182 TTINMNMTIENVASSFVLIIPQETLLKTTLISLSS--QNKSENQSEDLIDPFARKTYQLN 239
             + M + I + +    +  P  +L        S        +  +             N
Sbjct: 199 IMVVMEIIIGHSSGMMSICYPVISLETVLSRLASRDLMLSDTSSKKSRNKELQALIAGAN 258

Query: 240 VNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           V +   +     +LK+V+ L++G ++          ++S +G+E Y   +G      T++
Sbjct: 259 VVVSGYLGNATLSLKEVLDLQVGDIVRLDRAADDTILVSVDGREKYIASIGLQRYRKTLQ 318

Query: 300 ITDRINFDQKSLKNFLHK 317
           I + I  ++  +K  L  
Sbjct: 319 IKEVIKTEKDQVKEVLEM 336


>gi|255322027|ref|ZP_05363177.1| flagellar motor switch protein FliM [Campylobacter showae RM3277]
 gi|255301131|gb|EET80398.1| flagellar motor switch protein FliM [Campylobacter showae RM3277]
          Length = 368

 Score =  219 bits (557), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 48/304 (15%), Positives = 104/304 (34%), Gaps = 6/304 (1%)

Query: 16  ILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIH 75
           +++          K   +    +     + L       M   V+I   S     +   + 
Sbjct: 38  VIIYDFKRPNRVSKEQLRAIKGIHDKLARNLASQISSVMRSIVEIRLHSVDQMTYGEFLM 97

Query: 76  SFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLA 135
           S      F+  S+     N  +  + ++   +++ LLG + E      +R L+ +E  L 
Sbjct: 98  SLPSPTSFNVFSIKPLDGNCVLEINPSIAFPMIDRLLGGNGEGFET--SRELTDIEVNLL 155

Query: 136 KRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVAS 195
              +  +   L +  S   +  PN+E       +        NE V  + M + + N + 
Sbjct: 156 DAILRMMMQRLKESWSMITDMYPNVEAKESSPNV--VQIVSQNEIVIMVVMEIIVGNSSG 213

Query: 196 SFVLIIPQETLLKTTLISLSS--QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTL 253
              +  P   L        +        +  +           +  V  +  +     ++
Sbjct: 214 MINICYPVIYLEPILSRLANRDIMLGETSAKKSRNKELKTLIGRAEVLYEAILGKSIVSV 273

Query: 254 KDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKN 313
            + + LK G ++         AI++ + KE++  E+G      +IRI + I  D+  +KN
Sbjct: 274 NEFLNLKEGDILRLDRSANDKAIVTIDKKEVFLAEVGLHRFRKSIRIEELIRSDKDEIKN 333

Query: 314 FLHK 317
            L +
Sbjct: 334 ILEQ 337


>gi|257866408|ref|ZP_05646061.1| flagellar motor switch protein fliM [Enterococcus casseliflavus
           EC30]
 gi|257873076|ref|ZP_05652729.1| flagellar motor switch protein fliM [Enterococcus casseliflavus
           EC10]
 gi|257876021|ref|ZP_05655674.1| flagellar motor switch protein fliM [Enterococcus casseliflavus
           EC20]
 gi|257800366|gb|EEV29394.1| flagellar motor switch protein fliM [Enterococcus casseliflavus
           EC30]
 gi|257807240|gb|EEV36062.1| flagellar motor switch protein fliM [Enterococcus casseliflavus
           EC10]
 gi|257810187|gb|EEV39007.1| flagellar motor switch protein fliM [Enterococcus casseliflavus
           EC20]
          Length = 332

 Score =  218 bits (556), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 41/299 (13%), Positives = 94/299 (31%), Gaps = 10/299 (3%)

Query: 20  RLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKE 79
                    K        +   + K    +   ++  +V +   + +   +   IHS  +
Sbjct: 36  DFRRPTKLSKEYVNTLHMIFEDFSKMSSSMLSTQLRTNVSLQLAAIEQVSYDEFIHSIPK 95

Query: 80  NFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQL------YNRSLSTVEKK 133
             +         S    I  +  L + L+E L G       +         +S + +E  
Sbjct: 96  FTLLGLFHSQPLSGIQMIEMNPQLCMMLVELLCGGLDVYQNKPIEMDFSEKKSFTDIETA 155

Query: 134 LAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENV 193
           + +  +AQ   V              L+        +   N   NE V  +   + I  V
Sbjct: 156 ILEEVVAQFVRVYQNVWKDIVALDSVLDGIDT--NPQLMQNMSPNEPVVLVTFTIKIFEV 213

Query: 194 ASSFVLIIPQETLLKTTLISL--SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
                L IP              +  + ++  ++D      +    + +N++  +   + 
Sbjct: 214 KHFINLCIPYVFFEGIIDKLSFRNWFDSNQPVNQDDSRELQKSLNGVGLNLEVLLGHAQM 273

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
           +L + + L+ G VI    +         +GK  +  + G+      I + D++  +Q+ 
Sbjct: 274 SLSEFLHLEEGDVIKLDKKITEPLETFIDGKPYFRAKPGKQEDRLAIELLDKLEEEQEL 332


>gi|295688787|ref|YP_003592480.1| flagellar motor switch protein FliM [Caulobacter segnis ATCC 21756]
 gi|295430690|gb|ADG09862.1| flagellar motor switch protein FliM [Caulobacter segnis ATCC 21756]
          Length = 369

 Score =  218 bits (556), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 32/288 (11%), Positives = 96/288 (33%), Gaps = 4/288 (1%)

Query: 14  HPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHI 73
               +  +            +   +     + +    +     +V++S  +  S +F   
Sbjct: 67  DRTGIRAIINSALVSYERLPMLEIVFDRLVRLMTTSLRNFTSDNVEVSLDNISSIRFGDY 126

Query: 74  IHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGA-SHETIPQLYNRSLSTVEK 132
           ++S     + +        +   +   +NL+ ++++ LLG        ++  R  +T+E+
Sbjct: 127 LNSIPLPAILAVFRAEELDNYGLLTVDSNLIYSIVDVLLGGRRGTAAMRIEGRPYTTIER 186

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            L +R I  +   L          + +L+        +             + + + +E+
Sbjct: 187 VLVQRMIEVVLHDLKSAFEPLHPVAFSLDRLET--NPRFAAIARPANAAILVKLRIDMED 244

Query: 193 VASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
                 L++P  TL     ++      +   +        A + +   + +   ++ ++ 
Sbjct: 245 RGGRIELLLPYATLEPIRKMLLQQFMGEKFGRDNIWEGHLATELWTTQMEVRAVLDEQQL 304

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
            L  V+ +++G  +       +   L A    +    +GR   +  +R
Sbjct: 305 PLSRVLNMQVGDTLMLNATPDSLVELRAGAIPLTRGRMGRRNHSIAVR 352


>gi|312879599|ref|ZP_07739399.1| flagellar motor switch protein FliM [Aminomonas paucivorans DSM
           12260]
 gi|310782890|gb|EFQ23288.1| flagellar motor switch protein FliM [Aminomonas paucivorans DSM
           12260]
          Length = 334

 Score =  218 bits (556), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 43/307 (14%), Positives = 104/307 (33%), Gaps = 13/307 (4%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           ++  +           +        K   +    +   + + L       +   V     
Sbjct: 30  ETEERKVKIYDFRRPDKF------SKDQLRAIQMIHDSFARQLTTSLSTLVRSMVSAEVA 83

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
           S     +   I S  +  V     +   S N  +  + +LV ++++ +LG   E + +  
Sbjct: 84  SVDQMAYDEFIRSLVQPTVIGVLEMYPLSGNAVLEMNPHLVFSIIDRMLGGKGEPLRKP- 142

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R L+ +E+ + +R + +I   L +  ST  +     E                 + V  
Sbjct: 143 -RDLTDIERTVVERVMMKILEHLEESWSTVVDVRFRFE--SMESNPFFVQICPGTDMVLL 199

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDL---IDPFARKTYQLNV 240
           + + + +        L IP   +        S    +    ++L    D  +++ ++++V
Sbjct: 200 VTLKIQVGETEGIMNLCIPYFVMEPMIDKLSSQHWFASTGKKNLEGIRDMLSKRLHEVSV 259

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            +   +     TL DV+ L++  VI    +      L    +  + C+ G   K+Y   +
Sbjct: 260 PLALELGHCALTLGDVLQLQVNDVIRLDGKATDPLGLRVGNRVKFLCQAGLSEKHYAGSV 319

Query: 301 TDRINFD 307
            + +  +
Sbjct: 320 LEVVQDE 326


>gi|328545470|ref|YP_004305579.1| flagellar motor switch protein FliM [polymorphum gilvum
           SL003B-26A1]
 gi|326415211|gb|ADZ72274.1| Flagellar motor switch protein FliM, putative [Polymorphum gilvum
           SL003B-26A1]
          Length = 314

 Score =  218 bits (556), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 47/302 (15%), Positives = 115/302 (38%), Gaps = 3/302 (0%)

Query: 17  LLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHS 76
           +  RL    G       +   L     +      ++K      IS +  ++ +   ++  
Sbjct: 15  ITDRLLDAAGISVDRLPMLPVLFDRMARVFADAMRQKSTSPSYISVSCIENERIGDVLDE 74

Query: 77  FKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAK 136
           ++ N + +      W +   +G   + + T+++ L GA     P    RS S +E ++A+
Sbjct: 75  YEANALVAVLYSPEWDTRMLVGFDRDFIFTMIDVLFGADGTEPPIDEERSFSNIETRIAR 134

Query: 137 RTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASS 196
                 +  L +  S   E++  +E       +        N       + +        
Sbjct: 135 SVFEVAAKALQESFSPIAETTLKIERVE--SRMDFAVVGRRNNPAVVARLLLQAIGRGGE 192

