BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780690|ref|YP_003065103.1| flagellar biosynthesis protein
FlhB [Candidatus Liberibacter asiaticus str. psy62]
         (354 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780690|ref|YP_003065103.1| flagellar biosynthesis protein FlhB [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040367|gb|ACT57163.1| flagellar biosynthesis protein FlhB [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 354

 Score =  718 bits (1853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/354 (100%), Positives = 354/354 (100%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS
Sbjct: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL
Sbjct: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN
Sbjct: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP
Sbjct: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA
Sbjct: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKKI 354
           KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKKI
Sbjct: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKKI 354


>gi|315121857|ref|YP_004062346.1| flagellar biosynthesis protein FlhB [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495259|gb|ADR51858.1| flagellar biosynthesis protein FlhB [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 354

 Score =  525 bits (1353), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 261/352 (74%), Positives = 312/352 (88%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSEND P+NKTE+PSSKKIEDAL++GNAP+SRE  LFSS LACLIYLLFF SPGI+ +T 
Sbjct: 1   MSENDNPENKTESPSSKKIEDALSKGNAPVSREVYLFSSTLACLIYLLFFVSPGIHDLTY 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           D  + LAS TQ KL+ +SH+VFLL  L  S S+L+IPGLLLFM+FG+GSYLIQRIP  NL
Sbjct: 61  DFRMFLASVTQWKLDSVSHLVFLLVTLGFSTSKLLIPGLLLFMIFGVGSYLIQRIPSFNL 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           N+++PS KR+SLREGIKRIYS NNLVNF KS  KI++VGT+I ISL +N+ TML+ I++N
Sbjct: 121 NNIRPSLKRISLREGIKRIYSTNNLVNFTKSSFKIVIVGTLIAISLKDNHLTMLESITSN 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P  IL+H FFT+RK+LI+ILLFIA LT++DIGW+Y+QWYSKLKMSKQE+KDEIKQSYGNP
Sbjct: 181 PQIILHHIFFTIRKILIIILLFIAILTIIDIGWTYYQWYSKLKMSKQEVKDEIKQSYGNP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           +IK+RQKSIARSRIRHKM+EATSRAT++ITNPTHYALALRY+ TEND P+++AKGQNLIA
Sbjct: 241 MIKSRQKSIARSRIRHKMIEATSRATLVITNPTHYALALRYVPTENDVPIMIAKGQNLIA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
            K+RKIA E NIPIFE+P LARSLF+QVPINS+IPPVFYKA+AQLI+KIY K
Sbjct: 301 SKIRKIASEKNIPIFEDPLLARSLFRQVPINSSIPPVFYKAIAQLIHKIYSK 352


>gi|222147560|ref|YP_002548517.1| flagellar biosynthesis protein FlhB [Agrobacterium vitis S4]
 gi|221734548|gb|ACM35511.1| flagellar biosynthetic protein [Agrobacterium vitis S4]
          Length = 361

 Score =  340 bits (871), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 158/350 (45%), Positives = 239/350 (68%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++++  ++KTE+PS KK+ DA  +GN PISREA LF++ LA  IY +FF   G+ ++  
Sbjct: 1   MADDEDQESKTESPSEKKMRDAAEQGNLPISREAPLFATTLAFYIYFVFFMPQGVSTLYQ 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  L+    Q  +   + ++ L  HL  S + ++ P LLLFM+FG+     Q +P   L
Sbjct: 61  TLRDLMEKPDQWIIGTGTDVISLFVHLGWSMAAMLGPALLLFMLFGLTQSFAQHLPSFVL 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + + P  +R+SL  GI R++S+   V F KS  KII+V  I+ +S+   YF  LD + ++
Sbjct: 121 DRITPKMERLSLIGGIGRMFSVMGFVEFGKSLFKIIVVAIIMFVSMRGQYFGTLDAMLSD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P  I       V+++LI++L     LTV+D+GW  + WY KL+M++QE+KDE KQS G+P
Sbjct: 181 PQIIFVKLSDIVQEMLIIVLFATGLLTVMDLGWQRYNWYQKLRMTRQEVKDEHKQSQGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           ++K RQ+S  R + R +MM    RAT+IITNPTH+A+ALRY++TE +AP+++AKGQ+LIA
Sbjct: 241 VVKARQRSAQRDQARRRMMNNVPRATMIITNPTHFAVALRYVRTEMEAPIVLAKGQDLIA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
            K+R+IA E+NIPIFE+P LARS+F QV ++S IPP+FYKAVA+++ ++Y
Sbjct: 301 LKIREIAEENNIPIFEDPPLARSMFAQVSVDSVIPPIFYKAVAEIVQRLY 350


>gi|222084854|ref|YP_002543383.1| flagellar biosynthesis transmembrane protein [Agrobacterium
           radiobacter K84]
 gi|221722302|gb|ACM25458.1| flagellar biosynthesis transmembrane protein [Agrobacterium
           radiobacter K84]
          Length = 358

 Score =  337 bits (865), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 159/352 (45%), Positives = 238/352 (67%), Gaps = 1/352 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++ D  D+KTE P+ KK+ D + +GN P SREA++F+S+LA +IY+ FF    +  +  
Sbjct: 1   MADEDK-DSKTEKPTEKKLRDTMEKGNVPHSREATIFASMLATVIYVTFFLPERMGRMGE 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  L     Q KLE     + L T +      LV+P ++LF +FGIGS + Q +P   L
Sbjct: 60  VLRDLFEKPDQWKLETGPDALSLFTRIGWEVGNLVLPAIVLFFIFGIGSSMFQNLPTPVL 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + ++P F R+S   G  RI+S + LV F KS  KI++V  I+   L   +F  +D ++++
Sbjct: 120 DRIQPKFSRISPVSGWNRIFSTSGLVEFGKSLAKIVVVSIIMFFVLRGQFFHAIDSLASD 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P +I       V+++L+++LL  A + + D+ WS H W+ +LKM+KQEIKDE KQS G+P
Sbjct: 180 PQTIFVRLSTIVQRILMIVLLATAVVGIADVLWSRHHWFDQLKMTKQEIKDEFKQSQGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           I+K+RQ+S+AR R R +M++   RAT++I NPTH+A+ALRY++ E DAPV+VAKGQ+LIA
Sbjct: 240 IVKSRQRSVARDRARRRMIKQVPRATLVIANPTHFAVALRYVREEGDAPVVVAKGQDLIA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
            K+R+IA  + IP+FE+P LARS+F QV ++S IP VFYKAVA+LI++IY +
Sbjct: 300 LKIREIAEANGIPVFEDPPLARSMFAQVSVDSVIPSVFYKAVAELIHRIYAQ 351


>gi|241203095|ref|YP_002974191.1| flagellar biosynthesis protein FlhB [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240856985|gb|ACS54652.1| flagellar biosynthetic protein FlhB [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 359

 Score =  332 bits (851), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 152/347 (43%), Positives = 236/347 (68%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP++KK  DA  +GN P SRE S+F++ILA  IYL+FF    +  ++  L 
Sbjct: 3   DDDKDSKTEAPTAKKQSDAAEKGNVPSSRELSIFATILATFIYLVFFLPDSVGRMSETLR 62

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
            +     Q K+E    ++ L   L  +++ LV P  +LFM+FG+ S + Q +P L L  +
Sbjct: 63  DIFEQPDQWKIETGPDVLALFVRLGWASAALVAPAFILFMVFGVASSVFQNLPTLVLERI 122

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P   R+S  +G  R++S+  LV F KS  K+++VG I+   L   YF  +D + ++P +
Sbjct: 123 RPQASRISPIKGWSRLFSVPGLVEFGKSLFKVVVVGVILFFVLRSEYFGSIDAMFSDPQT 182

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
           IL      +RK++I++L+  A + + D+ W+ H W+++LKM++ E+K+E KQ+ G+P +K
Sbjct: 183 ILVRLMAAMRKIIIVMLIATAIVAIADLFWTRHHWFTELKMTRHEVKEENKQAQGDPFVK 242

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
           +RQ+S+ R R R +M+    RAT++I NPTHYA+ALRY + ENDAPV++AKGQ+LIA K+
Sbjct: 243 SRQRSLMRDRARRRMIADVHRATLVIANPTHYAVALRYAREENDAPVVLAKGQDLIALKI 302

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           R+IA ++ IP+FE+P LARS+F QV I+S IP VFYKAVA+LI+++Y
Sbjct: 303 REIAEKNGIPVFEDPPLARSMFAQVSIDSVIPSVFYKAVAELIHRVY 349


