BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780688|ref|YP_003065101.1| putative flagellar motor switch protein [Candidatus Liberibacter asiaticus str. psy62] (147 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780688|ref|YP_003065101.1| putative flagellar motor switch protein [Candidatus Liberibacter asiaticus str. psy62] Length = 147 Score = 290 bits (742), Expect = 7e-81, Method: Compositional matrix adjust. Identities = 147/147 (100%), Positives = 147/147 (100%) Query: 1 MIKKVSKISYIKDNLEGRSMHIDNPLQDTNVSSPTNNSEMLIQKNDVDNISEPISSDSNN 60 MIKKVSKISYIKDNLEGRSMHIDNPLQDTNVSSPTNNSEMLIQKNDVDNISEPISSDSNN Sbjct: 1 MIKKVSKISYIKDNLEGRSMHIDNPLQDTNVSSPTNNSEMLIQKNDVDNISEPISSDSNN 60 Query: 61 ILEKSTDNFDLIMNIPVKMQIILGSCCMQISNLVNLSKGDVITLDKRVGESVDITINNQK 120 ILEKSTDNFDLIMNIPVKMQIILGSCCMQISNLVNLSKGDVITLDKRVGESVDITINNQK Sbjct: 61 ILEKSTDNFDLIMNIPVKMQIILGSCCMQISNLVNLSKGDVITLDKRVGESVDITINNQK 120 Query: 121 IAKGEITIMEEDDTHFGVRVIEILNAQ 147 IAKGEITIMEEDDTHFGVRVIEILNAQ Sbjct: 121 IAKGEITIMEEDDTHFGVRVIEILNAQ 147 >gi|254780545|ref|YP_003064958.1| metalloprotease [Candidatus Liberibacter asiaticus str. psy62] Length = 647 Score = 23.1 bits (48), Expect = 2.3, Method: Composition-based stats. Identities = 20/78 (25%), Positives = 38/78 (48%), Gaps = 5/78 (6%) Query: 4 KVSKISYIKDNLEGRSMHIDNPLQDTNVSSPTNNSEML--IQKNDVDNISEPISSDSNNI 61 +V KIS I ++ G ++ ++ Q P S++L +Q D++ S P++ S + Sbjct: 39 RVRKISVIGTHITGFYVNGESSFQ---TYMPLVGSKLLDKLQSKDIEISSRPVNDGSPGL 95 Query: 62 LEKSTDNFDLIMNIPVKM 79 L F L++ + V M Sbjct: 96 LSYLGSWFPLVLVVLVWM 113 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.313 0.131 0.351 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 96,521 Number of Sequences: 1233 Number of extensions: 3983 Number of successful extensions: 6 Number of sequences better than 100.0: 4 Number of HSP's better than 100.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 4 length of query: 147 length of database: 328,796 effective HSP length: 66 effective length of query: 81 effective length of database: 247,418 effective search space: 20040858 effective search space used: 20040858 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 34 (17.7 bits)