Query: 197 FVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKD 255
             +++P  TL             +   + +     F  +  +  V +   +  ++ TL +
Sbjct: 193 IFVVMPHSTLNPLRQRLSQVLSGEMSGRDKQWTQHFQTEIQRTEVRLQAVLEERELTLGE 252

Query: 256 VVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFL 315
           +  L++GQ+I      ++   L  N + I++C LG++  +YT+++ D I+ ++  + + L
Sbjct: 253 IANLQVGQIIELQATPRSPVKLECNQQPIFNCLLGQLDGSYTLQVEDLIHLEKDIVDDLL 312

Query: 316 HK 317
            +
Sbjct: 313 SR 314


>gi|87119476|ref|ZP_01075373.1| flagellar motor switch protein FliM [Marinomonas sp. MED121]
 gi|86164952|gb|EAQ66220.1| flagellar motor switch protein FliM [Marinomonas sp. MED121]
          Length = 322

 Score =  218 bits (556), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 37/273 (13%), Positives = 88/273 (32%), Gaps = 6/273 (2%)

Query: 31  IEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSS 90
                  +   + ++        +    D+S    Q  KF   +H+       +      
Sbjct: 49  RMPTLEMINERFARYTRISLFNLLRRTADVSSGGLQIMKFGEYVHTLYVPTSLNLVKFRP 108

Query: 91  WSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCI 150
             S         LV  L++N  G       ++  R  +  E ++ +  + Q+   L +  
Sbjct: 109 LRSTALFILDAKLVFKLVDNFFGGDGR-HAKIEGREFTPTEIRIVQLMLEQVFVDLTEAW 167

Query: 151 STTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTT 210
           +        L+                +E V     ++ ++       + +P   +    
Sbjct: 168 APVLSVE--LDYIGSEVNPAMANIVSPSEVVVVSTFHIELDGGGGELHITLPYSMIEPVR 225

Query: 211 LISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLH 269
            +  +  Q+  + + +       +   +LNV +   +      L+DV+  K G +IP   
Sbjct: 226 ELLDAGVQSDVDEKDDRWGKSLQQDVKELNVELSAAVAHVDVPLQDVLKFKAGDIIPVDI 285

Query: 270 REKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
                  + ANG      +LG   + Y++++ +
Sbjct: 286 P--EFITVRANGLPTIKGKLGVSNEKYSVQVVE 316


>gi|114570494|ref|YP_757174.1| flagellar motor switch protein FliM [Maricaulis maris MCS10]
 gi|114340956|gb|ABI66236.1| flagellar motor switch protein FliM [Maricaulis maris MCS10]
          Length = 376

 Score =  218 bits (556), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 36/295 (12%), Positives = 103/295 (34%), Gaps = 4/295 (1%)

Query: 14  HPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHI 73
               +  +            +   +     + +    +     +V++S  +  S +F   
Sbjct: 74  DKSGIRAIINSALVSYERLPMLEIVFDRLVRLMTTSLRNFTSDNVEVSLDNISSIRFGDY 133

Query: 74  IHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGAS-HETIPQLYNRSLSTVEK 132
           ++S     + +        +   +   +NL+ ++++ LLG     +  ++  R  +T+E+
Sbjct: 134 LNSIPLPAILAVFRAQQLDNYGLLTVDSNLIYSIVDVLLGGRRGTSAMRIEGRPYTTIER 193

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            L +R I  +     Q  +   +   +LE        +             + + + +E+
Sbjct: 194 MLVQRMIEVVLGDAKQAFAPLTDVEFDLERVET--NPRFAAIARPANAAILVKLRIDMED 251

Query: 193 VASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
                 L++P  TL     ++      +   +        A + +   + +   ++ ++ 
Sbjct: 252 RGGRIELLLPYATLEPIRKMLLQQFMGEKFGRDNIWEGHLATELWSTKMEVQAVLDEQRV 311

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
           +L  V  LK+G  +       +   L      +    +GR+G N  +R++  ++ 
Sbjct: 312 SLGTVANLKVGDTLYLDASPSSDVELRCGQVPLTRGRMGRIGHNVALRLSGPLSP 366


>gi|32266646|ref|NP_860678.1| flagellar motor switch protein FliM [Helicobacter hepaticus ATCC
           51449]
 gi|32262697|gb|AAP77744.1| flagellar motor switch protein FliM [Helicobacter hepaticus ATCC
           51449]
          Length = 353

 Score =  218 bits (555), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 49/304 (16%), Positives = 103/304 (33%), Gaps = 6/304 (1%)

Query: 16  ILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIH 75
           + L          K   +   S+     + L       M   V+I   S     +   + 
Sbjct: 37  VTLYDFKRPNRVSKEQLRAFKSIHDKMARSLSSQVSAVMRSIVEIQLHSVDQMTYGEFLM 96

Query: 76  SFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLA 135
           S      F+  S+        +  + ++   +++ LLG   +      +R  S +E  L 
Sbjct: 97  SLPSPTSFNIFSMKPLEGAAILEINPSIAFPMIDRLLGGKGDPYE--SSREFSDIELNLL 154

Query: 136 KRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVAS 195
              + Q+   L +  S+  E  P+++       +        NE V  + M + I + + 
Sbjct: 155 DTLLRQVMQNLKEAWSSITEIFPSVDAKESSPNV--VQIVAQNEIVIMVVMEIIIGHSSG 212

Query: 196 SFVLIIPQETLLKTTLISLSS--QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTL 253
              +  P  +L        S        +  +             NV +   +     TL
Sbjct: 213 MMSICYPVISLETVLSRLASRDLMLSDTSSKKSRNKELQALIAGANVIVSGYLGDATLTL 272

Query: 254 KDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKN 313
           K+++ L++G ++          I+S +G+E Y   +G      T++I + I  ++  +K 
Sbjct: 273 KEILDLQVGDIVRLDTIADDTIIVSVDGREKYIASIGLQRYRKTLQIKEVIKTEKDQVKE 332

Query: 314 FLHK 317
            L  
Sbjct: 333 VLEM 336


>gi|330721397|gb|EGG99462.1| Flagellar motor switch protein FliM [gamma proteobacterium
           IMCC2047]
          Length = 329

 Score =  218 bits (555), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 48/306 (15%), Positives = 99/306 (32%), Gaps = 12/306 (3%)

Query: 2   RGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDIS 61
               +              +                +   + +F  +     +     ++
Sbjct: 31  SQPPVDGGVKAYDLTSQDHIVRG------RLPTLEMINERFARFTEQSMFNLLRETPVVT 84

Query: 62  YTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQ 121
               ++ KFS            S   +             +LV+ L++   G        
Sbjct: 85  AAKIENIKFSEYTQMLGIPSSLSLVKIHPLRGTAMFVLDADLVVNLVDRFFGG-GVHDNA 143

Query: 122 LYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFV 181
           +  R  +  E+++ ++ ++Q+   + Q   T  +     E   + +          +E V
Sbjct: 144 IGEREFTVTEQRIIQKVLSQVFVDMKQAWQTIMDID--FEYLSNEENPAMIKAISPSEVV 201

Query: 182 TTINMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNV 240
                 + IE       + IP   L        S  Q  +E    +  +   R     +V
Sbjct: 202 VLSTFEIKIEEKGGRIQVAIPYSMLEPVREALDSGVQVDNEYTDGNWAEALQRDLRYASV 261

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            I  R+  +K TL++++  K G VIP    E +  IL ANG  IY   +G   ++  ++I
Sbjct: 262 PISCRVAERKITLREILNFKAGDVIPIDMPESS--ILMANGVPIYEAAVGASNEHLALKI 319

Query: 301 TDRINF 306
             +I+ 
Sbjct: 320 KRQIDR 325


>gi|325567500|ref|ZP_08144167.1| flagellar motor switch protein FliM [Enterococcus casseliflavus
           ATCC 12755]
 gi|325158933|gb|EGC71079.1| flagellar motor switch protein FliM [Enterococcus casseliflavus
           ATCC 12755]
          Length = 336

 Score =  218 bits (555), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 41/299 (13%), Positives = 94/299 (31%), Gaps = 10/299 (3%)

Query: 20  RLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKE 79
                    K        +   + K    +   ++  +V +   + +   +   IHS  +
Sbjct: 40  DFRRPTKLSKEYVNTLHMIFEDFSKMSSSMLSTQLRTNVSLQLAAIEQVSYDEFIHSIPK 99

Query: 80  NFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQL------YNRSLSTVEKK 133
             +         S    I  +  L + L+E L G       +         +S + +E  
Sbjct: 100 FTLLGLFHSQPLSGIQMIEMNPQLCMMLVELLCGGLDVYQNKPIEMDFSEKKSFTDIETA 159

Query: 134 LAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENV 193
           + +  +AQ   V              L+        +   N   NE V  +   + I  V
Sbjct: 160 ILEEVVAQFVRVYQNVWKDIVALDSVLDGIDT--NPQLMQNMSPNEPVVLVTFTIKIFEV 217

Query: 194 ASSFVLIIPQETLLKTTLISL--SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
                L IP              +  + ++  ++D      +    + +N++  +   + 
Sbjct: 218 KHFINLCIPYVFFEGIIDKLSFRNWFDSNQPVNQDDSRELQKSLNGVGLNLEVLLGHAQM 277

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
           +L + + L+ G VI    +         +GK  +  + G+      I + D++  +Q+ 
Sbjct: 278 SLSEFLHLEEGDVIKLDKKITEPLETFIDGKPYFRAKPGKQEDRLAIELLDKLEEEQEL 336


>gi|329298601|ref|ZP_08255937.1| flagellar motor switch protein FliM [Plautia stali symbiont]
          Length = 269

 Score =  218 bits (555), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 36/259 (13%), Positives = 82/259 (31%), Gaps = 4/259 (1%)

Query: 49  IFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLL 108
                +    DIS  + +   +     +       +   L        +  S +LV   +
Sbjct: 2   ALFNLLRRSPDISVGAIKIQPYHEFARNLPVPTNLNLIHLQPLRGTALVVFSPSLVFIAV 61

