>TIGR00207 fliG flagellar motor switch protein FliG; InterPro: IPR000090 The flagellar motor switch in Escherichia coli and Salmonella typhimurium regulates the direction of flagellar rotation and hence controls swimming behaviour . The switch is a complex apparatus that responds to signals transduced by the chemotaxis sensory signalling system during chemotactic behaviour . CheY, the chemotaxis response regulator, is believed to act directly on the switch to induce tumbles in the swimming pattern, but no physical interactions of CheY and switch proteins have yet been demonstrated. The switch complex comprises at least three proteins - FliG, FliM and FliN. It has been shown that FliG interacts with FliM, FliM interacts with itself, and FliM interacts with FliN . Several residues within the middle third of FliG appear to be strongly involved in the FliG-FliM interaction, with residues near the N- or C-termini being less important . Such clustering suggests that FliG-FliM interaction plays a central role in switching. Analysis of the FliG, FliM and FliN sequences shows that none are especially hydrophobic or appear to be integral membrane proteins . This result is consistent with other evidence suggesting that the proteins may be peripheral to the membrane, possibly mounted on the basal body M ring , . FliG is present in about 25 copies per flagellum. This structure of the C-terminal domain is known, this domain functions specifically in motor rotation .; GO: 0003774 motor activity, 0001539 ciliary or flagellar motility, 0006935 chemotaxis, 0009288 flagellin-based flagellum.

Probab=98.05 E-value=0.0014 Score=43.44 Aligned_cols=162 Identities=10% Similarity=0.148 Sum_probs=87.0 Q ss_pred HHHHHHHHHHHHCCHHHHHHHHHCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHH---CCC-CCCCHHHHHHHHH Q ss_conf 687999999983814689998519999999999998613899989999999999999851---045-6653488999976 Q gi|254780689|r 24 QKDKATAILLAMEKQVSGKLLRHFTHAELKEIVASAKLLPEISPEELEDIIDEFESQFIA---GIG-LTENSKNIESILE 99 (345) Q Consensus 24 g~eKAAilLl~LGee~Aa~ilk~l~~~Ei~~i~~~m~~l~~i~~~~~~~vl~EF~~~~~~---~~~-~~g~~~~~~~lL~ 99 (345) T Consensus 138 HPQtiAlIL~hL~~~~Aa~iLs~l~~e~~~~v~~RiA~~g~~sP~vv~ev~~VLe~kL~s~~~~~~~~~GGv~~vaEi~N 217 (346) T TIGR00207 138 HPQTIALILSHLDPAQAAEILSLLPEEVQAEVARRIAVMGRTSPEVVKEVERVLEKKLESLTSEDYTKVGGVRAVAEIIN 217 (346) T ss_pred CHHHHHHHHHHHCHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHCCCHHHHHHHHC T ss_conf 86799999985183047888730685689999999985078678999999999977622442123554162578999873 Q ss_pred HCCCHHHHHHHHHHHHCCCCC-------CCCHHHHHHCCCHHHHHHHHHCCCHHHHHHHHHHCCHHHHHHHHHHCCHHHH Q ss_conf 114979999997544113445-------6756789741998999999840386478899995788899999983798999 Q gi|254780689|r 100 EGLEQNELEKLLNKSDISQEN-------NNSIWDHLKETDPGVIADFLSKEHPQTTAYVLSMMPPSIGASVLLRFPNKIH 172 (345) Q Consensus 100 ~al~~d~a~~ll~~~~~~~~~-------~~~~~~~L~~~~~~~La~~L~~EhPQtiAlILs~L~~~~Aa~VL~~Lp~e~r 172 (345) T Consensus 218 ~~-~~~~ek~~l~~~e~~D~~LA~~Ik~~MF~FEdiV~lDdraIqr~L~~vd~~~L~~ALK~~~~~l~ek~l~NMS~Raa 296 (346) T TIGR00207 218 LL-DRKTEKTILESLEEVDPELAEEIKKKMFVFEDIVKLDDRAIQRVLREVDKEDLLLALKTAEKPLREKFLNNMSQRAA 296 (346) T ss_pred CC-CCCHHHHHHHHHHHHCHHHHHHHHHHCCCHHHHHHHCCHHHHHHHHHHCCHHHHHHHHCCCHHHHHHHHHHHHHHHH T ss_conf 57-87159999999983184789999972364011543030899999998433556778512662478898631548999 Q ss_pred HHHHHHHHHCCCCC Q ss_conf 99999984048999 Q gi|254780689|r 173 ADIMKRTVNLPKIS 186 (345) Q Consensus 173 ~ev~~Ria~l~~v~ 186 (345) T Consensus 297 ~~l~edm~flGpvr 310 (346) T TIGR00207 297 EILKEDMEFLGPVR 310 (346) T ss_pred HHHHHHHHHCCCCC T ss_conf 99999887268844

HHsearch alignment for GI: 254780689 and conserved domain: TIGR00207