HHsearch alignment for GI: 254780690 and conserved domain: TIGR01404

>TIGR01404 FlhB_rel_III type III secretion protein, YscU/HrpY family; InterPro: IPR006307 This is one of several families of proteins related to bacterial flagellar biosynthesis proteins and involved in bacterial type III protein secretion systems. This family is homologous to, but distinguished from, the flagellar biosynthetic protein FlhB (IPR006136 from INTERPRO). This model may not identify all type III secretion system FlhB homologs. ; GO: 0006810 transport, 0016021 integral to membrane.
Probab=100.00  E-value=0  Score=794.11  Aligned_cols=342  Identities=25%  Similarity=0.373  Sum_probs=321.3

Q ss_pred             CCCCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHH
Q ss_conf             77686658787999998578751335999999999999999999999999999999997200012104979899999999
Q gi|254780690|r    8 DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLASATQRKLEDISHIVFLLTHL   87 (354)
Q Consensus         8 ~eKTE~PT~kRL~dARekGqV~kS~el~~~~~ll~~~~~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   87 (354)
T Consensus         1 ~EKTEkPT~KKLrDarkKGQv~KS~Dl~~~~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~f~---~aL~~~~~~~   77 (346)
T TIGR01404         1 AEKTEKPTPKKLRDARKKGQVAKSKDLTSAVLLLAGFLYLLSLASVFLEHLIALLLLPLDFDDQPFA---YALKQVLSGF   77 (346)
T ss_pred             CCCCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHH---HHHHHHHHHH
T ss_conf             9999999701677667617853201799999999999999987678999999999878863044166---7799999999


Q ss_pred             -HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCCCCHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             -9999999999999999887768785321013712137791016934303320126679999999999999999999999
Q gi|254780690|r   88 -SLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISL  166 (354)
Q Consensus        88 -~~~~~~~~~p~~~~~~l~~i~~~l~q~G~~fs~k~l~pk~~rlNPi~GlKriFS~k~lvel~KsllKv~li~~v~~~~i  166 (354)
T Consensus        78 ~l~~~~~~~l~~~~~v~~~~~~~~~~Q~Gf~lA~ea~Kpd~~klNP~~glK~IFS~rs~~El~Ks~lK~~~~a~~~~~~~  157 (346)
T TIGR01404        78 LLQLILTVLLPLLAIVLLATVLSGLLQVGFVLATEALKPDLSKLNPISGLKRIFSLRSLIELLKSILKVVALALIFYLFL  157 (346)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999888733001101436681013835324677677649999999999999999999999


Q ss_pred             HHCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHCCCCHHHHHHH
Q ss_conf             83215689784089799999999999999999999999999976679999999840699899999975448998999999
Q gi|254780690|r  167 TENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ  246 (354)
Q Consensus       167 ~~~~~~l~~l~~~~~~~~l~~~~~~~~~l~~~~~~~~~via~iD~~~qr~~~~k~lkMskqEvK~E~K~~EGdP~iK~~~  246 (354)
T Consensus       158 ~~~~~~l~~~~~~~~~~~~~~~~~ll~~l~~~~l~~~l~~~~~D~~~q~~~~~KdlkMsK~EVKrEyKe~EGdPeiK~~R  237 (346)
T TIGR01404       158 KNYLEELFALPYCGLDGLAPIVGELLKLLILVILGFFLVVGLADFAFQRYLFMKDLKMSKDEVKREYKEQEGDPEIKSKR  237 (346)
T ss_pred             HHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHCCCCCCCHHHHH
T ss_conf             97499999851786678899999999999999999999999999999999998431899778864310278684134688


Q ss_pred             HHHHHHHHHHHHHHH---CCCCCEEEECCCCEEEEEEECCCCCCCCEEEEECCCHHHHHHHHHHHHCCCCEEECHHHHHH
Q ss_conf             999999999889860---77686998735530788897688888888998076589999999999739978868899999
Q gi|254780690|r  247 KSIARSRIRHKMMEA---TSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARS  323 (354)
Q Consensus       247 r~~~re~~~~~~~~~---V~~A~vvitNPTH~AVAL~Y~~~~~~aP~vvaKG~~~~A~~Ir~~A~~~~Vpive~~~LAR~  323 (354)
T Consensus       238 R~lhqEi~se~~~~~sKPv~~s~~vv~NPTHiAi~iyY~p~etPlP~i~~~g~d~~A~~~~~~A~~~giPvv~~~~LAR~  317 (346)
T TIGR01404       238 RELHQEILSEQLKSDSKPVKRSTLVVANPTHIAIGIYYKPGETPLPLIIAKGTDAQALAVIAYAEEAGIPVVRDIPLARQ  317 (346)
T ss_pred             HHHHHHHHCCCCCCCCCCHHHCEEEEECCCCEEEEECCCCCCCCCCEEEEECCCHHHHHHHHHHHHCCCCEECCCHHHHH
T ss_conf             99998864154002688610286765566010112102567789877887356489999999999758985227479999


Q ss_pred             HHHHCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             99728898948989999999999999730
Q gi|254780690|r  324 LFKQVPINSAIPPVFYKAVAQLIYKIYHK  352 (354)
Q Consensus       324 Ly~~~~ig~~Ip~~~y~aVA~il~~v~~l  352 (354)
T Consensus       318 Ly~~~~~~~~ip~~~~e~Va~~L~~l~~~  346 (346)
T TIGR01404       318 LYRTARVGQYIPEELLEAVAEVLRWLEQV  346 (346)
T ss_pred             HHHHCCCCCCCCHHHHHHHHHHHHHHHHC
T ss_conf             98405378888810078999999999609