Query: 109 ENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDY 168
           +NL G       ++  R  +  E+++ +R +       +                  +  
Sbjct: 62  DNLFGGDGRFPTKVEGREFTHTEQRVIRRMLKLALEGYSDAWKAIYPLEVEYVRSE-MQV 120

Query: 169 LKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNK-SENQSEDL 227
              N     N+ V      + I N+   F + IP   +     + ++   + S  +    
Sbjct: 121 KFINITTSPNDIVVNTPFQVEIGNLVGEFNICIPFSMIEPLRELLVNPPLENSRQEDNHW 180

Query: 228 IDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSC 287
            D   ++     + +          L  ++ LK+G V+P         I   +G  + + 
Sbjct: 181 RDNLVKQVQHSELELIAHFAETSLRLSRILQLKLGDVLPIEKP--DRIIAHVDGVPVLTS 238

Query: 288 ELGRVGKNYTIRITDRINF 306
           + G +   Y +R+  +IN 
Sbjct: 239 QYGTLNGQYALRVEHQINP 257


>gi|269792932|ref|YP_003317836.1| flagellar motor switch protein FliM [Thermanaerovibrio
           acidaminovorans DSM 6589]
 gi|269100567|gb|ACZ19554.1| flagellar motor switch protein FliM [Thermanaerovibrio
           acidaminovorans DSM 6589]
          Length = 335

 Score =  218 bits (555), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 44/284 (15%), Positives = 95/284 (33%), Gaps = 7/284 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +    +   + + L       +   V     S     +   I S  +  V     
Sbjct: 48  SKDQLRAIQMIHDSFARQLTTSLSTLVRSMVSSEVVSVDQLAYDEFIRSLVQPTVIGVLE 107

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +   S N  +  + +LV  +++ +LG   E I +   R L+ +E+ + +R + +I   L 
Sbjct: 108 MYPLSGNAVLEMNPHLVFAIIDRMLGGKGEPIRKP--RDLTDIERTVVERVMLKILEHLE 165

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  ST  +     E                 + V  + + + +        L IP   + 
Sbjct: 166 ESWSTVVDIRFRFE--SMESNPFFVQICPGTDMVLLVTLKVQVGEAEGIMNLCIPYFVME 223

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
                        +      E   +    +  ++ V +   +     +L DV+ L+ G V
Sbjct: 224 PMIDKLSSQHWFASTGRKNVEGAREIIEARLSKVAVPVALELGHTVLSLGDVLQLREGDV 283

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
           I    +      L    +  + CE G   K+Y  R+ + ++ ++
Sbjct: 284 IRLDAKTSDPLGLRVGNRVKFLCEAGSFNKHYAARVLEVLSSEE 327


>gi|255022053|ref|ZP_05294059.1| Flagellar motor switch protein FliM [Acidithiobacillus caldus ATCC
           51756]
 gi|254968539|gb|EET26095.1| Flagellar motor switch protein FliM [Acidithiobacillus caldus ATCC
           51756]
          Length = 366

 Score =  218 bits (555), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 45/309 (14%), Positives = 92/309 (29%), Gaps = 12/309 (3%)

Query: 12  PLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFS 71
           PL  +   R+       ++       L   + +         + ++ DI   S Q  K+ 
Sbjct: 62  PLDLLNQDRM------NRSRMPTMEVLNDRFARSFRGSLFNYLRVNADIISLSAQIQKYG 115

Query: 72  HIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVE 131
             I        F   SL+    +        L   ++E   G +    P+L  R  S +E
Sbjct: 116 EYIGKIALPSYFVMVSLTPLRGSMLFIMDPYLCYAVIEAFFGGNGRLEPKLEGRDFSVIE 175

Query: 132 KKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIE 191
           +++  + I               +  P +         +  +   S E V      + +E
Sbjct: 176 QRVFNKIIDHAVEDFTSAWEPIIKLRPKVLRSDVKS--QFVSIASSTEGVVGSVFEIEME 233

Query: 192 NVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKK 250
             +      IP  T+       +S                         V++   +  + 
Sbjct: 234 RWSGKLYTCIPYNTVEPLREQLVSGVAADQSEMDPSWKQMLHMDIQNAMVDVSVILASQD 293

Query: 251 TTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR-ITDRINFDQK 309
             L    TL+ G V+ F   +   A +      I     G     Y ++ ++ R   ++ 
Sbjct: 294 IPLSRARTLQKGDVLSFDRVQD--ARVYVEDILIGEGRYGAFKNQYAVKLVSYRTPSEED 351

Query: 310 SLKNFLHKR 318
            L++   K+
Sbjct: 352 VLQSIRLKK 360


>gi|224370777|ref|YP_002604941.1| FliM [Desulfobacterium autotrophicum HRM2]
 gi|223693494|gb|ACN16777.1| FliM [Desulfobacterium autotrophicum HRM2]
          Length = 326

 Score =  217 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 34/286 (11%), Positives = 88/286 (30%), Gaps = 3/286 (1%)

Query: 20  RLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKE 79
             T +    +        +     + +       +  +VD++     + KF+  + S   
Sbjct: 40  DFTSQDKVVRARMPTFDVINERLSREIRTSLSGLLQTNVDVTANPLDTLKFTEFVRSLPV 99

Query: 80  NFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTI 139
                   +     +  +   + LV  L++   G       ++  R  + +E+ + K+ +
Sbjct: 100 PTSLHVFRMEPLRGHGLVVLESQLVYNLIDTFFGGEGLGKARVEGREFTAIEEVMIKKVV 159

Query: 140 AQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVL 199
                 + +     +    +L         +     L  + V      + +E  A + VL
Sbjct: 160 VACLKDIEKAWLPIEPVKTSLIRSEM--NPQFAAIVLPTDLVIVTRFEIELEQAAGNLVL 217

Query: 200 IIPQETLLKTTLISLS-SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVT 258
            +P   +        S  Q ++E               +  VN+  ++   + + + ++ 
Sbjct: 218 CLPYAMIEPLRAKLASGFQAETEEIDVAWRKRLQEIILESTVNLRVQLGTTEISGERLIY 277

Query: 259 LKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
           L+ G VI   +  K       +G        G        R+  ++
Sbjct: 278 LQPGDVIQLDNDAKDMLTGYVDGLPKVRGFAGVQRGFQAFRVEKKL 323


>gi|254470104|ref|ZP_05083508.1| flagellar motor switch protein FliM [Pseudovibrio sp. JE062]
 gi|211960415|gb|EEA95611.1| flagellar motor switch protein FliM [Pseudovibrio sp. JE062]
          Length = 409

 Score =  217 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 42/298 (14%), Positives = 100/298 (33%), Gaps = 4/298 (1%)

Query: 13  LHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSH 72
                +  L            +   +     +      +     +V++S  S  + +F  
Sbjct: 97  GDEGGIRALINSAMVSYERLPMLEIVFDRLVRLTTTSLRNFTSDNVEVSLDSMTNVRFGD 156

Query: 73  IIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGA-SHETIPQLYNRSLSTVE 131
            ++S     +        W     +   ++L+ ++++ LLG     +  ++  R  +T+E
Sbjct: 157 YLNSIPLPAILGVFKAKEWDGFGLVTVESSLIYSIIDVLLGGGRGSSPTRVEGRPYTTIE 216

Query: 132 KKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIE 191
             L +R I  I     Q        S  LE        +             + + + +E
Sbjct: 217 SNLVRRMIEIILLDAEQAFGPLSPVSFPLERLET--NPRFAAISRPANAAIMVELRIDME 274

Query: 192 NVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKK 250
           +      +++P  TL     + L     +   +     +  A + Y   V +D  +    
Sbjct: 275 DRGGKVEIVLPYATLEPIRDLLLQMFMGEKFGRDPIWEEHLATEVYSSEVQVDAVLYENT 334

Query: 251 TTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
             L+ V+ L++GQ + F    +    +   G ++    +G V    +I I+ ++   +
Sbjct: 335 IPLQRVLNLEVGQTLLFDTGPRDPVQVKCGGVQLTEGLMGHVDDRISIEISKKLKQPK 392


>gi|168334557|ref|ZP_02692713.1| flagellar motor switch protein FliM [Epulopiscium sp. 'N.t.
           morphotype B']
          Length = 327

 Score =  217 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 39/291 (13%), Positives = 86/291 (29%), Gaps = 6/291 (2%)

Query: 21  LTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKEN 80
                   +   +    +G  Y + + +     M   V I   S ++  FS    S    
Sbjct: 41  FARPTKFSREHLRTLELMGENYARLISQYLSGLMRTLVPIKVVSSEAITFSDFTSSLSNP 100

Query: 81  FVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIA 140
              +        +N  +  S N+    LE LLG     +  +  R  +++E  +  R + 
Sbjct: 101 IALAIVDPYPLKNNMLLELSTNVAFAFLERLLGGEGTELEHV--REFTSIELVILIRVLE 158

Query: 141 QISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLI 200
                + +         P +         +        E V  I  ++    V     L 
Sbjct: 159 HFVDYMREPWENMVALKPRMSRVET--NSQILNMIAPTEMVALITFSIQFGAVDGLMNLC 216

Query: 201 IPQETLLKTTLISLSSQNKSENQSE--DLIDPFARKTYQLNVNIDTRINLKKTTLKDVVT 258
           IP  T+        +S     +  +  +          + N+ +   +     T+K+ + 
Sbjct: 217 IPYLTVEPIMDKLNTSYQFQSSDDKKAERNTNVEYLLKRANIPMKAVVGQTHITVKEFIE 276

Query: 259 LKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQK 309
           L+IG +I       +   +       +    G       ++I   ++ +  
Sbjct: 277 LQIGDIIRLDTTIDSLIDVYVGNVVKFKAVPGIHKNKSAVQIKQILDKEDD 327