>gi|15964403|ref|NP_384756.1| flagellar biosynthesis protein FlhB [Sinorhizobium meliloti 1021]
 gi|307311545|ref|ZP_07591186.1| flagellar biosynthetic protein FlhB [Sinorhizobium meliloti BL225C]
 gi|307318900|ref|ZP_07598331.1| flagellar biosynthetic protein FlhB [Sinorhizobium meliloti AK83]
 gi|17380369|sp|O54243|FLHB_RHIME RecName: Full=Flagellar biosynthetic protein flhB
 gi|15073580|emb|CAC45222.1| Flagellar biosynthetic transmembrane protein [Sinorhizobium
           meliloti 1021]
 gi|306895314|gb|EFN26069.1| flagellar biosynthetic protein FlhB [Sinorhizobium meliloti AK83]
 gi|306899562|gb|EFN30191.1| flagellar biosynthetic protein FlhB [Sinorhizobium meliloti BL225C]
          Length = 360

 Score =  332 bits (851), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 156/350 (44%), Positives = 243/350 (69%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E    D+KTEAPS KKI DA  +GN P SRE + F+S LA  I+++FF S G  ++  
Sbjct: 1   MAEEQDKDSKTEAPSEKKISDATEKGNVPFSREVTAFASTLAIYIFVVFFLSDGAANMAE 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  +       +L+  +  V L++H+ L  + LV+P  +L ++FG+GS + Q +P   L
Sbjct: 61  ALKDIFEQPEAWRLDTATDAVALISHVVLKCAALVLPVFILLILFGVGSSIFQNLPRPVL 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + ++P + RVS   G KRIY +  LV F KS  KII+V  ++ + L  +YF  LD + ++
Sbjct: 121 DRIQPKWNRVSPAAGFKRIYGVQGLVEFGKSLFKIIVVSIVVVLVLWNDYFATLDMMFSD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P +I       +++++I++L   ATL ++D+ W+ H WY++L+M++QE+KDE+KQS G+P
Sbjct: 181 PVTIFTTMISDLKQIIIVVLFATATLAIVDLFWTRHHWYTELRMTRQEVKDELKQSQGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           I+K+R +S+ R R R +M+ +  RAT+II NPTHYA+ALRY++ E+DAPV+VA G++L+A
Sbjct: 241 IVKSRLRSMQRDRARKRMISSVPRATLIIANPTHYAVALRYVREESDAPVVVAMGKDLVA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
            K+R+IA ++ IP+FE+P LARS+F QV ++S IPPVFYKAVA+LI+++Y
Sbjct: 301 LKIREIAEKNGIPVFEDPPLARSMFAQVSVDSVIPPVFYKAVAELIHRVY 350


>gi|15887910|ref|NP_353591.1| flagellar biosynthesis protein FlhB [Agrobacterium tumefaciens str.
           C58]
 gi|2459702|gb|AAB71778.1| FlhB [Agrobacterium tumefaciens]
 gi|15155504|gb|AAK86376.1| flagellar biosynthetic protein [Agrobacterium tumefaciens str. C58]
          Length = 360

 Score =  331 bits (849), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 154/352 (43%), Positives = 236/352 (67%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++   D+KTE P+ KK+ DA  +GN P SRE  +F+S LA   YL+FF   G   +  
Sbjct: 1   MADDQDKDSKTEDPTEKKLRDAAEKGNLPFSREVPIFASSLAFYCYLVFFLPEGAGRLGV 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  L     Q  L      + LL  L  S + L++P +++F++FG+ S  +Q +P   L
Sbjct: 61  TLKDLFGQPEQWNLSTRPDALALLYFLGTSVAYLLMPAMIMFIVFGLASSFLQNLPSPVL 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             V+P + R+S  +G  RIYS    V F KS  KI++V  I+  +L  ++++++D + ++
Sbjct: 121 ERVRPQWSRISPAKGFTRIYSKQGFVEFAKSVFKIMIVSIIMFFALRGDFYSLIDLMFSD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P  I       V+K++++ILL  A L  +D+ W+ H W+S+LKM+K E+K+E KQS G+P
Sbjct: 181 PQVIFVRVVEIVKKMMVVILLSTALLAAVDVLWTRHHWFSQLKMTKHEVKEEYKQSQGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           ++K+RQ+SIAR R R +M+    RAT++I NPTH+A+ALRY++ E DAPV+VAKGQ+LIA
Sbjct: 241 VVKSRQRSIARDRARRRMINNVPRATLVIANPTHFAVALRYVREEGDAPVVVAKGQDLIA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
            K+R+IA E+NIP+FE+P LARS+F QV ++S IPPVFYKAVA+L++++Y +
Sbjct: 301 LKIRQIAEENNIPVFEDPPLARSMFAQVSVDSVIPPVFYKAVAELVHRVYAR 352


>gi|2916784|emb|CAA11951.1| flhB protein [Sinorhizobium meliloti]
          Length = 360

 Score =  330 bits (847), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 156/350 (44%), Positives = 243/350 (69%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E    D+KTEAPS KKI DA  +GN P SRE + F+S LA  I+++FF S G  ++  
Sbjct: 1   MAEEQDKDSKTEAPSEKKISDATEKGNVPFSREVTAFASTLAIYIFVVFFLSDGAANMAE 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  +       +L+  +  V L++H+ L  + LV+P  +L ++FG+GS + Q +P   L
Sbjct: 61  ALKDIFEQPEAWRLDTATDAVALISHVVLKCAALVLPVSILLILFGVGSSIFQNLPRPVL 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + ++P + RVS   G KRIY +  LV F KS  KII+V  ++ + L  +YF  LD + ++
Sbjct: 121 DRIQPKWNRVSPAAGFKRIYGVQGLVEFGKSLFKIIVVSIVVVLVLWNDYFATLDMMFSD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P +I       +++++I++L   ATL ++D+ W+ H WY++L+M++QE+KDE+KQS G+P
Sbjct: 181 PVTIFTTMISDLQQIIIVVLFATATLAIVDLFWTRHHWYTELRMTRQEVKDELKQSQGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           I+K+R +S+ R R R +M+ +  RAT+II NPTHYA+ALRY++ E+DAPV+VA G++L+A
Sbjct: 241 IVKSRLRSMQRDRARKRMISSVPRATLIIANPTHYAVALRYVREESDAPVVVAMGKDLVA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
            K+R+IA ++ IP+FE+P LARS+F QV ++S IPPVFYKAVA+LI+++Y
Sbjct: 301 LKIREIAEKNGIPVFEDPPLARSMFAQVSVDSVIPPVFYKAVAELIHRVY 350


>gi|150395473|ref|YP_001325940.1| flagellar biosynthesis protein FlhB [Sinorhizobium medicae WSM419]
 gi|150026988|gb|ABR59105.1| flagellar biosynthetic protein FlhB [Sinorhizobium medicae WSM419]
          Length = 360

 Score =  330 bits (845), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 155/350 (44%), Positives = 245/350 (70%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++   D+KTEAPS KKI DA ++GN P SRE + F+S LA  I+++FF + G  +V  
Sbjct: 1   MADDQDKDSKTEAPSEKKISDATDKGNVPFSREVTAFASTLAIYIFVVFFLADGAANVAE 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  +       +L+  +  V L++H+ L ++ L++P  +L ++FG+GS + Q +P   L
Sbjct: 61  ALKDIFEQPEAWRLDTATDAVALISHVVLKSATLLMPIFILLILFGVGSSIFQNLPRPVL 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + ++P + RVS   G KRIY +  LV F KS  K+I+V  ++ + L  +YF  LD + ++
Sbjct: 121 DRIQPKWNRVSPVAGFKRIYGVPGLVEFGKSLFKVIVVSIVVVLVLWNDYFATLDMMFSD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P  I       +++++I++L   ATL ++D+ W+ H WY++LKM+KQE+KDE+KQS G+P
Sbjct: 181 PVMIFTTMTSDLKQIIIVVLFATATLAIVDLFWTRHHWYTELKMTKQEVKDELKQSQGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           I+K+R +S+ R R R +M+ +  RAT+II NPTHYA+ALRY++ E+DAPV+VA G++L+A
Sbjct: 241 IVKSRLRSLQRDRARKRMISSVPRATLIIANPTHYAVALRYVREESDAPVVVAMGKDLVA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
            K+R+IA ++ IP+FE+P LARS+F QV ++S IPPVFYKAVA+LI+++Y
Sbjct: 301 LKIREIAEKNGIPVFEDPPLARSMFAQVSVDSVIPPVFYKAVAELIHRVY 350


