HHsearch alignment for GI: 254780690 and conserved domain: COG1377

>COG1377 FlhB Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion].
Probab=100.00  E-value=0  Score=856.28  Aligned_cols=350  Identities=37%  Similarity=0.579  Sum_probs=335.6

Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHH
Q ss_conf             87678776866587879999985787513359999999999999999999999999999999972000121049798999
Q gi|254780690|r    3 ENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLASATQRKLEDISHIVF   82 (354)
Q Consensus         3 e~d~~~eKTE~PT~kRL~dARekGqV~kS~el~~~~~ll~~~~~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~   82 (354)
T Consensus         2 ~~~~~~eKTE~pT~kKl~dArekG~v~kS~el~~a~~ll~g~~~l~~~~~~~~~~l~~~l~~~~~~~~~~~~-~~~~~~~   80 (363)
T COG1377           2 DDMADDEKTEKPTPKKLRDAREKGQVPKSRELTSAASLLVGFLLLFFFGSYFARRLSGFLRAFLEFPESMDL-DDESALE   80 (363)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC-CCHHHHH
T ss_conf             654344567789856699999747886306689999999999999999999999999999999826242123-7225999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCCCCHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999988776878532101371213779101693430332012667999999999999999999
Q gi|254780690|r   83 LLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTII  162 (354)
Q Consensus        83 ~~~~~~~~~~~~~~p~~~~~~l~~i~~~l~q~G~~fs~k~l~pk~~rlNPi~GlKriFS~k~lvel~KsllKv~li~~v~  162 (354)
T Consensus        81 ~~~~~~~~~~~~llp~~~~~~v~gi~~~~~q~g~~fs~e~ikP~~~kinP~~G~KRiFs~~~~vEllKsllKi~~v~~v~  160 (363)
T COG1377          81 LIKALLLEILKALLPFLLVLLVVGLLANILQVGFLFSTEALKPKFSKLNPIKGLKRIFSLQTLVELLKSLLKIVLVGLVA  160 (363)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999999999984763146346777211493677899845889999999999999999999


Q ss_pred             HHHHHHCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHCCCCHHH
Q ss_conf             99998321568978408979999999999999999999999999997667999999984069989999997544899899
Q gi|254780690|r  163 TISLTENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPII  242 (354)
Q Consensus       163 ~~~i~~~~~~l~~l~~~~~~~~l~~~~~~~~~l~~~~~~~~~via~iD~~~qr~~~~k~lkMskqEvK~E~K~~EGdP~i  242 (354)
T Consensus       161 ~~~l~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~l~~~~~~liia~~D~~~qr~~~~k~lkMtKqEVKdE~K~sEGdPeV  240 (363)
T COG1377         161 YFVLKNHLSELLSLAGQSPVAALSIFMELLGKLLLAVLLLLLIVAAFDYFYQRFQYIKKLKMTKQEVKDEYKQSEGDPEV  240 (363)
T ss_pred             HHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCHHH
T ss_conf             99999419999977048989999999999999999999999999999999999999996668689999998615698056


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCEEEEEEECCCCCCCCEEEEECCCHHHHHHHHHHHHCCCCEEECHHHHH
Q ss_conf             99999999999998898607768699873553078889768888888899807658999999999973997886889999
Q gi|254780690|r  243 KNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLAR  322 (354)
Q Consensus       243 K~~~r~~~re~~~~~~~~~V~~A~vvitNPTH~AVAL~Y~~~~~~aP~vvaKG~~~~A~~Ir~~A~~~~Vpive~~~LAR  322 (354)
T Consensus       241 Ksr~Rq~~re~a~~rm~~~Vp~AdvVItNPTH~AVAlkY~~~~~~AP~VvAKG~d~~AlkIreiA~e~~Ipi~enppLAR  320 (363)
T COG1377         241 KSRIRQMQREIARRRMMSDVPKADVVITNPTHYAVALKYDPEKMPAPVVVAKGVDLVALKIREIAKEHGIPIIENPPLAR  320 (363)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCEEEEEEECCCCCCCCEEEEECCCHHHHHHHHHHHHCCCCEECCHHHHH
T ss_conf             68999999999999998518998889727661134546655558999899817869999999999984995641807799


Q ss_pred             HHHHHCCCCCCCCHHHHHHHHHHHHHHHHHC
Q ss_conf             9997288989489899999999999997302
Q gi|254780690|r  323 SLFKQVPINSAIPPVFYKAVAQLIYKIYHKK  353 (354)
Q Consensus       323 ~Ly~~~~ig~~Ip~~~y~aVA~il~~v~~lk  353 (354)
T Consensus       321 aLY~~~~v~~~IP~e~y~aVaevL~~V~~~~  351 (363)
T COG1377         321 ALYRQVEVGQQIPEELYKAVAEVLAYVYQLK  351 (363)
T ss_pred             HHHHHCCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             9997257666489999999999999999865