>gi|39995529|ref|NP_951480.1| flagellar motor switch protein FliM [Geobacter sulfurreducens PCA]
 gi|39982292|gb|AAR33753.1| flagellar motor switch protein FliM [Geobacter sulfurreducens PCA]
 gi|298504529|gb|ADI83252.1| flagellar motor switch protein FliM [Geobacter sulfurreducens
           KN400]
          Length = 328

 Score =  217 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 39/282 (13%), Positives = 96/282 (34%), Gaps = 4/282 (1%)

Query: 29  KTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASL 88
           K +      +   + ++       ++   V+I      S KF   I +       +    
Sbjct: 47  KGLVPNLDIIYDGFIRYQRGTLSNRLGRIVEIKKLGAGSYKFDDFIQTLPSPVCMAIYKA 106

Query: 89  SSWSSNFFIGCSNNLVITLLENLLGASHETIPQL-YNRSLSTVEKKLAKRTIAQISAVLN 147
                   I   + LV T+++ +LG +  T  Q   NR  +++E +L ++ +  +   L 
Sbjct: 107 DPLKGAALIAFDSTLVFTIVDCILGGTGMTSVQTSANRMFTSIELRLVQKIVQDMLVDLE 166

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  +    +  +L         +          V T+ M + I+ +    V  +P  T+ 
Sbjct: 167 KAWAPLYAAKMSL--LRMEMNPRLVNIVPPEYQVVTMEMQIQIDQLEGKMVFAVPYMTIE 224

Query: 208 KTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIP 266
                    +Q              +++  +  +++   +     +L D+++L  G  I 
Sbjct: 225 PIRDKLKSGAQFDLMAIDPQWSFRLSKELLEAPLDVSVEVGGAVISLNDLLSLVPGDTIM 284

Query: 267 FLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQ 308
                 +   +   G   ++   G    N  ++IT+ +   +
Sbjct: 285 LDTPCTSDLTVKVGGVPKFTGMPGIRHGNKALQITNVVGKGE 326


>gi|83858803|ref|ZP_00952325.1| flagellar motor switch protein [Oceanicaulis alexandrii HTCC2633]
 gi|83853626|gb|EAP91478.1| flagellar motor switch protein [Oceanicaulis alexandrii HTCC2633]
          Length = 385

 Score =  217 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 37/294 (12%), Positives = 102/294 (34%), Gaps = 4/294 (1%)

Query: 14  HPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHI 73
               +  +            +   +     + +    +     +V++S  +  S +F   
Sbjct: 83  ERSGIRAIINSALVSYERLPMLEIVFDRLVRLMTTSLRNFTSDNVEVSLDNISSIRFGDY 142

Query: 74  IHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGAS-HETIPQLYNRSLSTVEK 132
           ++S     + +        +   +   +NL+ ++++ LLG     +  ++  R  +T+E+
Sbjct: 143 LNSIPLPAILAVFRAKQLDNYGLLTVDSNLIYSIVDVLLGGRRGTSAMRVEGRPYTTIER 202

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            L +R I  + A   Q  +   E   +L+        +             + + + +E+
Sbjct: 203 TLVQRMIEVVLADARQAFAPLTEVDFDLDRVET--NPRFAAIARPANAAILVKLRIDMED 260

Query: 193 VASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
                 L++P  TL     ++      +   +        A + +   + +   ++  + 
Sbjct: 261 RGGRIELLLPYATLEPIRKMLLQQFMGEKFGRDNIWESHLATELWSTKMEVSAVLDEMQK 320

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
            L +V+ LK+G  +           L      +    +GR+G N  +R+   ++
Sbjct: 321 PLGEVMQLKVGDTLMLDAGPDGLIELRCGTVPLAHGHMGRIGHNIGVRLDRPLS 374


>gi|167645399|ref|YP_001683062.1| flagellar motor switch protein FliM [Caulobacter sp. K31]
 gi|167347829|gb|ABZ70564.1| flagellar motor switch protein FliM [Caulobacter sp. K31]
          Length = 377

 Score =  217 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 33/288 (11%), Positives = 94/288 (32%), Gaps = 4/288 (1%)

Query: 14  HPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHI 73
               +  +            +   +     + +    +     +V++S  +  S +F   
Sbjct: 75  DRTGIRAIINSALVSYERLPMLEIVFDRLVRLMTTSLRNFTSDNVEVSLDNISSIRFGDY 134

Query: 74  IHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGAS-HETIPQLYNRSLSTVEK 132
           ++S     + +        +   +   +NL+ ++++ LLG        ++  R  +T+E+
Sbjct: 135 LNSIPLPAILAVFRAEELDNYGLLTVDSNLIYSIVDVLLGGRRGTAAMRIEGRPYTTIER 194

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            L +R +  +              S  L+        +             + + + +E+
Sbjct: 195 VLVQRMVEVVLHDAKAAFEPLHPVSFTLDRLET--NPRFAAIARPANAAILVKLRIDMED 252

Query: 193 VASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
                 L++P  TL     ++      +   +        A + +   + +   ++ ++ 
Sbjct: 253 RGGRIELLLPYATLEPIRKMLLQQFMGEKFGRDNIWEGHLATELWTTQMEVRAVLDEQQL 312

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
            L  V+ LK+G  +       +   L A    +    +GR   +  +R
Sbjct: 313 PLSRVLDLKVGDTLMLNATTDSLVELRAGSIPLTRGRMGRRNHSIAVR 360


>gi|257871319|ref|ZP_05650972.1| flagellar motor switch protein fliM [Enterococcus gallinarum EG2]
 gi|257805483|gb|EEV34305.1| flagellar motor switch protein fliM [Enterococcus gallinarum EG2]
          Length = 332

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 42/299 (14%), Positives = 94/299 (31%), Gaps = 10/299 (3%)

Query: 20  RLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKE 79
                    K        +   + K    +   ++  +V +   + +   +   IHS  +
Sbjct: 36  DFRRPTKLSKEYVNTLHMIFEDFSKMSSSMLSTQLRTNVSLQLAAIEQVSYDEFIHSIPK 95

Query: 80  NFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQL------YNRSLSTVEKK 133
             +         S    I  +  L + L+E L G       +         +S + +E  
Sbjct: 96  FTLLGLFHSQPLSGIQMIEMNPQLCMMLVELLCGGLDVYQNKPIEMDFSEKKSFTDIETA 155

Query: 134 LAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENV 193
           + +  +AQ   V              L+        +   N   NE V  +   + I  V
Sbjct: 156 ILEEVVAQFVRVYQNVWKDIVALDSVLDGIDT--NPQLMQNMSPNEPVVLVTFTIKIFEV 213

Query: 194 ASSFVLIIPQETLLKTTLISL--SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
                L IP              +  + ++  ++D      +    + +N++  +   + 
Sbjct: 214 KHFINLCIPYVFFEGIIDKLSFRNWFDSNQPVNQDDSRELQKSLNGVGLNLEVLLGHAQM 273

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKS 310
           +L + + L+ G VI    +         +GK  +  + G+      I + D++  +QK 
Sbjct: 274 SLSEFLHLEEGDVIKLDKKITEPLETFIDGKPYFRAKPGKQEDRLAIELLDKLEEEQKL 332


>gi|254504068|ref|ZP_05116219.1| flagellar motor switch protein FliM, putative [Labrenzia alexandrii
           DFL-11]
 gi|222440139|gb|EEE46818.1| flagellar motor switch protein FliM, putative [Labrenzia alexandrii
           DFL-11]
          Length = 319

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 49/316 (15%), Positives = 120/316 (37%), Gaps = 7/316 (2%)

Query: 4   QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYT 63
           QS   +   +   +  RL    G       +   +     + +  + ++K      IS +
Sbjct: 9   QSTSNSERAM---ITDRLLDAAGISVDRLPMLPVVFDRMARLMADVMRQKSPSPSYISVS 65

Query: 64  SCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLY 123
             ++ +   ++  F+ N + +      W +   +G   + + TL++ L GA     P   
Sbjct: 66  YVENNRIGDVLDEFESNALVAVLYSPEWDARVLVGFDRDFIFTLVDVLFGADGTEPPIDE 125

Query: 124 NRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTT 183
            R  S +E ++A+      +  L +  +   E++  +E       +       SN     
Sbjct: 126 ERPFSNIETRIARTIFEIAAKSLAESFAPIAETTLKIERIE--SRMDFAVVGRSNNPAVV 183

Query: 184 INMNMTIENVASSFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNI 242
             +            +++P  TL             +   + +     F  +  +  V +
Sbjct: 184 GRLLQQAIGRGGEVFVVLPHATLNPLRQALSQVLSGEMSGRDKQWTQHFHNEIQRTEVKL 243

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
           +  +  ++  L ++  LK+GQVI      ++   L+ N + I++C+LG++  +YT++I +
Sbjct: 244 EAILEEREMHLGELSNLKVGQVIELQATARSPVTLACNDQPIFTCQLGQLDGSYTLQIEE 303

Query: 303 RI-NFDQKSLKNFLHK 317
            I   ++    +  ++
Sbjct: 304 LIHEEEKDLFDDLRNR 319


>gi|302874572|ref|YP_003843205.1| flagellar motor switch protein FliM [Clostridium cellulovorans
           743B]
 gi|307690817|ref|ZP_07633263.1| flagellar motor switch protein FliM [Clostridium cellulovorans
           743B]
 gi|302577429|gb|ADL51441.1| flagellar motor switch protein FliM [Clostridium cellulovorans
           743B]
          Length = 331

 Score =  216 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 41/275 (14%), Positives = 97/275 (35%), Gaps = 7/275 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +    +   Y + +      ++  +V +   S +   +   IHS +   + +   
Sbjct: 48  SKDHIRTLELIHDNYARIISSYLTAQVRSNVKVKIESVEQTTYEEFIHSIQNPTILTVFK 107

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +   + N     +   V  +++ LLG + E   +  NR  + ++K +  R    + + L 
Sbjct: 108 MPPLAGNILFETNPQFVYQIIDILLGGTGE--GKYKNREFTDIDKNIITRINEGLISNLK 165

