RPS-BLAST 2.2.22 [Sep-27-2009]

Database: scop70_1_75 
           13,730 sequences; 2,407,596 total letters

Searching..................................................done

Query= gi|254780687|ref|YP_003065100.1| flagellar C-ring protein
[Candidatus Liberibacter asiaticus str. psy62]
         (318 letters)



>d1o6aa_ b.139.1.1 (A:) Putative flagelar motor switch protein FliN
           {Thermotoga maritima [TaxId: 2336]}
          Length = 87

 Score = 53.8 bits (130), Expect = 2e-08
 Identities = 16/77 (20%), Positives = 35/77 (45%), Gaps = 2/77 (2%)

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
           + + +   +   + TLK V+ +  G +I           +  NGK I   E+  + +N+ 
Sbjct: 10  IPLKVTVELGRTRMTLKRVLEMIHGSIIELDKLTGEPVDILVNGKLIARGEVVVIDENFG 69

Query: 298 IRITDRINFDQ--KSLK 312
           +RIT+ ++  +  + L 
Sbjct: 70  VRITEIVSPKERLELLN 86


>d1o9ya_ b.139.1.1 (A:) Structural protein HrcQ2, C-terminal domain
           {Pseudomonas syringae [TaxId: 317]}
          Length = 71

 Score = 46.2 bits (110), Expect = 4e-06
 Identities = 13/68 (19%), Positives = 26/68 (38%)

Query: 237 QLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNY 296
            L +++  R    + TL ++  L  G ++         A L    + +   EL  V    
Sbjct: 4   SLALDLTLRCGELRLTLAELRRLDAGTILEVTGISPGHATLCHGEQVVAEGELVDVEGRL 63

Query: 297 TIRITDRI 304
            ++IT  +
Sbjct: 64  GLQITRLV 71


>d1k9oi_ e.1.1.1 (I:) Alaserpin (serpin 1) {Tobacco hornworm
           (Manduca sexta) [TaxId: 7130]}
          Length = 376

 Score = 28.3 bits (62), Expect = 0.88
 Identities = 14/120 (11%), Positives = 34/120 (28%), Gaps = 6/120 (5%)

Query: 70  FSHIIHSFK-ENFVFSQASLSSWSSNFFIGCSNNLVITL--LENLLGASHETIPQLYNRS 126
           FS ++ +   +N V S  S+        +        +   L   L   ++ + +     
Sbjct: 21  FSEVVKANPGQNVVLSAFSVLPPLGQLALASVGE---SHDELLRALALPNDNVTKDVFAD 77

Query: 127 LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
           L+   + +    +   S +         +    +        ++      S E    IN 
Sbjct: 78  LNRGVRAVKGVDLKMASKIYVAKGLELNDDFAAVSRDVFGSEVQNVDFVKSVEAAGAINK 137


>g1lq8.1 e.1.1.1 (A:,B:) Protein C inhibitor {Human (Homo sapiens)
           [TaxId: 9606]}
          Length = 358

 Score = 27.1 bits (59), Expect = 1.9
 Identities = 17/114 (14%), Positives = 44/114 (38%), Gaps = 4/114 (3%)

Query: 79  ENFVFSQASLSSWSSNFFIGCSNN----LVITLLENLLGASHETIPQLYNRSLSTVEKKL 134
           +N  FS  S+S   +   +G  ++    ++  L  NL  +S + + + + + L  + +  
Sbjct: 19  QNIFFSPVSISMSLAMLSLGAGSSTKMQILEGLGLNLQKSSEKELHRGFQQLLQELNQPR 78

Query: 135 AKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNM 188
               ++  +A+    +   Q++  +      +        R S   +  IN  +
Sbjct: 79  DGFQLSLGNALFTDLVVDLQDTFVSAMKTLYLADTFPTNFRDSAGAMKQINDYV 132


>g1m93.1 e.1.1.1 (A:,B:,C:) Viral serpin crmA (cytokine response
           modifier protein) {Cowpox virus [TaxId: 10243]}
          Length = 322

 Score = 26.7 bits (58), Expect = 2.8
 Identities = 27/117 (23%), Positives = 37/117 (31%), Gaps = 18/117 (15%)

Query: 70  FSHIIHSFK-ENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLS 128
           F  I  S K EN   S  S+SS             V+T+L    GA+  T  QL      
Sbjct: 4   FREIASSMKGENVFISPPSISS-------------VLTIL--YYGANGSTAEQL--SKYV 46

Query: 129 TVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTIN 185
            +  K   +   + SAV           +    DF D   +      +       IN
Sbjct: 47  DISFKSMNKVYGRYSAVFKDSFLRKIGDNFQTVDFTDSRTVDAINKSVDIFTEGKIN 103


>d1by7a_ e.1.1.1 (A:) Plasminogen activator inhibitor-2 {Human (Homo
           sapiens) [TaxId: 9606]}
          Length = 381

 Score = 26.4 bits (57), Expect = 3.6
 Identities = 27/179 (15%), Positives = 61/179 (34%), Gaps = 18/179 (10%)

