Score = 53.8 bits (130), Expect = 2e-08 Identities = 16/77 (20%), Positives = 35/77 (45%), Gaps = 2/77 (2%) Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297 + + + + + TLK V+ + G +I + NGK I E+ + +N+ Sbjct: 10 IPLKVTVELGRTRMTLKRVLEMIHGSIIELDKLTGEPVDILVNGKLIARGEVVVIDENFG 69 Query: 298 IRITDRINFDQ--KSLK 312 +RIT+ ++ + + L Sbjct: 70 VRITEIVSPKERLELLN 86
class: All beta proteins
fold: Surface presentation of antigens (SPOA)
superfamily: Surface presentation of antigens (SPOA)
family: Surface presentation of antigens (SPOA)
domain: Putative flagelar motor switch protein FliN
species: Thermotoga maritima [TaxId: 2336]