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
              S   E +P +E          N     +E V  I   + I    +   + IP   + 
Sbjct: 166 LAWSEVLEVNPEIETIET--NPALNQTLAPHEPVALIIFTIEIGESRTYINICIPFICIE 223

Query: 208 KTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
           K            + S+ + E   +    K   + +  +  +     T++D + L +G V
Sbjct: 224 KYLDHLEIKHWYHDSSDEEDEVTKEYLRMKLDSVQLVSEVILGNASVTVEDFLNLTVGDV 283

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIR 299
           +    + +    +    +  +  + G +GK   ++
Sbjct: 284 VTLERKFEDPLEVVIEERPHFLAKPGIIGKKTGVQ 318


>gi|222823278|ref|YP_002574851.1| flagellar motor switch protein FliM [Campylobacter lari RM2100]
 gi|222538499|gb|ACM63600.1| flagellar motor switch protein FliM [Campylobacter lari RM2100]
          Length = 363

 Score =  216 bits (551), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 47/292 (16%), Positives = 98/292 (33%), Gaps = 6/292 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +    +     + L       M   V+I   S     +   + S      F+  S
Sbjct: 51  SKEQLRSIKGIHDKLARNLASQISSMMRSIVEIKLHSVDQMTYGEFLMSLPSPTSFNVFS 110

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           +     N  +  + ++   +++ LLG   ++   L  R L+ +E  L    +  I   L 
Sbjct: 111 IKPLDGNCVLEINPSIAFPMIDRLLGGQGDSFDTL--RELTEIELNLLDSILRIIMQRLK 168

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +      E  P++E       +        NE V  + M + I N +    +  P   L 
Sbjct: 169 ESWMNVTEIYPSVEAKESSPNV--VQIVSQNEIVIMVVMEIIIGNSSGMVNICYPVVHLE 226

Query: 208 KTTLISLSS--QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVI 265
                  +        +  +           +  V  +  +      + + + LK G ++
Sbjct: 227 SILSRLANRDIMMGETSAKKSRNKELKTLIGRAEVIYEAMLGKTFINVNEFLDLKQGDIL 286

Query: 266 PFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLHK 317
                    AI++ + KE++  ++G      +I+I + I  D+  +K  L K
Sbjct: 287 KLDRSADDKAIVAIDKKEVFLAQVGLHRFRKSIKILELIKTDKDEIKEMLEK 338


>gi|134300220|ref|YP_001113716.1| flagellar motor switch protein FliM [Desulfotomaculum reducens
           MI-1]
 gi|134052920|gb|ABO50891.1| flagellar motor switch protein FliM [Desulfotomaculum reducens
           MI-1]
          Length = 330

 Score =  216 bits (551), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 47/277 (16%), Positives = 98/277 (35%), Gaps = 7/277 (2%)

Query: 29  KTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASL 88
           K   +    L   Y + L       +   + I   S     +   I+S     V +  SL
Sbjct: 49  KEQLRTLHVLHEGYARLLSNFLSGYLRTPITIEIASIGQFTYEEFINSVPSPTVMTIFSL 108

Query: 89  SSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQ 148
           +    +  +  +   +  +++   G   E  P+   R L+ +E  ++ R I ++   L  
Sbjct: 109 APLKGSALMETNLQFLFPIIDLQFGGLGEMPPKT--RELTDIELSVSNRIIKRLLDHLTI 166

Query: 149 CISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTI-ENVASSFVLIIPQETLL 207
                   SP +E          +     N+ V  I  +  + E V     L +P   L 
Sbjct: 167 SWKDIMSVSPKVESIDA--NPHLHQLMSPNDIVVVITFSTGVAEEVRGLINLCLPYSLLD 224

Query: 208 KTTLI--SLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVI 265
                    +   K+  Q +  +        + +V I   +   + T+KD + L++G V+
Sbjct: 225 PILSKFSMANQFTKTTEQDQKELMALEYWLGESDVAISVVMGEAQITVKDFLQLQVGDVL 284

Query: 266 PFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
           P          +  + +  Y  ++G VG++  +++T 
Sbjct: 285 PLGRGLTQDLDMYVDEELKYKVQVGTVGQSLAVQVTS 321


>gi|208434362|ref|YP_002266028.1| flagellar motor switch protein [Helicobacter pylori G27]
 gi|208432291|gb|ACI27162.1| flagellar motor switch protein [Helicobacter pylori G27]
          Length = 334

 Score =  216 bits (551), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 48/312 (15%), Positives = 102/312 (32%), Gaps = 6/312 (1%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
           K+  P   + L          K   +   S+     + L       M   V+I   S   
Sbjct: 9   KDIIPQRSVTLYDFKRPNRVSKEQLRSFRSIHDKMARNLSSQISSIMRSIVEIQLHSVDQ 68

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSL 127
             +   + S      F+  S+        +  + ++   +++ LLG       Q  NR  
Sbjct: 69  MTYGEFLMSLPSPTSFNVFSMKPMGGTGVLEINPSIAFPMIDRLLGGKGSAYDQ--NREF 126

Query: 128 STVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMN 187
           S +E  L    + Q+  +L +  S   E  P ++       +        NE    + + 
Sbjct: 127 SDIELNLLDTILRQVMQILKEVWSPVVEMYPTIDAKESSANV--VQIVAQNEISIMVVLE 184

Query: 188 MTIENVASSFVLIIPQETLLKTTLISLSS--QNKSENQSEDLIDPFARKTYQLNVNIDTR 245
           + I +      +  P  ++        S        N  +            ++V++   
Sbjct: 185 IIIGHSRGMMNICYPVISIESILSKMGSRDLMLSETNSKKSRNKELQALLSGVSVDMMVF 244

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           +   + +LK+++ L +G  I           +  + K+ Y   +G  G   TI+I + + 
Sbjct: 245 LGAVELSLKEMLDLDVGDTIRLNKIANDEVSVYVHKKKRYLASVGFQGYRKTIQIKEVVY 304

Query: 306 FDQKSLKNFLHK 317
            +++  K  L  
Sbjct: 305 SEKERTKEILEM 316


>gi|242281039|ref|YP_002993168.1| flagellar motor switch protein FliM [Desulfovibrio salexigens DSM
           2638]
 gi|242123933|gb|ACS81629.1| flagellar motor switch protein FliM [Desulfovibrio salexigens DSM
           2638]
          Length = 326

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 49/302 (16%), Positives = 93/302 (30%), Gaps = 10/302 (3%)

Query: 7   HKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQ 66
                        R+            +   +   + +         M   VDI+  S  
Sbjct: 32  DSGVVSFDLANQDRIIRG------RMPVLEIVNDRFARLATNNLANTMRKRVDINPISID 85

Query: 67  SGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRS 126
             KF   + S       S   +     N  +   + LV  L+E+  G S     ++  R 
Sbjct: 86  MSKFGDFMRSLPVPTSLSIFKMDPLRGNAILVVDSRLVFALVESFFGGSGSQP-KVEGRD 144

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
            + +E+ +  R +    + L        E    L         +       ++ V  I  
Sbjct: 145 FTPIEQAIVDRVVKIALSNLEDSWRPVHEVHLELVR--SEVNPQFAAIVPPSDVVVVITF 202

Query: 187 NMTIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNIDTR 245
            + +EN   S ++ +P  TL         S Q++        +  F  +  +  V++  R
Sbjct: 203 EVELENAIGSLIVCLPYSTLEPIRSKLHASFQSERLEIDHVWVSRFKERLLETPVDLLVR 262

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           +   K T + ++ L+ G ++     E+        G   Y    GRV  N   +I   I 
Sbjct: 263 LGKTKITGRQLLNLEEGDLLLLDTDEEDMLECEVGGVLKYLGSPGRVKANRAFQIAQAIE 322

Query: 306 FD 307
             
Sbjct: 323 PK 324


>gi|291519586|emb|CBK74807.1| Flagellar motor switch protein [Butyrivibrio fibrisolvens 16/4]
          Length = 272

 Score =  216 bits (550), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 37/275 (13%), Positives = 96/275 (34%), Gaps = 7/275 (2%)

Query: 36  SSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNF 95
             +   Y + L       +  ++ +   + ++  +    +S     +      +   +N 
Sbjct: 2   EIIFEHYGRLLSTNLPIFLRKNIQVEVINSEAVTYMEFSNSLSNPVLLGIVDFAPLETNI 61

Query: 96  FIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQE 155
            +  ++NL   +++ +LG   E + ++  R  S +E  + +R +     +L +      +
Sbjct: 62  IVEMASNLGFAMVDRMLGGVGEPLDKV--RDFSEIELLIIERVMTSCVELLREPWENVLD 119

Query: 156 SSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISL- 214
           + P LE        +       +E +  + +N+ I +V     + +P  TL         
Sbjct: 120 AHPRLERIET--NSQFAQIISPSEMIAIVTLNIKIGDVEGLMNICLPFITLEPVMDKLNT 177

Query: 215 --SSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREK 272
                ++ E       D       +  + +   +     T+ D   L++G ++    +  
Sbjct: 178 KFWYSSQKEKTGASFSDTVEALISRAKIPVKAVLGNSVITVADFSQLQVGDIVKLDTKVD 237

Query: 273 TCAILSANGKEIYSCELGRVGKNYTIRITDRINFD 307
               +       ++   G  GK Y +R+T  I  +
Sbjct: 238 EELDVFVGDIRKFAALPGASGKEYAVRVTQIIREE 272


>gi|323490151|ref|ZP_08095371.1| flagellar motor switch protein FliM [Planococcus donghaensis
           MPA1U2]
 gi|323396199|gb|EGA89025.1| flagellar motor switch protein FliM [Planococcus donghaensis
           MPA1U2]
          Length = 327

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 42/299 (14%), Positives = 93/299 (31%), Gaps = 13/299 (4%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
           +N          R        +   +  S +   + + L   F  ++   V +       
Sbjct: 29  RNVQAYDFKKALRF------SQDQIRTLSRIHENFSRLLSSYFSAQLRTYVQVGVEVVAE 82