>gi|116250471|ref|YP_766309.1| flagellar biosynthesis protein FlhB [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115255119|emb|CAK06193.1| putative flagellar biosynthetic protein [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 365

 Score =  329 bits (844), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 151/347 (43%), Positives = 235/347 (67%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP++KK  DA  +GN P SRE S+F++ILA  IYL+FF    +  +T  L 
Sbjct: 9   DDDKDSKTEAPTAKKQSDAAEKGNVPSSRELSIFATILATFIYLVFFLPESVGRMTEMLR 68

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
            +     Q K+E    ++ L   +  +++ LV P  +LFM+FG+ S + Q +P   L  +
Sbjct: 69  DIFEQPDQWKIETGPDVLALFVRIGWASAALVAPAFILFMVFGVASSVFQNLPTPVLERI 128

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P   R+S  +G  R++S+  LV F KS  K+++VG I+   L   YF  +D + ++P +
Sbjct: 129 RPQASRISPIKGWSRLFSVPGLVEFGKSLFKVVVVGVILFFVLRSEYFGSIDAMFSDPQT 188

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
           IL      +RK++I++L+  A + + D+ W+ H W+++LKM++ E+K+E KQ+ G+P +K
Sbjct: 189 ILVRMMAAMRKIIIVMLIATAIVAIADLFWTRHHWFTELKMTRHEVKEENKQAQGDPFVK 248

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
           +RQ+S+ R R R +M+    RAT++I NPTHYA+ALRY + ENDAPV++AKGQ+LIA K+
Sbjct: 249 SRQRSLMRDRARRRMIANVDRATLVIANPTHYAVALRYAREENDAPVVLAKGQDLIALKI 308

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           R+IA ++ IP+FE+P LARS+F QV I+S IP VFYKAVA+LI+++Y
Sbjct: 309 REIAEKNGIPVFEDPPLARSMFAQVSIDSVIPSVFYKAVAELIHRVY 355


>gi|227820846|ref|YP_002824816.1| flagellar biosynthesis protein FlhB [Sinorhizobium fredii NGR234]
 gi|227339845|gb|ACP24063.1| flagellar biosynthetic protein FlhB [Sinorhizobium fredii NGR234]
          Length = 360

 Score =  329 bits (844), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 158/350 (45%), Positives = 242/350 (69%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS++   D+KTEAPS KK+ DA  +GN P SRE + F+S LA  I+++FF S G  S   
Sbjct: 1   MSDDQDKDSKTEAPSEKKLSDAAEKGNVPFSREVTAFASTLAVYIFIVFFLSDGAASTAE 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  +       +LE  +  V L++H+ L ++ LV+P  +L ++FG+GS + Q +P   L
Sbjct: 61  ALKDIFEQPEAWRLETATDAVGLISHVVLKSAGLVLPVFVLLIIFGVGSSIFQNLPRPVL 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + + P+  RVS   G KRI+ +  LV F KS  KII+V  I+ + L  +YF  LD + ++
Sbjct: 121 DRIMPNMNRVSPIAGFKRIFGVPGLVEFAKSLFKIIVVSIIVVLVLWNDYFATLDLMFSD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P +I       +++++ ++LL  A L ++D+ W+ H WYS+LKM+KQE+K+E+KQS G+P
Sbjct: 181 PVTIFATMISDLKQIVTVVLLATAVLAIVDLFWTRHHWYSELKMTKQEVKEELKQSQGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           I+K+R +S+ R R R +M+ +  RAT++I NPTHYA+ALRY++ E+DAPV+VA GQ+L+A
Sbjct: 241 IVKSRLRSMQRDRARKRMIASVPRATLVIANPTHYAVALRYVREESDAPVVVAMGQDLVA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
            K+R+IA ++ IP+FE+P LARS+F QV ++S IPPVFYKAVA+LI+++Y
Sbjct: 301 LKIREIAEKNGIPVFEDPPLARSMFAQVSVDSVIPPVFYKAVAELIHRVY 350


>gi|163758003|ref|ZP_02165091.1| flagellar biosynthesis protein B [Hoeflea phototrophica DFL-43]
 gi|162284292|gb|EDQ34575.1| flagellar biosynthesis protein B [Hoeflea phototrophica DFL-43]
          Length = 363

 Score =  326 bits (836), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 152/353 (43%), Positives = 233/353 (66%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E +  D+KTE P+ KK+ DA+++GN P SRE  +F+SIL  L++L+FF        T+
Sbjct: 1   MAEGEDKDSKTEEPTEKKLRDAIDKGNIPFSREVPIFASILGTLLFLVFFLPSAASRFTN 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  L   +   +LE     V L   L + A  +++P   L M FGI + ++Q +P   L
Sbjct: 61  SLRDLFEQSDDWRLETGGDAVALFQSLFIEAGVVMVPAFALLMGFGIAASVLQNMPSPVL 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + ++P  +R+S+ +G  RIY I  +V F KS  KII V   ++I++ + +F  LDF+  +
Sbjct: 121 DRIQPKLERISIVKGFGRIYGIKGMVEFAKSMFKIIAVSLFVSIAMKDEFFRSLDFMFMD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P  ++        KV+ ++L+  A L VLD+ W+ + W++  KMSKQ+IKDE+KQS G+P
Sbjct: 181 PTLVVPDMARIAAKVVAVVLISTALLAVLDVLWTRYSWHNDQKMSKQDIKDELKQSDGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           I+K RQ+S+AR R R +M+    RAT++I NPTH+A+ALRY++ E  APV++AKGQ+LIA
Sbjct: 241 IVKARQRSLARDRARRRMIAEVPRATMVIANPTHFAVALRYVREEGGAPVVIAKGQDLIA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++A  H IP+FE+P LARS+F QV +++ IP VFYKAVA+L+++IY  K
Sbjct: 301 LKIREVAEAHGIPVFEDPPLARSMFAQVSVDNFIPAVFYKAVAELVHRIYTDK 353


>gi|86356301|ref|YP_468193.1| flagellar biosynthesis protein FlhB [Rhizobium etli CFN 42]
 gi|86280403|gb|ABC89466.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CFN
           42]
          Length = 373

 Score =  326 bits (836), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 150/347 (43%), Positives = 235/347 (67%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP++KK  DA  +GN P SRE S+F++ILA  IYL+FF    +  ++  L 
Sbjct: 17  DDDKDSKTEAPTAKKQTDAAEKGNVPFSRELSIFATILATYIYLVFFLPDSVGRMSETLR 76

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
            +     Q K+E    ++ L   L  + + L+ P  +LFM+FGI S + Q +P   L  +
Sbjct: 77  DIFEQPDQWKIETGPDVLSLFVRLGWAIAALLAPAFILFMVFGIASSVFQNLPTPVLERI 136

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P   R+S  +G  R++S+  L+ F KS  K+++VG I+   L   YF+ +D + ++P +
Sbjct: 137 RPQASRISPAKGWGRLFSLPGLIEFGKSLFKVVVVGLILFFVLRSEYFSSIDAMFSDPQT 196

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
           IL      +RK++I++L+  A + + D+ W+ H W+++LKM++ EIK+E KQ+ G+P +K
Sbjct: 197 ILVRISTAMRKIVIVVLIATAIVAIADVFWTRHHWFTELKMTRHEIKEENKQAQGDPFVK 256

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
           +RQ+S+ R R R +M+    RAT++I NPTHYA+ALRY + ENDAPV++AKGQ+LIA K+
Sbjct: 257 SRQRSLMRDRARRRMIANVHRATLVIANPTHYAVALRYAREENDAPVVLAKGQDLIALKI 316

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           R+IA ++ IP+FE+P LARS+F QV ++S IP VFYKAVA+LI+++Y
Sbjct: 317 REIAEQNGIPVFEDPPLARSMFAQVSVDSVIPSVFYKAVAELIHRVY 363


>gi|327193023|gb|EGE59935.1| flagellar biosynthesis transmembrane protein [Rhizobium etli
           CNPAF512]
          Length = 373

 Score =  325 bits (834), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 149/347 (42%), Positives = 233/347 (67%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP++KK  DA  +GN P SRE S+F++ILA  IYL+FF    +  ++  L 
Sbjct: 17  DDDKDSKTEAPTAKKQTDAAEKGNVPFSRELSIFATILATFIYLVFFLPENVGRMSETLR 76

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
            +     Q K+E    I+ L   L  +++ L+ P  +L M+FGI S + Q +P   L  +
Sbjct: 77  DIFEQPDQWKIETGPDILALFVRLGWASAALLAPAFILLMVFGIASSIFQNLPTPVLERI 136

