HHsearch results for GI: 254780690 and protein with PDBid: 2jli_A

>2jli_A YSCU, YOP proteins translocation protein; cell membrane, transmembrane, protein transport, type III secretion system, plasmid, membrane; 1.13A {Yersinia pestis}
Probab=100.00  E-value=5.4e-43  Score=359.22  Aligned_cols=122  Identities=30%  Similarity=0.483  Sum_probs=121.2

Q ss_pred             HHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCEEEEEEECCCCCCCCEEEEECCCHHHHHHHHHH
Q ss_conf             99999754489989999999999999998898607768699873553078889768888888899807658999999999
Q gi|254780690|r  228 EIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA  307 (354)
Q Consensus       228 EvK~E~K~~EGdP~iK~~~r~~~re~~~~~~~~~V~~A~vvitNPTH~AVAL~Y~~~~~~aP~vvaKG~~~~A~~Ir~~A  307 (354)
                      ||||||||+||||+||++||++|||+++++|+.+|++|||||||||||||||+||+++++||+|+|||.|.+|++|+++|
T Consensus         1 EvK~E~Ke~EGdP~iK~~rr~~~~e~~~~~~~~~v~~A~vvi~NPth~AVAL~Yd~~~~~aP~VvAkG~g~~A~~I~~~A   80 (123)
T 2jli_A            1 EIKREYKEMEGSPEIKSKRRQFHQEIQSRNMRENVKRSSVVVANPTHIAIGILYKRGETPLPLVTFKYTDAQVQTVRKIA   80 (123)
T ss_dssp             --------------------CHHHHHHHHHHHHHHHTCSEEEECCCSEEEEEECCTTTCSSCEEEEEEETHHHHHHHHHH
T ss_pred             CCHHHHHHCCCCHHHHHHHHHHHHHHHHCCHHCCCCCCEEEEECCCHHEEEEEECCCCCCCCEEEEECCCHHHHHHHHHH
T ss_conf             90256553659989999999999999864123057745189848723058878578999999997636819999999999


Q ss_pred             HHCCCCEEECHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             973997886889999999728898948989999999999999
Q gi|254780690|r  308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKI  349 (354)
Q Consensus       308 ~~~~Vpive~~~LAR~Ly~~~~ig~~Ip~~~y~aVA~il~~v  349 (354)
                      ++|||||++||+|||+||.++++|++||+++|++||+||+||
T Consensus        81 ~~~gIPi~~d~~LAr~Ly~~~~~g~~IP~ely~aVA~IL~~v  122 (123)
T 2jli_A           81 EEEGVPILQRIPLARALYWDALVDHYIPAEQIEATAEVLRWL  122 (123)
T ss_dssp             HHHTCCEEECHHHHHHHHHHCCTTSBCCGGGHHHHHHHHC--
T ss_pred             HHCCCCEEECHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             985998897899999999748898906999999999999841