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSL 127
             +   + + ++  +      +    +  +  S N+V  + + LLG     + +     L
Sbjct: 83  ISYEEFVENVQKKSMLGVFEAAPLQGSMVMEFSPNVVHVMFDRLLGGQGHVLEKDS--EL 140

Query: 128 STVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMN 187
           + +E  + +R  A+      +   +  + SP L         +  T    NE V  + + 
Sbjct: 141 TEIEISVIERVFAKALDCFQEAWLSVVKLSPEL--KEIEVNSQFLTTSPPNETVILVKLQ 198

Query: 188 MTIENVASSFVLIIPQETLLKTTLISL---SSQNKSENQSEDLIDPFARKTYQLNVNIDT 244
             I NV     + +P   L +            N+ +      +     K +   + I  
Sbjct: 199 TKIGNVEGVINICLPHVVLEQILPKLSAKHWLANQKKAIEAHEVVALEEKLHGTKMEIKA 258

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDR 303
            +        D + LK G VI       +   L  + K  +  + G       I++T+ 
Sbjct: 259 VLGQSMIEFGDFLNLKKGDVIRLDESYDSPVTLQVDNKLKFYAQPGVSKGRMAIQVTEV 317


>gi|197104384|ref|YP_002129761.1| flagellar motor switch protein FliM [Phenylobacterium zucineum
           HLK1]
 gi|196477804|gb|ACG77332.1| flagellar motor switch protein FliM [Phenylobacterium zucineum
           HLK1]
          Length = 358

 Score =  215 bits (548), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 36/281 (12%), Positives = 101/281 (35%), Gaps = 4/281 (1%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
                 +   +     + +    +     +V++S  +  S +F   ++S     + S   
Sbjct: 70  SYERLPMLEIVFDRLVRLMTTSLRNFTSDNVEVSLDNISSIRFGDYLNSIPLPAILSVFR 129

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGAS-HETIPQLYNRSLSTVEKKLAKRTIAQISAVL 146
               ++   +   +NL+ ++++ LLG        ++  R  +T+E+ L +R +  + A  
Sbjct: 130 AEELNNYGLLTVDSNLIYSIVDVLLGGRRGTAAMRIEGRPYTTIERVLVQRMVEVVLADA 189

Query: 147 NQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETL 206
            +        S  L+        +             + + + +E+      L++P  TL
Sbjct: 190 REAFEPLTPVSFTLDRLET--NPRFAAIARPANAAILVKLRIDMEDRGGRIELLLPYATL 247

Query: 207 LKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVI 265
                ++      +   +        A + +  N+ +   ++ ++ +L+ V+ LK+G  +
Sbjct: 248 EPIRKMLLQQFMGEKFGRDNIWESHLATELWTTNMEVRAVLDEQQVSLQKVLDLKVGDTL 307

Query: 266 PFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINF 306
                  +   L A    +    +GR   +  +R+   ++ 
Sbjct: 308 MLNATPDSLIELRAGAIPLTRGRMGRRNHHIAVRVEAPLSP 348


>gi|329849711|ref|ZP_08264557.1| flagellar motor switch protein FliM [Asticcacaulis biprosthecum
           C19]
 gi|328841622|gb|EGF91192.1| flagellar motor switch protein FliM [Asticcacaulis biprosthecum
           C19]
          Length = 388

 Score =  215 bits (548), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 36/290 (12%), Positives = 101/290 (34%), Gaps = 4/290 (1%)

Query: 14  HPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHI 73
               +  +            +   +     + +    +     +V++S  +  S +F   
Sbjct: 84  ERSGIRAIINSAMVSYERLPMLEIVFDRLVRLMTTSLRNFTSDNVEVSLDNISSIRFGDY 143

Query: 74  IHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGAS-HETIPQLYNRSLSTVEK 132
           ++S     + +        +   +   +NL+ ++++ LLG        ++  R  +T+E+
Sbjct: 144 LNSIPLPAILAVFRAEELDNYGLLTVDSNLIYSIVDVLLGGRRGTAALRIEGRPYTTIER 203

Query: 133 KLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN 192
            L +R +  +     Q        + NL+        +             + + + +E+
Sbjct: 204 VLVQRMVEVVLNDARQAFEPLTAVNFNLDRLET--NPRFAAIARPANAAILVKLRIDMED 261

Query: 193 VASSFVLIIPQETLLKTT-LISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKT 251
                 L++P  TL     ++ L    +   +        A + +   + +   ++ ++ 
Sbjct: 262 RGGRIELLLPYATLEPIRKMLLLQFMGEKFGRDNIWESHLATELWTTQMEVRAVLDEQQV 321

Query: 252 TLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRIT 301
            L  V+ LK+G+ I    +  +   L      + +  +GR G +  +R+ 
Sbjct: 322 PLSRVLNLKVGETIVLNAQADSPVQLRCGQIPLTTGRMGRKGHSIAVRVD 371


>gi|268678938|ref|YP_003303369.1| flagellar motor switch protein FliM [Sulfurospirillum deleyianum
           DSM 6946]
 gi|268616969|gb|ACZ11334.1| flagellar motor switch protein FliM [Sulfurospirillum deleyianum
           DSM 6946]
          Length = 353

 Score =  215 bits (548), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 49/310 (15%), Positives = 103/310 (33%), Gaps = 6/310 (1%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
           S   + +    ++L          K   +    +     + L       M   V+I   S
Sbjct: 25  SSELDNTESKQVILYDFKRPNRVSKEQLRAVKGIHDKMARNLASQISAIMRSIVEIQLHS 84

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
                +   + S      F+  S+     N  I  + ++   +++ LLG   E+      
Sbjct: 85  VDQMTYGEFLMSLPSPTSFNVFSIKPLDGNCIIEINPSIAFPMIDRLLGGLGESYE--AT 142

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R L+ +E  L    +  I   L +  +   +  P +E       +        NE V  +
Sbjct: 143 RELTDIELNLLDAILRIIMQRLKEGWAPITDMYPAIETKESSPNV--VQIVSQNEIVIMV 200

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLISLSS--QNKSENQSEDLIDPFARKTYQLNVNI 242
            M + I N +    L  P   L        +        +  +           +  V  
Sbjct: 201 VMEIIIGNSSGMINLCYPVIYLEPILSRLANRDIMLGETSAKKSRNKELNTLISRAEVFN 260

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
           +  I   + ++ +++ LK G ++         AI+  + KE++  E+G    + +I+I  
Sbjct: 261 EAIIGQAELSVGELLELKKGDIVRLDRAADDKAIVMIDKKELFLAEIGLHRFHKSIKIER 320

Query: 303 RINFDQKSLK 312
            +  D+  +K
Sbjct: 321 LVKTDKDEVK 330


>gi|109947667|ref|YP_664895.1| flagellar motor switch protein FliM [Helicobacter acinonychis str.
           Sheeba]
 gi|109714888|emb|CAJ99896.1| fliM [Helicobacter acinonychis str. Sheeba]
          Length = 354

 Score =  215 bits (548), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 48/312 (15%), Positives = 103/312 (33%), Gaps = 6/312 (1%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
           K+ +P   + L          K   +   S+     + L       M   V+I   S   
Sbjct: 29  KDITPQRSVTLYDFKRPNRVSKEQLRSFRSIHDKMARNLSSQISSIMRSIVEIQLHSVDQ 88

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSL 127
             +   + S      F+  S+        +  + ++   +++ LLG       Q  NR  
Sbjct: 89  MTYGEFLMSLPSPTSFNVFSMKPMGGTGVLEINPSIAFPMIDRLLGGKGSAYDQ--NREF 146

Query: 128 STVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMN 187
           S +E  L    + Q+  +L +  S   E  P ++       +        NE    + + 
Sbjct: 147 SDIELNLLDTILRQVMQILKEVWSPVVEMYPTIDAKESSANV--VQIVAQNEISIMVVLE 204

Query: 188 MTIENVASSFVLIIPQETLLKTTLISLS--SQNKSENQSEDLIDPFARKTYQLNVNIDTR 245
           + I +      +  P  ++        S        N  +            ++V++   
Sbjct: 205 IIIGHSRGMMNICYPVISIESILSKMGSRDFMLSETNSKKSRNRELQALLSSVSVDMIVL 264

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           +   + +LK+++ L +G  I           +  + K+ Y   +G  G   TI+I + + 
Sbjct: 265 LGAVELSLKEMLDLDVGDTIRLNKVANDEVSVYVHKKKRYLASVGFQGYRKTIQIKEVVY 324

Query: 306 FDQKSLKNFLHK 317
            +++  K  L  
Sbjct: 325 SEKEHTKEILEM 336


>gi|323703196|ref|ZP_08114849.1| flagellar motor switch protein FliM [Desulfotomaculum nigrificans
           DSM 574]
 gi|323531855|gb|EGB21741.1| flagellar motor switch protein FliM [Desulfotomaculum nigrificans
           DSM 574]
          Length = 330

 Score =  214 bits (546), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 45/286 (15%), Positives = 99/286 (34%), Gaps = 7/286 (2%)

Query: 29  KTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASL 88
           K   +    L   Y + L       +   + I   S     +   I+S     V +  SL
Sbjct: 49  KEQLRTLQVLHEGYARLLSNFLSGYLRTTITIEVASIGQFTYEEFINSVPTPTVMTIFSL 108

Query: 89  SSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQ 148
           S       +  +   +  L++   G S +   ++  R L+ +E  +A R I ++   L  
Sbjct: 109 SPLKGTALMETNLQFLFPLIDLQFGGSGDMPMKV--RELTDIELSVANRIIKRLLDHLTV 166

Query: 149 CISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIEN-VASSFVLIIPQETLL 207
                   +P +E          +     N+ V  +  +  + N V     + +P   L 
Sbjct: 167 TWKDIATITPKIESIDA--NPHLHQLMSPNDIVAVLTFSTAVGNEVKGLINMCLPYNFLD 224