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P   R+S  +G  R++S+  L+ F KS  K+++VG I+   L   YF  +D + ++P +
Sbjct: 137 RPQASRISPMKGWSRLFSLPGLIEFGKSLFKVVVVGVILFFVLRSEYFGSIDAMFSDPQT 196

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
           IL      +RK++I++L+  A + + D  W+ H W+++LKM++ E+K+E KQ+ G+P +K
Sbjct: 197 ILVRMMTAMRKIIIVMLIATAIVAIADFFWTRHHWFTELKMTRHEVKEENKQAQGDPFVK 256

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
           +RQ+S+ R R R +M+    RAT++I NPTHYA+ALRY + ENDAPV++AKGQ+LIA K+
Sbjct: 257 SRQRSLMRDRARRRMIANVHRATLVIANPTHYAVALRYAREENDAPVVLAKGQDLIALKI 316

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           R+IA ++ IP+FE+P LARS+F QV ++S IP VFYKAVA+LI+++Y
Sbjct: 317 REIAEQNGIPVFEDPPLARSMFAQVSVDSVIPSVFYKAVAELIHRVY 363


>gi|209547917|ref|YP_002279834.1| flagellar biosynthesis protein FlhB [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533673|gb|ACI53608.1| flagellar biosynthetic protein FlhB [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 359

 Score =  325 bits (833), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 149/347 (42%), Positives = 235/347 (67%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP++KK  DA  +GN P SRE S+F++ILA  IYL+FF    +  +   L 
Sbjct: 3   DDDKDSKTEAPTAKKQTDAAEKGNVPFSRELSIFATILATYIYLVFFLPDSVGHMAETLR 62

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
            +     Q K+E    ++ L   L  + + L+ P  +LFM+FGI S + Q +P   L  +
Sbjct: 63  DIFDQPDQWKIETGPDVLSLFVKLGWAIAALLAPAFILFMVFGIASSIFQNLPTPVLERI 122

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P   R+S  +G +R++S+  L+ F KS  K+++VG I+   L   YF+ +D + ++P +
Sbjct: 123 RPQASRISPVKGWERLFSLPGLIEFGKSLFKVVVVGVILFFVLRSEYFSSIDAMFSDPQT 182

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
           IL      +RK++I++L+  A + ++D+ W+ H W+++LKM++ EIK+E KQ+ G+P +K
Sbjct: 183 ILVRISTAMRKIIIVVLIATAIVAIVDVFWTRHHWFTELKMTRHEIKEENKQAQGDPFVK 242

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            RQ+S+ R R R +M+    RAT++I NPTHYA+ALRY + ENDAPV++AKGQ+LIA K+
Sbjct: 243 GRQRSLMRDRARRRMISNVHRATLVIANPTHYAVALRYAREENDAPVVLAKGQDLIALKI 302

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           R+IA ++ IP+FE+P LARS+F QV +++ IP VFYKAVA+LI+++Y
Sbjct: 303 REIAEKNGIPVFEDPPLARSMFAQVSVDTVIPSVFYKAVAELIHRVY 349


>gi|190890352|ref|YP_001976894.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CIAT
           652]
 gi|190695631|gb|ACE89716.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CIAT
           652]
          Length = 373

 Score =  325 bits (832), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 149/347 (42%), Positives = 233/347 (67%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP++KK  DA  +GN P SRE S+F++ILA  IYL+FF    +  ++  L 
Sbjct: 17  DDDKDSKTEAPTAKKQTDAAEKGNVPFSRELSIFATILATFIYLVFFLPENVGRMSETLR 76

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
            +     Q K+E    I+ L   L  +++ L+ P  +L M+FGI S + Q +P   L  +
Sbjct: 77  DIFEQPDQWKIETGPDILALFVRLGWASAALLAPAFILLMVFGIASSIFQNLPTPVLERI 136

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P   R+S  +G  R++S+  L+ F KS  K+++VG I+   L   YF  +D + ++P +
Sbjct: 137 RPQASRISPVKGWSRLFSLPGLIEFGKSLFKVVVVGVILFFVLRSEYFGSIDAMFSDPQT 196

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
           IL      +RK++I++L+  A + + D  W+ H W+++LKM++ E+K+E KQ+ G+P +K
Sbjct: 197 ILVRMMTAMRKIIIVMLIATAIVAIADFFWTRHHWFTELKMTRHEVKEENKQAQGDPFVK 256

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
           +RQ+S+ R R R +M+    RAT++I NPTHYA+ALRY + ENDAPV++AKGQ+LIA K+
Sbjct: 257 SRQRSLMRDRARRRMIANVHRATLVIANPTHYAVALRYAREENDAPVVLAKGQDLIALKI 316

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           R+IA ++ IP+FE+P LARS+F QV ++S IP VFYKAVA+LI+++Y
Sbjct: 317 REIAEQNGIPVFEDPPLARSMFAQVSVDSVIPSVFYKAVAELIHRVY 363


>gi|325291951|ref|YP_004277815.1| flagellar biosynthesis protein FlhB [Agrobacterium sp. H13-3]
 gi|325059804|gb|ADY63495.1| flagellar biosynthesis protein FlhB [Agrobacterium sp. H13-3]
          Length = 360

 Score =  325 bits (832), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 152/353 (43%), Positives = 233/353 (66%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++   D+KTE P+ KK+ DA  +GN P SRE  +F+S LA   YL+FF   G   +  
Sbjct: 1   MADDQDKDSKTEDPTEKKLRDAAEKGNLPFSREVPIFASSLAFYCYLVFFLPDGAGRLGV 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  L     Q  L      + LL  L  S + L++P +++F++FG+ S   Q +P   L
Sbjct: 61  TLKDLFGQPEQWNLSTRPDALSLLYFLGTSMAYLLMPAMIMFIVFGLASSFFQNLPSPVL 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             V+P + R+S  +G  RIYS    V F KS  KI++V  I+ +SL  ++++++D + ++
Sbjct: 121 ERVRPQWSRISPAKGFGRIYSKQGFVEFGKSLFKILIVSIIMFLSLRGDFYSLIDLMFSD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P  I        +K++++IL   A L  +D+ W+ H W+S+LKM+K E+K+E KQS G+P
Sbjct: 181 PQVIFVRVVELTKKMMVVILFSTALLAAVDLLWTRHHWFSQLKMTKHEVKEEYKQSQGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           ++K RQ+S+AR R R +M++   RAT++I NPTH+A+ALRY++ E DAPV+VAKGQ+LIA
Sbjct: 241 VVKARQRSVARDRARRRMIDNVPRATLVIANPTHFAVALRYVREEGDAPVVVAKGQDLIA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA ++NIP+FE+P LARS+F QV I+S IPP FYKAVA+L++++Y  K
Sbjct: 301 LKIREIAEKNNIPVFEDPPLARSMFAQVSIDSVIPPAFYKAVAELVHRVYAMK 353


>gi|45479286|gb|AAS66688.1| FlhB [Agrobacterium sp. H13-3]
          Length = 374

 Score =  323 bits (829), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 151/353 (42%), Positives = 233/353 (66%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           ++++   D+KTE P+ KK+ DA  +GN P SRE  +F+S LA   YL+FF   G   +  
Sbjct: 15  LADDQDKDSKTEDPTEKKLRDAAEKGNLPFSREVPIFASSLAFYCYLVFFLPDGAGRLGV 74

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  L     Q  L      + LL  L  S + L++P +++F++FG+ S   Q +P   L
Sbjct: 75  TLKDLFGQPEQWNLSTRPDALSLLYFLGTSMAYLLMPAMIMFIVFGLASSFFQNLPSPVL 134

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             V+P + R+S  +G  RIYS    V F KS  KI++V  I+ +SL  ++++++D + ++
Sbjct: 135 ERVRPQWSRISPAKGFGRIYSKQGFVEFGKSLFKILIVSIIMFLSLRGDFYSLIDLMFSD 194

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P  I        +K++++IL   A L  +D+ W+ H W+S+LKM+K E+K+E KQS G+P
Sbjct: 195 PQVIFVRVVELTKKMMVVILFSTALLAAVDLLWTRHHWFSQLKMTKHEVKEEYKQSQGDP 254

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           ++K RQ+S+AR R R +M++   RAT++I NPTH+A+ALRY++ E DAPV+VAKGQ+LIA
Sbjct: 255 VVKARQRSVARDRARRRMIDNVPRATLVIANPTHFAVALRYVREEGDAPVVVAKGQDLIA 314

