HHsearch results for GI: 254780690 and protein with PDBid: 3c01_E

>3c01_E Surface presentation of antigens protein SPAS; auto cleavage protein, flagella, ESCU, YSCU, intein, T3SS, membrane, inner membrane; 2.60A {Salmonella typhimurium} SCOP: d.367.1.1
Probab=99.93  E-value=4.1e-26  Score=225.55  Aligned_cols=82  Identities=22%  Similarity=0.259  Sum_probs=80.9

Q ss_pred             CCCEEEEEEECCCCCCCCEEEEECCCHHHHHHHHHHHHCCCCEEECHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             55307888976888888889980765899999999997399788688999999972889894898999999999999973
Q gi|254780690|r  272 PTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH  351 (354)
Q Consensus       272 PTH~AVAL~Y~~~~~~aP~vvaKG~~~~A~~Ir~~A~~~~Vpive~~~LAR~Ly~~~~ig~~Ip~~~y~aVA~il~~v~~  351 (354)
                      ||||||||+||+++++||+|+|||.|.+|++||++|+++||||++|++|||+||+++++|++||+++|++||+||+|+|+
T Consensus         1 PTH~AVAL~Y~~~~~~aP~VvAkG~g~~A~~I~~~A~~~gIPi~~~~~LAr~L~~~~~ig~~IP~ely~aVA~IL~~v~~   80 (98)
T 3c01_E            1 PTHITIGIYFKPELMPIPMISVYETNQRALAVRAYAEKVGVPVIVDIKLARSLFKTHRRYDLVSLEEIDEVLRLLVWLEE   80 (98)
T ss_dssp             CCCEEEEEECCTTTCSSCEEEEEEEHHHHHHHHHHHHHHTCCEEECHHHHHHHHHHCCTTCBCCHHHHHHHHHHHHHHHH
T ss_pred             CCEEEEEEEECCCCCCCCEEEEECCCHHHHHHHHHHHHCCCCEECCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             96699998846899989998775172999999999999599887099999999973889994899999999999999999


Q ss_pred             HC
Q ss_conf             02
Q gi|254780690|r  352 KK  353 (354)
Q Consensus       352 lk  353 (354)
                      ++
T Consensus        81 l~   82 (98)
T 3c01_E           81 VE   82 (98)
T ss_dssp             HH
T ss_pred             HH
T ss_conf             87