Query: 208 KTTLISLS--SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVI 265
                  +     +   Q E  ++       + +V I   +     ++KD + L++G V+
Sbjct: 225 PVLAKFSAANQFTRDNEQKEQDLEALEFWLGESDVEISVVVGETDISVKDFLQLQVGDVL 284

Query: 266 PFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSL 311
           P          +  + +  Y  ++G VG++  +++T       + +
Sbjct: 285 PLARGFNQDLDMYVDNELKYKVQVGTVGQSLAVQVTSLAEEAWEIV 330


>gi|149179192|ref|ZP_01857759.1| flagellar motor switch protein fliM [Planctomyces maris DSM 8797]
 gi|148841965|gb|EDL56361.1| flagellar motor switch protein fliM [Planctomyces maris DSM 8797]
          Length = 349

 Score =  214 bits (546), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 40/293 (13%), Positives = 95/293 (32%), Gaps = 5/293 (1%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +   +L   + +         +   +++   S     +S  + S +    F+   
Sbjct: 53  SKEQMRAFRALHESFSREFGAALSGMLRSIIEVKLISVDQLTYSEFVFSLENPTCFNLLE 112

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
             +   +  +  S +++  +++ LLG    +     NR+L+ +E +L  R        + 
Sbjct: 113 SETLDGHIILDISPSIIFPIIDRLLGGDGHSHGAYPNRALTEIEIRLVSRITGLAIEGIE 172

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
              S   +    +         +       NE +  I+  +T+        L IP  T+ 
Sbjct: 173 SAWSNLCDWKLRVS--QVESNPQLVQIVPPNEVIVLISFEVTMGETRGIINLCIPFNTIE 230

Query: 208 KTTLIS---LSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQV 264
             +        S  K ++              +  + +   ++  K T  +V+ L +G V
Sbjct: 231 PLSNKLTSDTWSAYKKKSPDLRQQLNLEASVSKSKIAMRVELDNSKLTAGEVLNLAVGDV 290

Query: 265 IPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLHK 317
           I           +   G  +++   G    +  I I   +   +  ++  L K
Sbjct: 291 IMCNKGSAQSLTVELEGSPVFTAFPGVYKGHKAISIEKMLAIPRDVIEERLKK 343


>gi|170741398|ref|YP_001770053.1| flagellar motor switch protein FliM [Methylobacterium sp. 4-46]
 gi|168195672|gb|ACA17619.1| flagellar motor switch protein FliM [Methylobacterium sp. 4-46]
          Length = 303

 Score =  214 bits (546), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 57/303 (18%), Positives = 113/303 (37%), Gaps = 3/303 (0%)

Query: 16  ILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIH 75
            +  RL    G       + + +            K      +  S  S +SG F  ++ 
Sbjct: 3   DVRDRLLDASGLSPDRLPMLNVIFDRLATACADNLKHLAVSPIFYSLMSVESGLFGDLLE 62

Query: 76  SFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLA 135
            ++ N V        W  +  +G   + V T++E LLGA     P    R+ S++E ++A
Sbjct: 63  PYEANAVVGIFYSPQWDGHLLVGLDRDFVFTMVEVLLGADGSEPPVEEARNFSSIELRIA 122

Query: 136 KRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVAS 195
           + T  QI   L    +    ++  LE       +        +         +   N   
Sbjct: 123 QMTFEQIGKALEAAFALVSVATLKLERTET--RMDFAIIGRRSNKAVAAKFLLQALNRGG 180

Query: 196 SFVLIIPQETLLKTTLISLSS-QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLK 254
              LIIPQ  L             +S ++        + +  +  V +   +  +  TL 
Sbjct: 181 EMFLIIPQAVLNPMRQSLSKVLTGESTSRDPRWEKQISTEVRKTEVTLRAVLEERTLTLG 240

Query: 255 DVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNF 314
           ++  LK+GQV+      ++   L  N + ++ C++G+    Y +R+ D+I+ D++ +   
Sbjct: 241 EIADLKVGQVLTLDATPRSRVKLQGNDQALFWCQVGQANGAYVLRVEDQIDQDKEFMDGV 300

Query: 315 LHK 317
           L +
Sbjct: 301 LAR 303


>gi|317051535|ref|YP_004112651.1| flagellar motor switch protein FliM [Desulfurispirillum indicum S5]
 gi|316946619|gb|ADU66095.1| flagellar motor switch protein FliM [Desulfurispirillum indicum S5]
          Length = 329

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 43/306 (14%), Positives = 99/306 (32%), Gaps = 13/306 (4%)

Query: 6   IHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSC 65
             K  S        R+       K   +   +L   + +         +    D++  S 
Sbjct: 33  TKKKVSLYDFKRPDRV------SKDQMRSIKNLHDKFARNFSSSLSGYLRSITDMNLISV 86

Query: 66  QSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNR 125
               +   + S      F+  S+     N  +  + +LV  +++ LLG   E I ++  R
Sbjct: 87  DQMTYGEFLMSLPNPTSFNIISMLPLDGNAVLEVNPSLVFPIIDKLLGGQGEPIDEV--R 144

Query: 126 SLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTIN 185
            ++ +E+ +    +A     L +           +E                NE V  + 
Sbjct: 145 EITDIEQNVIGGVLAIALRELAEVWQPIINIRFKIELRET--SPHVIQIVSQNEVVILLV 202

Query: 186 MNMTIENVASSFVLIIPQETLLKTT---LISLSSQNKSENQSEDLIDPFARKTYQLNVNI 242
             + + +V+    + IP   L                 +  +   +        +   N+
Sbjct: 203 FEIKVGDVSGMMNICIPAIVLEPIMQKIDSQDWLIGAKKMHATANVQQITSIVSKSRTNL 262

Query: 243 DTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
              +     TL++++ L+IG ++    + +   +L     + Y  E+G +  N   +I  
Sbjct: 263 QAVLGESTMTLREILDLEIGDILTLSTKVRDPMVLQVGDMKKYYGEIGIIDNNKAFKIHR 322

Query: 303 RINFDQ 308
           +I  + 
Sbjct: 323 KIVKED 328


>gi|291288740|ref|YP_003505556.1| flagellar motor switch protein FliM [Denitrovibrio acetiphilus DSM
           12809]
 gi|290885900|gb|ADD69600.1| flagellar motor switch protein FliM [Denitrovibrio acetiphilus DSM
           12809]
          Length = 336

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 51/305 (16%), Positives = 102/305 (33%), Gaps = 12/305 (3%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
           K  S        R+       K   +   +L   + +         +    DI+ TS   
Sbjct: 36  KKISVYDFRRPDRV------SKEQLRSIRNLHDKFARNFSSTLSNYLRTITDITLTSVDQ 89

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSL 127
             +   + S  +   F+  S+     N  +  + +LV  +++ LLG + + + Q   R L
Sbjct: 90  MTYGEFLMSLPDPTSFNIISMIPMEGNAVLEINPSLVFPIVDKLLGGTGKPLFQT--REL 147

Query: 128 STVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMN 187
           +++E+ +    +  I   L +        +  L+     +          NE V  +   
Sbjct: 148 TSLEQHIMDGILGLILKDLEEVWRQIIP-NIRLKKELSENSPHIIQIVSQNEVVILVVCE 206

Query: 188 MTIENVASSFVLIIPQETLLKTT---LISLSSQNKSENQSEDLIDPFARKTYQLNVNIDT 244
           +    V     L IP   L         S       +    +  D          V    
Sbjct: 207 VKFGEVLGMMNLCIPAIVLEPVLGKISSSDWLIGAKKGLQGEKEDEIMHMLNDTEVPTSI 266

Query: 245 RINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI 304
            +   K T++DV+ L+ G ++ F  ++     +  N K+ +  E+G +G    ++IT  I
Sbjct: 267 YLGHNKLTIEDVLGLQNGDLVMFNVKQDRPVEIHFNNKQKFLGEVGTLGVKKAVKITQFI 326

Query: 305 NFDQK 309
                
Sbjct: 327 TESDD 331


>gi|332702324|ref|ZP_08422412.1| flagellar motor switch protein FliM [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332552473|gb|EGJ49517.1| flagellar motor switch protein FliM [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 325

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 42/299 (14%), Positives = 93/299 (31%), Gaps = 10/299 (3%)

Query: 5   SIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTS 64
                          R+            +   +   + +         M   VD++  S
Sbjct: 30  QEDDGAVTFDLSNQDRIIRG------RMPVMEIINDRFARLATNALANAMRKRVDVNPIS 83

Query: 65  CQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYN 124
               KF   + S       +   +     N      + LV  L+EN  G S     ++  
Sbjct: 84  IDMSKFGDFMRSLPVPTSINIFKMEPLRGNALCVVDSRLVFALVENFFGGSGTQP-KVEG 142

Query: 125 RSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTI 184
           R  + +E+ +  + +      + +  +   E   ++E        +       +E V  +
Sbjct: 143 RDFTHIEQAIIGKVVDLALTNMEEAWAPVHEV--HIELIRAEINPQFAAIVPPSEVVVVV 200

Query: 185 NMNMTIENVASSFVLIIPQETLLKTTLIS-LSSQNKSENQSEDLIDPFARKTYQLNVNID 243
              + +EN   SF++ +P  T+         S Q++        I  F  +  +  V + 
Sbjct: 201 TYEVELENAIGSFIVCLPYATIEPIRAKLYASFQSERLEVDHAWISRFKERLMETPVEMV 260

Query: 244 TRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITD 302
            R+     T + ++ + IG ++          +   +G   +    GRV  N   ++  
Sbjct: 261 VRMGKTSITGRQLLNMDIGDILLLDTDVDDLLVAEVDGVRKFHGIPGRVKGNRAFQVLK 319