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA ++NIP+FE+P LARS+F QV I+S IPP FYKAVA+L++++Y  K
Sbjct: 315 LKIREIAEKNNIPVFEDPPLARSMFAQVSIDSVIPPAFYKAVAELVHRVYAMK 367


>gi|218663130|ref|ZP_03519060.1| flagellar biosynthesis protein FlhB [Rhizobium etli IE4771]
          Length = 360

 Score =  275 bits (703), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 136/351 (38%), Positives = 215/351 (61%), Gaps = 7/351 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP++KK  DA  +GN P SRE S+F++ILA  IYL+FF    +  ++  L 
Sbjct: 3   DDDKDSKTEAPTAKKQSDAAEKGNVPFSRELSIFATILATFIYLVFFLPESVGRMSETLR 62

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIP----VLN 119
            +     Q K+E    ++ L   L  + + L+ P  +L M+FG   + I  +P       
Sbjct: 63  DIFEQPDQWKIETGPDVLALFVRLGWAIAALLAPAFILLMVFG---HRIVDLPEPADACA 119

Query: 120 LNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISA 179
            N      +            +     +      K+++VG I+   L   YF  +D + +
Sbjct: 120 GNASDRRLRASRRPRAGHGSSACLASSSSESPLFKVVVVGVILFFVLRSEYFGSIDAMFS 179

Query: 180 NPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
           +P +IL      +RK++I++L+  A + + D+ W+ H W+++LKM++ E+K+E KQ+ G+
Sbjct: 180 DPQTILVRMMTAMRKIIIVMLIATAIVAIADLFWTRHHWFTELKMTRHEVKEENKQAQGD 239

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLI 299
           P +K RQ+S+ R R R +M+    RAT++I NPTHYA+ALRY + ENDAPV++AKGQ+LI
Sbjct: 240 PFVKGRQRSLMRDRARRRMIANVHRATLVIANPTHYAVALRYAREENDAPVVLAKGQDLI 299

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           A K+R+IA ++ IP+FE+P LARS+F QV ++S IP VFYKAVA+LI+++Y
Sbjct: 300 ALKIREIAEQNGIPVFEDPPLARSMFAQVSVDSVIPSVFYKAVAELIHRVY 350


>gi|319781693|ref|YP_004141169.1| flagellar biosynthetic protein FlhB [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167581|gb|ADV11119.1| flagellar biosynthetic protein FlhB [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 360

 Score =  272 bits (695), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 131/353 (37%), Positives = 219/353 (62%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++    D+KTE  + KKI D + +G  P SRE +LF+S +A L++ +F+    I  +  
Sbjct: 1   MADAVDKDSKTEEATEKKIRDTIEQGKLPHSRETALFASFVAILVFTVFYAKDAIIDLGM 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L + L       ++  + ++ L   + L   R V+  ++L  + G+G+ + Q +P    
Sbjct: 61  FLSMFLEKPEAWPMDTETDVIALYKIVLLEVGRAVLSLMVLLTVAGVGASVFQNMPQFVG 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             V+P   R+S+ +G  R++ I   V F+KS  K+     +++ +L+E++  +L  +  N
Sbjct: 121 ERVRPQLSRISIAKGWNRLFGIQGWVEFLKSLGKVGFAIVVLSFTLSEDHRKLLAGMITN 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P +           +L+ I+  +  +  +DI WS   W   L+MSKQE+KDE KQS G+P
Sbjct: 181 PIAFGLVIRGIAVDILVAIVFVMGLIAAVDIVWSRFHWKQDLRMSKQEVKDEFKQSEGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           I+K+R +S+AR R R +MM A  RAT+II NPTH+++AL+Y++ E+ AP+++AKGQ+L+A
Sbjct: 241 IVKSRLRSLARDRARKRMMTAVPRATLIIANPTHFSIALKYVRDEDSAPMVLAKGQDLVA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA EHNIP+FE+ +LARS++KQV +++ IP  FY+AVA+L+  +Y KK
Sbjct: 301 LKIREIAREHNIPVFEDVALARSMYKQVSVDNVIPSQFYQAVAELVRIVYSKK 353


>gi|260466631|ref|ZP_05812819.1| flagellar biosynthetic protein FlhB [Mesorhizobium opportunistum
           WSM2075]
 gi|259029637|gb|EEW30925.1| flagellar biosynthetic protein FlhB [Mesorhizobium opportunistum
           WSM2075]
          Length = 360

 Score =  268 bits (686), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 133/353 (37%), Positives = 220/353 (62%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS+    D+KTE  + KKI D + +G  P SRE +L +S +A L++ +F+    I  +  
Sbjct: 1   MSDAVDKDSKTEEATEKKIRDTIEQGKLPHSRETALLASFVAILVFTVFYAKDAIIDLGM 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L       ++  + ++ L   + L   R ++  L+L  + GIG+ ++Q +P +  
Sbjct: 61  FLATFLEKPEAWPMDTETDVIALYKLVMLEVGRALVSLLVLLSVAGIGASVLQNMPQIVG 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F R+S+ +G  R++ +   V F+KS  K+     +++ +L+E++  +L  +  N
Sbjct: 121 ERIRPQFSRISIVKGWNRMFGVQGWVEFLKSLGKVGFAIAVLSFTLSEDHRKLLAGMITN 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P +           +L+ I+  +  +  +DI WS   W   L+MSKQE+KDE KQS G+P
Sbjct: 181 PVAFGLVIRGIAVDILVAIVFVMGLIAAIDIVWSRFHWKQDLRMSKQEVKDEFKQSEGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           I+K+R +S+AR R R +MM A  RAT+II NPTH+++AL+Y++ E+ AP++VAKGQ+L+A
Sbjct: 241 IVKSRLRSLARDRARKRMMTAVPRATLIIANPTHFSIALKYVRDEDSAPLVVAKGQDLVA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA EHNIPIFE+ +LARS++KQV +++ IP  FY+AVA+L+  +Y KK
Sbjct: 301 LKIREIAREHNIPIFEDVALARSMYKQVSVDNVIPSQFYQAVAELVRIVYSKK 353


>gi|13472564|ref|NP_104131.1| flagellar biosynthesis protein FlhB [Mesorhizobium loti MAFF303099]
 gi|14023310|dbj|BAB49917.1| flagellar biosynthetic protein; FlhB [Mesorhizobium loti
           MAFF303099]
          Length = 360

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 130/353 (36%), Positives = 218/353 (61%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS+    D+KTE  + KK+ D + +G  P SRE ++ +S +A L++ +F+    + ++  
Sbjct: 1   MSDAADKDSKTEEATEKKVRDTIEQGKLPHSRETAILASFVAILVFTVFYAKDAVINLGM 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L + L       +   + ++ L   + L   R V+  L+L  + GIG+ ++Q +P    
Sbjct: 61  FLSMFLEKPEAWPMNTETDVIDLYKIVMLEVGRAVVSLLVLLTVAGIGASVLQNMPQFVG 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P   R+S+ +G  R++     V F+KS  K+     ++T +L+E++  +L  +  N
Sbjct: 121 ERIRPQLSRISITKGWNRMFGAQGWVEFLKSLAKVGFAIAVLTFTLSEDHSKLLAGMITN 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P +           +L+ I+  +  +  +DI WS   W   L+M+KQE+KDE KQS G+P
Sbjct: 181 PVAFGLVIRGIAVDILVAIVFVMGLIAAIDIVWSRFHWKQDLRMTKQEVKDEFKQSEGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           I+K+R +S+AR R R +MM A  RAT+II NPTH+++AL+Y++ E+ AP++VAKGQ+L+A
Sbjct: 241 IVKSRLRSLARDRARKRMMTAVPRATLIIANPTHFSIALKYVRDEDSAPLVVAKGQDLVA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA EHNIPIFE+ +LARS++KQV +++ IP  FY+AVA+L+  +Y KK
Sbjct: 301 LKIREIAKEHNIPIFEDVALARSMYKQVSVDNVIPSQFYQAVAELVRIVYSKK 353


>gi|217976220|ref|YP_002360367.1| flagellar biosynthesis protein FlhB [Methylocella silvestris BL2]
 gi|217501596|gb|ACK49005.1| type III secretion exporter [Methylocella silvestris BL2]
          Length = 359

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 134/349 (38%), Positives = 217/349 (62%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +++ +++TE  + KKI D L  GNAP SREA+LF+S+ A LI   FF    I S+T  LH
Sbjct: 3   DESTESRTEEATEKKIGDELERGNAPFSREAALFASVSAMLIIGAFFAQQCIASMTLLLH 62

