Score = 62.0 bits (151), Expect = 2e-11 Identities = 10/73 (13%), Positives = 32/73 (43%), Gaps = 3/73 (4%) Query: 72 IMNIPVKMQIILGSCCMQISNLVNLSKGDVITLDKRVGESVDITINNQKIAKGEITIMEE 131 + ++ + + + G + ++ L L G ++ + + Q +A+GE+ +E Sbjct: 2 LDSLALDLTLRCGELRLTLAELRRLDAGTILEVTGISPGHATLCHGEQVVAEGELVDVEG 61 Query: 132 DDTHFGVRVIEIL 144 G+++ ++ Sbjct: 62 ---RLGLQITRLV 71
class: All beta proteins
fold: Surface presentation of antigens (SPOA)
superfamily: Surface presentation of antigens (SPOA)
family: Surface presentation of antigens (SPOA)
domain: Structural protein HrcQ2, C-terminal domain
species: Pseudomonas syringae [TaxId: 317]