Query: 79  ENFVFSQASLSSWSSNFFIGCSNN----LVITLLENLLGASHETIPQLYNRSLSTVEKKL 134
           +N   S  S+SS  +  ++G   +    +   L  N +GA+ + I   +    S +    
Sbjct: 25  QNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNEVGAAADKIHSSFRSLSSAINAST 84

Query: 135 AKRTIAQISAV-LNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTIN------MN 187
               +  ++ +   +  S  +E     + +Y  +    +    + E    IN        
Sbjct: 85  GNYLLESVNKLFGEKSASFREEYIRLCQKYYSSEPQAVDFLECAEEARKKINSWVKTQTK 144

Query: 188 MTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRI 246
             I N       ++P+ ++   T + L +    + + +   +      Y   VN   R 
Sbjct: 145 GKIPN-------LLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRT 196


>d1k28d1 b.106.1.1 (D:4-200) Baseplate structural protein gp27
           {Bacteriophage T4 [TaxId: 10665]}
          Length = 197

 Score = 25.6 bits (56), Expect = 6.0
 Identities = 14/66 (21%), Positives = 28/66 (42%), Gaps = 2/66 (3%)

Query: 89  SSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQ 148
            +WS+N F+  +  +    + + L   +E + Q Y+     +  K+    I QIS     
Sbjct: 18  DAWSNNRFVELAATITTLTMRDSLYGRNEGMLQFYDSKN--IHTKMDGNEIIQISVANAN 75

Query: 149 CISTTQ 154
            I+  +
Sbjct: 76  DINNVK 81


>g1mtp.1 e.1.1.1 (A:,B:) Thermopin {Thermobifida fusca [TaxId:
           2021]}
          Length = 355

 Score = 25.6 bits (55), Expect = 6.3
 Identities = 18/110 (16%), Positives = 34/110 (30%), Gaps = 10/110 (9%)

Query: 79  ENFVFSQASLSSWSSNFFIGCSNNLVITL--LENLLGASHETIPQLYNRSLSTVEKKLAK 136
              ++S  S++        G       T   L  LLG     +    +R+++     LA 
Sbjct: 26  GEVIWSPYSVACALGVLAAGARAT---TRTELTTLLGTDPAPLLAALDRAVTD-SPDLAS 81

Query: 137 RTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
           RT+  +    +  +         + D  D D    +          T+N 
Sbjct: 82  RTVLWV----SADVPVRSSFRATMHDRPDSDVRTADFRTNPEGVRATVNA 127


>d2b3ya1 c.8.2.1 (A:631-889) ron-responsive element binding
          protein 1, C-terminal domain {Human (Homo sapiens)
          [TaxId: 9606]}
          Length = 259

 Score = 25.5 bits (55), Expect = 6.6
 Identities = 9/30 (30%), Positives = 14/30 (46%)

Query: 8  KNTSPLHPILLARLTGKLGDKKTIEKISSS 37
           +  P   I+ A +   LGD  T + IS +
Sbjct: 24 LDLQPPKSIVDAYVLLNLGDSVTTDHISPA 53


>d1tv8a_ c.1.28.3 (A:) Molybdenum cofactor biosynthesis protein A
           MoaA {Staphylococcus aureus [TaxId: 1280]}
          Length = 327

 Score = 25.1 bits (53), Expect = 7.1
 Identities = 6/25 (24%), Positives = 11/25 (44%)

Query: 225 EDLIDPFARKTYQLNVNIDTRINLK 249
           E + D   R    L +++  R N +
Sbjct: 1   EQIKDKLGRPIRDLRLSVTDRCNFR 25


>d1xqga_ e.1.1.1 (A:) Maspin {Human (Homo sapiens) [TaxId: 9606]}
          Length = 378

 Score = 24.8 bits (53), Expect = 9.0
 Identities = 18/109 (16%), Positives = 43/109 (39%), Gaps = 1/109 (0%)

Query: 79  ENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRT 138
            N +FS  +LS+  S   +G   +    + + L   + + +P  +    S V K  +  +
Sbjct: 29  GNVLFSPIALSTSLSLAQVGAKGDTANEIGQVLHFENVKDVPFGFQTVTSDVNKLSSFYS 88

Query: 139 IAQISAV-LNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINM 186
           +  I  + +++ ++ + E   + +  Y  +    +      E    IN 
Sbjct: 89  LKLIKRLYVDKSLNLSTEFISSTKRPYAKELETVDFKDKLEETKGQINN 137


  Database: scop70_1_75
    Posted date:  Mar 27, 2010  6:21 PM
  Number of letters in database: 2,407,596
  Number of sequences in database:  13,730
  
Lambda     K      H
   0.317    0.132    0.365 

Gapped
Lambda     K      H
   0.267   0.0480    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13730
Number of Hits to DB: 1,091,763
Number of extensions: 48628
Number of successful extensions: 133
Number of sequences better than 10.0: 1
Number of HSP's gapped: 133
Number of HSP's successfully gapped: 21
Length of query: 318
Length of database: 2,407,596
Length adjustment: 85
Effective length of query: 233
Effective length of database: 1,240,546
Effective search space: 289047218
Effective search space used: 289047218
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (24.8 bits)