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
            LL  A   +L + +  V L+  +S    +++I   ++F   G+ +  +Q  P L ++ +
Sbjct: 63  HLLDDAGGVRLRNGNDAVALMKLVSWDVFKVLIAPFVVFAAGGVLASALQNAPRLVVDRI 122

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
            P+FKR+SL EG +R++       F KS VK+  +  I+   L      +++ ++  P +
Sbjct: 123 LPNFKRISLTEGWQRLHGARGYAEFSKSVVKLASISVIVLAVLQSQQNKLVNAVALEPEA 182

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
           +         K++ ++ +  A L  +D+ WS   W   ++MS+QEIKDE+KQS G+P+ K
Sbjct: 183 LPELILSVAMKLMSVVCIVTAALLAIDLVWSRFHWRRDMRMSRQEIKDEMKQSDGDPVRK 242

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R +S+A+ R+R  M+ A  +AT++I NPTHYA+ALRY++ E  AP++++KGQ+LIA K+
Sbjct: 243 ARLRSLAQDRVRKNMIAAVPKATLVIANPTHYAIALRYVKEEGGAPMVISKGQDLIALKI 302

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
           R++A  H+IPI E+  LARS++  V ++  IPP FYKAVA+LI+ +Y K
Sbjct: 303 RELAERHSIPIIEDKLLARSMYDSVEVDHPIPPQFYKAVAELIHYLYSK 351


>gi|115523175|ref|YP_780086.1| flagellar biosynthesis protein FlhB [Rhodopseudomonas palustris
           BisA53]
 gi|115517122|gb|ABJ05106.1| flagellar biosynthetic protein FlhB [Rhodopseudomonas palustris
           BisA53]
          Length = 358

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 121/351 (34%), Positives = 218/351 (62%), Gaps = 2/351 (0%)

Query: 4   NDAPD--NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSD 61
           +DAP+  +KTE P+ KK+ D++ +G  P+SRE ++FSS++A L+ L F     + ++T  
Sbjct: 2   SDAPEKESKTEEPTEKKVRDSVEKGQIPVSREVAIFSSMIALLLILSFLTGDKLTALTKA 61

Query: 62  LHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLN 121
           L  L+   +  +++  +  + L+T + +S++R V+P +++  + G+ S  +Q +P +  +
Sbjct: 62  LAGLIDDPSGVRIKTGADAIELITAIGVSSARFVLPIVVVLSLAGLASSFLQNVPRIVAD 121

Query: 122 HVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANP 181
            ++P   R+S+ +G +RI+     V F KS  K I +  ++ I L       ++ +  +P
Sbjct: 122 RIEPKLSRISIAKGWERIFGAQGRVEFAKSVFKFIAISIVVAIVLKAEEAATVNALFGDP 181

Query: 182 HSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPI 241
            ++      T  +++  I +    L  LD+ W+   W   L+M+KQE+KDE KQ+ G+PI
Sbjct: 182 TAVPELVLTTAMQLVSAISIATIVLVALDLVWARFHWRQDLRMTKQELKDEFKQAEGDPI 241

Query: 242 IKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAK 301
           +K+R +SIAR R R+ M+ A  RAT++I NPTHYA+AL+Y   E+ AP ++AKGQ+LIA 
Sbjct: 242 VKSRMRSIARDRARNAMLAAVPRATLVIANPTHYAIALKYQHGEDPAPTVLAKGQDLIAL 301

Query: 302 KMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
           K+R+IA ++N+P+ E+  LAR+++    I+  IP  F++ VA++IY ++ +
Sbjct: 302 KIREIAEQNNVPVVEDRMLARAMYDAAQIDRVIPAEFFRPVAEIIYFLHSR 352


>gi|110632668|ref|YP_672876.1| flagellar biosynthesis protein FlhB [Mesorhizobium sp. BNC1]
 gi|110283652|gb|ABG61711.1| flagellar biosynthetic protein FlhB [Chelativorans sp. BNC1]
          Length = 363

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 135/350 (38%), Positives = 217/350 (62%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E    ++KTE  + KKI D + +G  P SREA + +S LA L++++FF       +  
Sbjct: 1   MAEGADKESKTEEATEKKIRDTVEKGQLPFSREAPVLASFLAILVFVVFFAEDRAVQLAG 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L + +  A    L+  +  + +   + L   ++V   +LL +  G+ + ++Q  P   L
Sbjct: 61  FLAIFIERADGWSLKTQTDAIAIYRIVFLQIGKVVGIVMLLLVAAGVSASILQNTPRFVL 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P   RVSL +G  R++    LV F KS  K+++VG ++  +L      +L  +  +
Sbjct: 121 ERIQPKLSRVSLAKGWSRLFGTRGLVEFAKSVGKMLVVGALVAFTLRHADTRLLSGMVTH 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P +        V  +LI I LF+  + V D+ WS   W   L+MS+QE+KDE KQ+ G+P
Sbjct: 181 PVAFTVTIRDLVINILIAIALFMTLVAVADLVWSRFSWRQDLRMSRQEVKDEQKQTDGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           +++ R +S+AR R R +MM A  +AT++I NPTHYA+ALRY + ++ APV+VAKGQ+L+A
Sbjct: 241 LMRARLRSVARDRARRRMMSAIPQATLVIANPTHYAIALRYQRDKDAAPVVVAKGQDLVA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
            ++R++A EHNIP+FEEP+LARS++KQV ++S IPP FYKAVA+L+ ++Y
Sbjct: 301 LRIRELAREHNIPVFEEPALARSMYKQVSVDSLIPPQFYKAVAELVRRVY 350


>gi|254505032|ref|ZP_05117183.1| flagellar biosynthetic protein FlhB [Labrenzia alexandrii DFL-11]
 gi|222441103|gb|EEE47782.1| flagellar biosynthetic protein FlhB [Labrenzia alexandrii DFL-11]
          Length = 358

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 133/357 (37%), Positives = 211/357 (59%), Gaps = 8/357 (2%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE    D+KTE P+ KKI+DA+ +GN P+S+EA + + ++  L+   F  + G+  + S
Sbjct: 1   MSEEADKDSKTEEPTEKKIQDAIEKGNTPVSKEAPVLAMLIGALLIGGFAITSGVRQLVS 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           D+  LL  +    L + +  + L   LS+     + P + +  + G+ S  +Q  P +  
Sbjct: 61  DMAHLLDVSGGLDLGNSADALMLSHSLSIKVGLFLAPIIAILSVSGLASAFLQNKPSIVP 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFI--- 177
           N +KP   ++SL++G  RI+     V F+K+  K   V  I+      +   +++ +   
Sbjct: 121 NRIKPELSKLSLKKGWSRIFGAQGFVEFLKAVFKFSTVSAIVYAQFRAHESDLINAMFTD 180

Query: 178 -SANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQS 236
            SA P  IL  +   +  V I+ +L    L  +DI WS   W   L+M+KQE+KDE KQ 
Sbjct: 181 PSALPEMILQISLRLISGVCIVTIL----LVTVDILWSRSHWRKNLRMTKQEVKDEHKQM 236

Query: 237 YGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQ 296
            G+PI+K RQ+S+AR R R++MM A  +AT+++ NPTH+A+ALRY   +N APV+VAKGQ
Sbjct: 237 EGDPIVKARQRSLARDRARNRMMSAVPQATLVVANPTHFAVALRYDGEKNPAPVVVAKGQ 296

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +LIA K+R+IA  ++IP+ E+  LARSL+    +   IPP FY+AVA++I  +Y +K
Sbjct: 297 DLIALKIREIAETNDIPVIEDRQLARSLYAATEVERMIPPEFYRAVAEIICFVYSRK 353


>gi|90422606|ref|YP_530976.1| flagellar biosynthesis protein FlhB [Rhodopseudomonas palustris
           BisB18]
 gi|90104620|gb|ABD86657.1| flagellar biosynthetic protein FlhB [Rhodopseudomonas palustris
           BisB18]
          Length = 358

