BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780687|ref|YP_003065100.1| flagellar C-ring protein
[Candidatus Liberibacter asiaticus str. psy62]
         (318 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780687|ref|YP_003065100.1| flagellar C-ring protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 318

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/318 (100%), Positives = 318/318 (100%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI
Sbjct: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP
Sbjct: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF
Sbjct: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNV 240
           VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNV
Sbjct: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNV 240

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
           NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI
Sbjct: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300

Query: 301 TDRINFDQKSLKNFLHKR 318
           TDRINFDQKSLKNFLHKR
Sbjct: 301 TDRINFDQKSLKNFLHKR 318


>gi|254780751|ref|YP_003065164.1| ribonuclease E [Candidatus Liberibacter asiaticus str. psy62]
          Length = 723

 Score = 26.6 bits (57), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 75  HSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNR 125
           HS +E  V   A+ S  +    I  +NN V++ +E++ G S E +P+ + R
Sbjct: 118 HSLEE--VAPIANFSQETEEESIISANNDVVSNVEDVKGGSPEDVPKKFKR 166


>gi|254781179|ref|YP_003065592.1| D-alanine--D-alanine ligase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 300

 Score = 24.6 bits (52), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 8/21 (38%), Positives = 15/21 (71%)

Query: 222 NQSEDLIDPFARKTYQLNVNI 242
           ++S+ L DP +RK + L +N+
Sbjct: 244 SRSDFLFDPLSRKVFWLEINV 264


>gi|254780823|ref|YP_003065236.1| double-strand break repair protein AddB [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 1040

 Score = 24.3 bits (51), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 9/60 (15%)

Query: 12 PLHPILLARLTGKLGDKKTIEKISSSLGYLYKK---FLP------KIFKEKMDLDVDISY 62
          PL+P+LLA +T  +  K+ I+++ S    +  K    LP       + +EK   D+ +SY
Sbjct: 38 PLNPLLLASVTIYVPTKRAIQELRSEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSY 97


>gi|254780755|ref|YP_003065168.1| octaprenyl-diphosphate synthase protein [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 322

 Score = 23.5 bits (49), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/67 (23%), Positives = 35/67 (52%), Gaps = 1/67 (1%)

Query: 170 KKNTNRLSNEFVTTIN-MNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLI 228
           ++ T R  N + +TIN   +++EN+  +F+++     L+ T   + S   K+++    L 
Sbjct: 243 QRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLP 302

Query: 229 DPFARKT 235
           D   +K+
Sbjct: 303 DSSWKKS 309


>537021.9.peg.753_1 
          Length = 1033

 Score = 23.1 bits (48), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 16/33 (48%)

Query: 3   GQSIHKNTSPLHPILLARLTGKLGDKKTIEKIS 35
            Q + KN +  H  + A   G   DK T+EK S
Sbjct: 912 AQWVEKNRTNKHENIFAHEKGTFSDKITLEKFS 944


>gi|254780221|ref|YP_003064634.1| hypothetical protein CLIBASIA_00530 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 97

 Score = 22.7 bits (47), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 17/29 (58%)

Query: 226 DLIDPFARKTYQLNVNIDTRINLKKTTLK 254
           D +DP  R+      +++ RIN K TTL+
Sbjct: 68  DALDPILRRMDGPVKHVERRINSKTTTLE 96


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.317    0.132    0.365 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 200,267
Number of Sequences: 1233
Number of extensions: 8220
Number of successful extensions: 27
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 16
Number of HSP's gapped (non-prelim): 11
length of query: 318
length of database: 328,796
effective HSP length: 74
effective length of query: 244
effective length of database: 237,554
effective search space: 57963176
effective search space used: 57963176
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 38 (19.2 bits)