HHsearch alignment for GI: 254780690 and conserved domain: COG1422

>COG1422 Predicted membrane protein [Function unknown].
Probab=91.09  E-value=1.5  Score=24.80  Aligned_cols=56  Identities=11%  Similarity=0.082  Sum_probs=33.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHC--CCCHHHHHHHHHHHHHHHHH
Q ss_conf             999999997667999999984069989999997544--89989999999999999998
Q gi|254780690|r  201 LFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQS--YGNPIIKNRQKSIARSRIRH  256 (354)
Q Consensus       201 ~~~~via~iD~~~qr~~~~k~lkMskqEvK~E~K~~--EGdP~iK~~~r~~~re~~~~  256 (354)
T Consensus        56 i~gl~~~i~~~~liD~ekm~~~qk~m~efq~e~~eA~~~~d~~~lkkLq~~qmem~~~  113 (201)
T COG1422          56 ITGLYITILQKLLIDQEKMKELQKMMKEFQKEFREAQESGDMKKLKKLQEKQMEMMDD  113 (201)
T ss_pred             HHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHH
T ss_conf             9999999999996029999999999999999999999808899999999999999999