 Score =  253 bits (647), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 123/353 (34%), Positives = 215/353 (60%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE    ++KTE P+ KKI D++ +G  P+SREAS+FSS++A L+ L F     + ++T+
Sbjct: 1   MSEGPDKESKTEEPTEKKIRDSVEKGKIPVSREASIFSSMIALLLILSFLAVDNVRNLTA 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  ++   +  ++   +     L  +  SA+ LV+P +++  + G+ + ++Q +P++  
Sbjct: 61  TLARMIDDPSGIRIRTAADATEFLVAVGASAAGLVLPIVIVLAVAGVLASVLQNVPLIVF 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   R+S+ +G  RI+     V F KS  K I +  ++TI L     T ++ + ++
Sbjct: 121 ERIAPDASRISIAKGWGRIFGGQGRVEFAKSVFKFIAISLVVTIVLRAEEATAVNALFSD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P ++         +++  I +    L  LD+ W+   W   L+M+KQE+KDE +Q+ G+P
Sbjct: 181 PTAVPELILAAAMRLVSAISIATIVLVALDLLWARFHWRRDLRMTKQELKDEFRQAEGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           I+K+R +SIAR R R +M+ A  RAT++I NPTHYA+AL+Y   E+ AP ++AKGQ+LIA
Sbjct: 241 IVKSRLRSIARDRARKRMLAAVPRATLVIANPTHYAIALKYQHGEDAAPTVLAKGQDLIA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA  +N+P+ E+  LARS++    I+  IP  F++ VA++IY ++ ++
Sbjct: 301 LKIREIAERNNVPVVEDRMLARSMYDAAEIDRVIPAEFFRPVAEIIYFLHSRR 353


>gi|118589950|ref|ZP_01547354.1| flagellar biosynthesis protein B [Stappia aggregata IAM 12614]
 gi|118437447|gb|EAV44084.1| flagellar biosynthesis protein B [Stappia aggregata IAM 12614]
          Length = 357

 Score =  249 bits (635), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 142/358 (39%), Positives = 210/358 (58%), Gaps = 11/358 (3%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE D  D+KTE P+ KKI DA+ +GN P+SREA + ++ +A L+   F  +     +  
Sbjct: 1   MSEEDK-DSKTEEPTEKKISDAIEKGNTPVSREAPVLATFIATLLIGSFVITSASRQLIQ 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTH-LSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLN 119
            L  LL  +    L + S    LLTH +S+     + P + L    G+ S  +Q  P + 
Sbjct: 60  MLTHLLDLSGGVDLGN-SADALLLTHAVSIEVLVFLAPIVALLAASGLASAFLQNTPSIV 118

Query: 120 LNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFI-- 177
            + +KP   ++SL +G  RI+    LV F+K+  K   V  I+      N   +++ +  
Sbjct: 119 FHRIKPDASKLSLAKGWSRIFGAQGLVEFLKAVFKFSTVSAIVYGQFRANEAELINAMFT 178

Query: 178 --SANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQ 235
             SA P +IL  +   +  V I+ +L    L  +DI WS   W   L+MSKQEIKDE KQ
Sbjct: 179 DPSALPEAILQISMKLIAGVCIVTIL----LVTVDILWSRSHWRKNLRMSKQEIKDEHKQ 234

Query: 236 SYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKG 295
             G+PI+K RQ+S+AR R R++MM A  +AT+I+ NPTH+A+ALRY   +N APV+VAKG
Sbjct: 235 MEGDPIVKARQRSLARDRARNRMMSAVPQATLIVANPTHFAVALRYDGDQNPAPVVVAKG 294

Query: 296 QNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           Q+LIA K+R+IA  +NIP+ E+  LARSL+    +   IPP FY+AVA++I  +Y ++
Sbjct: 295 QDLIALKIREIAEANNIPVIEDRQLARSLYAATEVERMIPPEFYRAVAEIICYVYSRQ 352


>gi|90418395|ref|ZP_01226307.1| flagellar biosynthetic protein FlhB [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90338067|gb|EAS51718.1| flagellar biosynthetic protein FlhB [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 362

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 126/352 (35%), Positives = 207/352 (58%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS+++   +KTE P+ KKI DA+ +GN P+SREA + +S+LA + ++      G+  +  
Sbjct: 1   MSDSEDKSSKTEFPTEKKISDAVEKGNLPVSREAPILASLLAIMAFIALQAREGVQRLLL 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L     +  Q  L+  +  + +L  L+  A   ++P   LF+  G+ S ++Q  P +N+
Sbjct: 61  SLQTTFENPLQWDLDTSADALHVLHMLAREAVWFILPAAGLFVAGGVISSVLQNPPQINI 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P +  VS   G  RI+ +  L  F K+  K I +G ++++ L  ++ TM+  + A+
Sbjct: 121 ERIRPKWSNVSPASGFTRIFGLRGLTEFGKAVFKFITIGVVVSMLLVSSFPTMMQAMFAD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P  +         K+L  I +    L   D+  +   W   L MSKQEIKDE KQ+ G+P
Sbjct: 181 PVLVPELILQMAMKLLSGISIATIVLVAADLAMTRFHWRRDLMMSKQEIKDENKQAEGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK RQ+ I R R+R +MM     AT++I NPTHYA+ALRY + E  AP++VAKG +L+A
Sbjct: 241 QIKARQRQIGRDRVRRRMMADVPLATLVIANPTHYAIALRYNREEGGAPMVVAKGADLVA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
            K+R+IA  +++P+ E+  LARS++  V I+  IPP F+KA+A++IY ++ +
Sbjct: 301 LKIREIAEANDVPVIEDKLLARSMYDHVEIDQMIPPKFFKAIAEIIYFLHSR 352


>gi|306846305|ref|ZP_07478866.1| flagellar biosynthetic protein FlhB [Brucella sp. BO1]
 gi|306273300|gb|EFM55169.1| flagellar biosynthetic protein FlhB [Brucella sp. BO1]
          Length = 356

 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 124/353 (35%), Positives = 208/353 (58%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++   ++KTE  + +KI DAL++GN P SREA + + I + L+  +F  +P    +  
Sbjct: 1   MADDADKESKTEEATEQKIRDALDKGNMPFSREAPILAGIASFLVIAVFVAAPAATRLAV 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  L+       L        L + L+L+    ++P  ++  + GI +   Q  P    
Sbjct: 61  FLRELIDRPEDWLLNSAEDATRLFSVLALAVGAALVPIFIIIPLAGIAASAFQNAPRFVG 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P   R+S  +G +RI+     V F+KS  K++    I+ +   +      D ++ +
Sbjct: 121 ERIRPQASRISPLKGWQRIFGRAGQVEFLKSLAKLLAASVIVFLVFFKGNSLFTDAVATD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P ++       V ++L+  +L IA +   D+ WS   W  +L+M++QE+KDE+KQS G+P
Sbjct: 181 PSALPEFLRKNVVRLLVANVLTIAAIAGFDLAWSRIHWRQELRMTRQEVKDELKQSEGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           ++K+R +S+ R R RH+M+ A   AT+I+ NPTH+++ALRY   E+ APV++AKGQ+LIA
Sbjct: 241 LVKSRLRSLGRDRARHRMINAVPTATLIVANPTHFSVALRYKPNEDAAPVVIAKGQDLIA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA  H+IP+FE+  LAR+L+KQV ++  I P FYKAVA+LI  I  ++
Sbjct: 301 LKIREIAVSHSIPVFEDVQLARALYKQVNVDQMIAPEFYKAVAELIRIINTRR 353


>gi|256158147|ref|ZP_05456063.1| flagellar biosynthesis protein FlhB [Brucella ceti M490/95/1]
 gi|256252902|ref|ZP_05458438.1| flagellar biosynthesis protein FlhB [Brucella ceti B1/94]
 gi|261219990|ref|ZP_05934271.1| flagellar biosynthetic protein FlhB [Brucella ceti B1/94]
 gi|265996665|ref|ZP_06109222.1| flagellar biosynthetic protein FlhB [Brucella ceti M490/95/1]
 gi|260918574|gb|EEX85227.1| flagellar biosynthetic protein FlhB [Brucella ceti B1/94]
 gi|262550962|gb|EEZ07123.1| flagellar biosynthetic protein FlhB [Brucella ceti M490/95/1]
          Length = 356

 Score =  246 bits (627), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 125/353 (35%), Positives = 207/353 (58%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++   ++KTE  + +KI DAL++GN P SREA + + I + L+  +F  +P    +  
Sbjct: 1   MADDADKESKTEEATEQKIRDALDKGNMPFSREAPILAGIASFLVIAVFVAAPAATRLAV 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  L+       L        L + L+L+    ++P  ++  + GI +   Q  P    
Sbjct: 61  FLRELIDRPEDWLLNSAEDATRLFSVLALAVGAALVPVFIIIPLAGIAASAFQNAPRFVG 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P   R+S  +G +RI+     V F+KS  K++    I+ +   +      D ++ +
Sbjct: 121 ERIRPQASRISPLKGWQRIFGRAGQVEFLKSLAKLLAASVIVFLVFFKGNSLFTDAVATD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P ++       V ++L+  +L IA +   D+ WS   W  +L+M++QE+KDE+KQS G+P
Sbjct: 181 PGALPEFLRKNVVRLLVANVLAIAAIAGFDLAWSRIHWRQELRMTRQEVKDELKQSEGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           ++K+R +S+ R R R +M+ A   AT+I+ NPTH+++ALRY   EN APV+VAKGQ+LIA
Sbjct: 241 LVKSRLRSLGRDRARRRMINAVPTATLIVANPTHFSVALRYKPNENAAPVVVAKGQDLIA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA  H+IP+FE+  LAR+L+KQV ++  I P FYKAVA+LI  I  ++
Sbjct: 301 LKIREIAASHSIPVFEDVQLARALYKQVNVDQMIAPEFYKAVAELIRIINTRR 353


