HHsearch results for GI: 254780690 and protein with PDBid: 2jlj_A

>2jlj_A YSCU, YOP proteins translocation protein U; cell membrane, transmembrane, yersinia pesits, protein transport, type III secretion system, plasmid; 1.3A {Yersinia pestis} PDB: 2jlh_A* 2v5g_A 2w0r_A
Probab=100.00  E-value=0  Score=410.50  Aligned_cols=135  Identities=29%  Similarity=0.455  Sum_probs=133.3

Q ss_pred             HHHHCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCEEEEEEECCCCCCCCEEEEECCCH
Q ss_conf             98406998999999754489989999999999999998898607768699873553078889768888888899807658
Q gi|254780690|r  219 YSKLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL  298 (354)
Q Consensus       219 ~k~lkMskqEvK~E~K~~EGdP~iK~~~r~~~re~~~~~~~~~V~~A~vvitNPTH~AVAL~Y~~~~~~aP~vvaKG~~~  298 (354)
                      +|+||||||||||||||+||||+||++||++|||+++++++.+|++|||||||||||||||+||+++++||+|||||.|.
T Consensus         1 ik~lkMsk~EvK~E~K~~EGdP~iK~~rr~~~~e~~~~~~~~~v~~a~vvi~NPth~AVAL~Yd~~~~~aP~VvAkG~g~   80 (144)
T 2jlj_A            1 IKELKMSKDEIKREYKEMEGSPEIKSKRRQFHQEIQSRNMRENVKRSSVVVAAATHIAIGILYKRGETPLPLVTFKYTDA   80 (144)
T ss_dssp             -------------------CCHHHHHHHHHHHHHHCCCCHHHHHHTCSEEEEETTTEEEEEECCTTTCSSCEEEEEEETH
T ss_pred             CCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCEEEEEEECCCCCCCCEEECCCCCH
T ss_conf             94144888999999884539989999999999999985777405741389957871678988788999878820416829


Q ss_pred             HHHHHHHHHHHCCCCEEECHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHC
Q ss_conf             9999999999739978868899999997288989489899999999999997302
Q gi|254780690|r  299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK  353 (354)
Q Consensus       299 ~A~~Ir~~A~~~~Vpive~~~LAR~Ly~~~~ig~~Ip~~~y~aVA~il~~v~~lk  353 (354)
                      +|.+|+++|++|||||+|||+|||+||.++++|++||+++|++||+||+|||+++
T Consensus        81 ~A~~I~~~A~e~gIPi~e~~~LAr~Ly~~~~vg~~IP~ely~aVA~ILa~v~~l~  135 (144)
T 2jlj_A           81 QVQTVRKIAEEEGVPILQRIPLARALYWDALVDHYIPAEQIEATAEVLRWLERQN  135 (144)
T ss_dssp             HHHHHHHHHHHHTCCEEECHHHHHHHHHHCCTTSBCCGGGHHHHHHHHHHHHHC-
T ss_pred             HHHHHHHHHHHCCCCEEECHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999859978848999999997488999369999999999999999987