>gi|224373367|ref|YP_002607739.1| flagellar motor switch protein FliM [Nautilia profundicola AmH]
 gi|223588573|gb|ACM92309.1| flagellar motor switch protein FliM [Nautilia profundicola AmH]
          Length = 356

 Score =  214 bits (545), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 44/292 (15%), Positives = 97/292 (33%), Gaps = 6/292 (2%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +   ++     + L       M   V+I   S     +   + S      F+  S
Sbjct: 51  SKEQLRSIRAIHDKMARSLASDISSLMRSIVEIQLHSVDQMTYGEFLMSLPSPTSFNVFS 110

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
           L        I  + ++V  +++ LLG S         R  + +E  L  + +  ++  + 
Sbjct: 111 LKPLDGKGVIELNPSIVFPMIDRLLGGSGAPFETT--REFTDIELNLLDQILKVVTQNMK 168

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           +  S   +  P +E       +        NE V  + M + I   +    +  P  T+ 
Sbjct: 169 EVWSPIMDLYPIIEAKESSPNV--VQIVAQNEIVIMVIMEIIIGQTSGMMNICYPVITIE 226

Query: 208 KTTLISLSS--QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVI 265
                  +        +  +              + ++  +   +  +K V+ L++G +I
Sbjct: 227 SLLPRLANRDLMLNETSGRKSRNKELRALLRGAKIELEAVLGYAELNMKQVLDLEVGDII 286

Query: 266 PFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLHK 317
                     I+  +G+E +  E G      +I+I + +  +   +K  L K
Sbjct: 287 KLNRPADDTVIVKVDGREKFIAEFGVRRYRRSIKIKEILKTEHDEIKEILQK 338


>gi|207092363|ref|ZP_03240150.1| flagellar motor switch protein FliM [Helicobacter pylori
           HPKX_438_AG0C1]
 gi|317012255|gb|ADU82863.1| flagellar motor switch protein FliM [Helicobacter pylori
           Lithuania75]
          Length = 354

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 49/312 (15%), Positives = 102/312 (32%), Gaps = 6/312 (1%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
           K+  P   + L          K   +   S+     + L       M   V+I   S   
Sbjct: 29  KDIIPQRSVTLYDFKRPNRVSKEQLRSFRSIHDKMARNLSSQISSIMRSIVEIQLHSVDQ 88

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSL 127
             +   + S      F+  S+        +  + ++   +++ LLG       Q  NR  
Sbjct: 89  MTYGEFLMSLPSPTSFNVFSMKPMGGTGVLEINPSIAFPMIDRLLGGKGSAYDQ--NREF 146

Query: 128 STVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMN 187
           S +E  L    + Q+  +L +  S   E  P ++       +        NE    + + 
Sbjct: 147 SDIELNLLDTILRQVMQILKEVWSPVVEMFPTIDAKESSANV--VQIVAQNEISIMVVLE 204

Query: 188 MTIENVASSFVLIIPQETLLKTTLISLSS--QNKSENQSEDLIDPFARKTYQLNVNIDTR 245
           + I +      +  P  ++        S        N  +            ++V++   
Sbjct: 205 IIIGHSRGMMNICYPVISIESILSKMGSRDLMLSETNSKKSRNKELQALLSGVSVDMIVF 264

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           +   + +LK+++ L +G  I           +  + K+ Y   +G  G   TI+I + I 
Sbjct: 265 LGAVELSLKEMLDLDVGDTIRLNKIANDEVSVYVHKKKRYLASVGFQGYRKTIQIKEVIY 324

Query: 306 FDQKSLKNFLHK 317
            +++  K  L  
Sbjct: 325 SEKERTKEILEM 336


>gi|148266212|ref|YP_001232918.1| flagellar motor switch protein FliM [Geobacter uraniireducens Rf4]
 gi|146399712|gb|ABQ28345.1| flagellar motor switch protein FliM [Geobacter uraniireducens Rf4]
          Length = 328

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 37/268 (13%), Positives = 92/268 (34%), Gaps = 3/268 (1%)

Query: 38  LGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFI 97
           +   + ++       ++   VDI     ++ KF   +         +   +        +
Sbjct: 56  IYDGFIRYNRVTMSNRLGKMVDIKKDGARTYKFDDFLQILPSPVCMAIYKIEPLKGAALV 115

Query: 98  GCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESS 157
              N LV T+++++LG +        NR  + +E +L ++ +      + +  +      
Sbjct: 116 AMDNTLVFTIVDSILGGTGAPSIPSNNRLFTPIELRLMEKIVKDALVDMEKAWAPLLAVK 175

Query: 158 PNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQ 217
            NL         +      S   V T+++ + IE    + +L +P  T+        S  
Sbjct: 176 MNL--LRMEMNPRLVNIVPSEYQVVTMSLKIQIEETVGTMILAVPYMTIEPVRDKLKSGM 233

Query: 218 N-KSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAI 276
                          + +  +  + I   +     TL +++ L  G  I   +R ++  +
Sbjct: 234 QVDMMAVDPQWSYRLSEELAEAPLEISVEMGNSVITLDELLNLAPGDTIMLNNRGRSELL 293

Query: 277 LSANGKEIYSCELGRVGKNYTIRITDRI 304
           +   G   ++   G    N  ++I+  +
Sbjct: 294 VKVGGVNKFTGIPGVRDGNKAVKISRIL 321


>gi|217031646|ref|ZP_03437151.1| hypothetical protein HPB128_21g204 [Helicobacter pylori B128]
 gi|298736644|ref|YP_003729170.1| flagellar motor switch protein FliM [Helicobacter pylori B8]
 gi|216946846|gb|EEC25442.1| hypothetical protein HPB128_21g204 [Helicobacter pylori B128]
 gi|298355834|emb|CBI66706.1| flagellar motor switch protein FliM [Helicobacter pylori B8]
          Length = 354

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 49/312 (15%), Positives = 102/312 (32%), Gaps = 6/312 (1%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
           K+  P   + L          K   +   S+     + L       M   V+I   S   
Sbjct: 29  KDIIPQRSVTLYDFKRPNRVSKEQLRSFRSIHDKMARNLSSQVSSIMRSIVEIQLHSVDQ 88

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSL 127
             +   + S      F+  S+        +  + ++   +++ LLG       Q  NR  
Sbjct: 89  MTYGEFLMSLPSPTSFNVFSMKPMGGTGVLEINPSIAFPMIDRLLGGKGSAYDQ--NREF 146

Query: 128 STVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMN 187
           S +E  L    + Q+  +L +  S   E  P ++       +        NE    + + 
Sbjct: 147 SDIELNLLDTILRQVMQILKEVWSPVVEMYPTIDAKESSANV--VQIVAQNEISIMVVLE 204

Query: 188 MTIENVASSFVLIIPQETLLKTTLISLSS--QNKSENQSEDLIDPFARKTYQLNVNIDTR 245
           + I +      +  P  ++        S        N  +            ++V++   
Sbjct: 205 IIIGHSRGMMNICYPVISIESILSKMGSRDLMLSETNSKKSRNKELQALLSGVSVDMIVF 264

Query: 246 INLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRIN 305
           +   + +LK+++ L +G  I           +  + K+ Y   +G  G   TI+I + I 
Sbjct: 265 LGAVELSLKEMLDLDVGDTIRLNKIANDEVSVYVHKKKRYLASVGFQGYRKTIQIKEVIY 324

Query: 306 FDQKSLKNFLHK 317
            +++  K  L  
Sbjct: 325 SEKERTKEILEM 336


>gi|189426342|ref|YP_001953519.1| flagellar motor switch protein FliM [Geobacter lovleyi SZ]
 gi|189422601|gb|ACD96999.1| flagellar motor switch protein FliM [Geobacter lovleyi SZ]
          Length = 331

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 41/271 (15%), Positives = 97/271 (35%), Gaps = 4/271 (1%)

Query: 38  LGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFI 97
           +   + +F       ++   V+I     +S KF   + +       +   L        I
Sbjct: 56  VYDGFIRFNRITLSNRLRKVVEIKKVGARSYKFDDFLQTLPSPVCMAIFKLDPLKGAALI 115

Query: 98  GCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESS 157
              ++L   +++++LG +  T   L NR  +T+E +L +  +A + A L +  +    + 
Sbjct: 116 AMDSSLAFAIVDSVLGGTSRTALAL-NRLFTTLELRLVEMVLADVLADLEKSWAPLYPAK 174

Query: 158 PNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLIS-LSS 216
            +L         +  T       V T+ + + IE    + + ++P  T+           
Sbjct: 175 LSL--LRMEMNPRLVTIVPPEYQVVTMTVKVHIEENVGTMIFVVPIMTIEPIRDKLKEGM 232

Query: 217 QNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAI 276
           Q              + +     + +   +     +L++++ L++G  I       +  +
Sbjct: 233 QFDLMAIDPQWSYRLSSEILDAPMELSVELGNSTISLRELLDLEVGDTIMLDKPCTSELL 292

Query: 277 LSANGKEIYSCELGRVGKNYTIRITDRINFD 307
           +   G   Y    G    N  ++I+D I+  
Sbjct: 293 VKVEGVPKYQGIPGIRHGNKAMQISDIISTK 323


>gi|317013858|gb|ADU81294.1| flagellar motor switch protein FliM [Helicobacter pylori
           Gambia94/24]
          Length = 354

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 48/312 (15%), Positives = 102/312 (32%), Gaps = 6/312 (1%)

Query: 8   KNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQS 67
           K+  P   + L          K   +   S+     + L       M   V+I   S   
Sbjct: 29  KDIIPQRSVTLYDFKRPNRVSKEQLRSFRSIHDKMARNLSSQVSSIMRSIVEIQLHSVDQ 88

Query: 68  GKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSL 127
             +   + S      F+  S+        +  + ++   +++ LLG       Q  NR  
Sbjct: 89  MTYGEFLMSLPSPTSFNVFSMKPMGGTGVLEINPSIAFPMIDRLLGGKGSAYDQ--NREF 146

Q