HHsearch alignment of GI: 254780690 and MMDB domain: 2jlj_A_38-144

>2jlj_A (A:38-144) YSCU, YOP proteins translocation protein U; cell membrane, transmembrane, yersinia pesits, protein transport, type III secretion system, plasmid; 1.3A {Yersinia pestis} PDB: 2jlh_A* 2v5g_A 2w0r_A
Probab=99.97  E-value=2.7e-31  Score=267.73  Aligned_cols=98  Identities=26%  Similarity=0.430  Sum_probs=96.0

Q ss_pred             HHHHHHCCCCCEEEECCCCEEEEEEECCCCCCCCEEEEECCCHHHHHHHHHHHHCCCCEEECHHHHHHHHHHCCCCCCCC
Q ss_conf             88986077686998735530788897688888888998076589999999999739978868899999997288989489
Q gi|254780690|r  256 HKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIP  335 (354)
Q Consensus       256 ~~~~~~V~~A~vvitNPTH~AVAL~Y~~~~~~aP~vvaKG~~~~A~~Ir~~A~~~~Vpive~~~LAR~Ly~~~~ig~~Ip  335 (354)
                      ++|+++|++|||||+|||||||||+||+++++||+|+|||.|++|++||++|+++||||++|++|||+||+++++|++||
T Consensus         1 r~~~~~v~~a~~vi~NPTh~AVAL~Y~~~~~~aP~VvAkG~g~~A~~I~~~A~~~gIPi~~d~~LAr~Ly~~~~~g~~IP   80 (107)
T 2jlj_A            1 RNMRENVKRSSVVVAAATHIAIGILYKRGETPLPLVTFKYTDAQVQTVRKIAEEEGVPILQRIPLARALYWDALVDHYIP   80 (107)
T ss_dssp             CCHHHHHHTCSEEEEETTTEEEEEECCTTTCSSCEEEEEEETHHHHHHHHHHHHHTCCEEECHHHHHHHHHHCCTTSBCC
T ss_pred             HHHHHHCCCCEEEEECCCCEEEEEEECCCCCCCCEEECCCCCHHHHHHHHHHHHCCCCEEECHHHHHHHHHCCCCCCCCC
T ss_conf             57774057413899578716789887889998788204168299999999999859978848999999997488999369


Q ss_pred             HHHHHHHHHHHHHHHHHC
Q ss_conf             899999999999997302
Q gi|254780690|r  336 PVFYKAVAQLIYKIYHKK  353 (354)
Q Consensus       336 ~~~y~aVA~il~~v~~lk  353 (354)
                      +++|++||+||+|+|+++
T Consensus        81 ~ely~~VA~Il~~v~~~~   98 (107)
T 2jlj_A           81 AEQIEATAEVLRWLERQN   98 (107)
T ss_dssp             GGGHHHHHHHHHHHHHC-
T ss_pred             HHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999987