>gi|254695264|ref|ZP_05157092.1| flagellar biosynthesis protein FlhB [Brucella abortus bv. 3 str.
           Tulya]
 gi|261215629|ref|ZP_05929910.1| flagellar biosynthetic protein FlhB [Brucella abortus bv. 3 str.
           Tulya]
 gi|260917236|gb|EEX84097.1| flagellar biosynthetic protein FlhB [Brucella abortus bv. 3 str.
           Tulya]
          Length = 356

 Score =  246 bits (627), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 124/353 (35%), Positives = 208/353 (58%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++   ++KTE  + +KI DAL++GN P SREA + + I + L+  +F  +P    +  
Sbjct: 1   MADDADKESKTEEATEQKIRDALDKGNMPFSREAPILAGIASFLVIAVFVAAPAATRLAV 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  L+  +    L        L + L+L+    ++P  ++  + GI +   Q  P    
Sbjct: 61  FLRELIDRSEDWLLNSAEDATRLFSVLALAVGAALVPVFIIIPLAGIAASAFQNAPRFVG 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P   R+S  +G +RI+     V F+KS  K++    I+ +   +      D ++ +
Sbjct: 121 ERIRPQASRISPLKGWQRIFGRAGQVEFLKSLAKLLAASVIVFLVFFKGNSLFTDAVATD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P ++       V ++L+  +L IA +   D+ WS   W  +L+M++QE+KDE+KQS G+P
Sbjct: 181 PGALPEFLRKNVVRLLVANVLAIAAIAGFDLAWSRIHWRQELRMTRQEVKDELKQSEGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           ++K+R +S+ R R R +M+ A   AT+I+ NPTH+++ALRY   E+ APV+VAKGQ+LIA
Sbjct: 241 LVKSRLRSLGRDRARRRMINAVPTATLIVANPTHFSVALRYKPNEDAAPVVVAKGQDLIA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA  H+IP+FE+  LAR+L+KQV ++  I P FYKAVA+LI  I  ++
Sbjct: 301 LKIREIAASHSIPVFEDVQLARALYKQVNVDQMIAPEFYKAVAELIRIINTRR 353


>gi|254711986|ref|ZP_05173797.1| flagellar biosynthesis protein FlhB [Brucella ceti M644/93/1]
 gi|254715056|ref|ZP_05176867.1| flagellar biosynthesis protein FlhB [Brucella ceti M13/05/1]
 gi|261216763|ref|ZP_05931044.1| flagellar biosynthetic protein FlhB [Brucella ceti M13/05/1]
 gi|261319630|ref|ZP_05958827.1| flagellar biosynthetic protein FlhB [Brucella ceti M644/93/1]
 gi|260921852|gb|EEX88420.1| flagellar biosynthetic protein FlhB [Brucella ceti M13/05/1]
 gi|261292320|gb|EEX95816.1| flagellar biosynthetic protein FlhB [Brucella ceti M644/93/1]
          Length = 356

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 124/353 (35%), Positives = 207/353 (58%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++   ++KTE  + +KI DAL++GN P SREA + + I + L+  +F  +P    +  
Sbjct: 1   MADDADKESKTEEATEQKIRDALDKGNMPFSREAPILAGIASFLVIAVFVAAPAATRLAV 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  L+       L        L + L+L+    ++P  ++  + GI +   Q  P    
Sbjct: 61  FLRELIDRPEDWLLNSAEDATRLFSVLALAVGAALVPVFIIIPLAGIAASAFQNAPRFVG 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P   R+S  +G +RI+     V F+KS  K++    I+ +   +      D ++ +
Sbjct: 121 ERIRPQASRISPLKGWQRIFGRAGQVGFLKSLAKLLAASVIVFLVFFKGNSLFTDAVATD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P ++       V ++L+  +L IA +   D+ WS   W  +L+M++QE+KDE+KQS G+P
Sbjct: 181 PGALPEFLRKNVVRLLVANVLAIAAIAGFDLAWSRIHWRQELRMTRQEVKDELKQSEGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           ++K+R +S+ R R R +M+ A   AT+I+ NPTH+++ALRY   E+ APV+VAKGQ+LIA
Sbjct: 241 LVKSRLRSLGRDRARRRMINAVPTATLIVANPTHFSVALRYKPNEDAAPVVVAKGQDLIA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA  H+IP+FE+  LAR+L+KQV ++  I P FYKAVA+LI  I  ++
Sbjct: 301 LKIREIAASHSIPVFEDVQLARALYKQVNVDQMIAPEFYKAVAELIRIINTRR 353


>gi|17989459|ref|NP_542092.1| flagellar biosynthesis protein FlhB [Brucella melitensis bv. 1 str.
           16M]
 gi|148558113|ref|YP_001257188.1| flagellar biosynthesis protein FlhB [Brucella ovis ATCC 25840]
 gi|163844317|ref|YP_001621972.1| flagellar biosynthesis protein FlhB [Brucella suis ATCC 23445]
 gi|225628598|ref|ZP_03786632.1| flagellar biosynthetic protein FlhB [Brucella ceti str. Cudo]
 gi|225685983|ref|YP_002733955.1| flagellar biosynthesis protein FlhB [Brucella melitensis ATCC
           23457]
 gi|254699432|ref|ZP_05161260.1| flagellar biosynthesis protein FlhB [Brucella suis bv. 5 str. 513]
 gi|254706322|ref|ZP_05168150.1| flagellar biosynthesis protein FlhB [Brucella pinnipedialis
           M163/99/10]
 gi|254711387|ref|ZP_05173198.1| flagellar biosynthesis protein FlhB [Brucella pinnipedialis B2/94]
 gi|256014911|ref|YP_003104920.1| flagellar biosynthesis protein [Brucella microti CCM 4915]
 gi|256029983|ref|ZP_05443597.1| flagellar biosynthesis protein FlhB [Brucella pinnipedialis
           M292/94/1]
 gi|256043043|ref|ZP_05445988.1| flagellar biosynthesis protein FlhB [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256059636|ref|ZP_05449833.1| flagellar biosynthesis protein FlhB [Brucella neotomae 5K33]
 gi|256111971|ref|ZP_05452922.1| flagellar biosynthesis protein FlhB [Brucella melitensis bv. 3 str.
           Ether]
 gi|256262893|ref|ZP_05465425.1| type III secretion exporter [Brucella melitensis bv. 2 str. 63/9]
 gi|260564276|ref|ZP_05834761.1| type III secretion exporter [Brucella melitensis bv. 1 str. 16M]
 gi|261313768|ref|ZP_05952965.1| flagellar biosynthetic protein FlhB [Brucella pinnipedialis
           M163/99/10]
 gi|261318993|ref|ZP_05958190.1| flagellar biosynthetic protein FlhB [Brucella pinnipedialis B2/94]
 gi|261323606|ref|ZP_05962803.1| flagellar biosynthetic protein FlhB [Brucella neotomae 5K33]
 gi|261749883|ref|ZP_05993592.1| flagellar biosynthetic protein FlhB [Brucella suis bv. 5 str. 513]
 gi|265987004|ref|ZP_06099561.1| flagellar biosynthetic protein FlhB [Brucella pinnipedialis
           M292/94/1]
 gi|265989482|ref|ZP_06102039.1| flagellar biosynthetic protein FlhB [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265993419|ref|ZP_06105976.1| flagellar biosynthetic protein FlhB [Brucella melitensis bv. 3 str.
           Ether]
 gi|17985338|gb|AAL54356.1| flagellar biosynthetic protein flhb [Brucella melitensis bv. 1 str.
           16M]
 gi|148369398|gb|ABQ62270.1| flagellar biosynthetic protein FlhB [Brucella ovis ATCC 25840]
 gi|163675040|gb|ABY39150.1| flagellar biosynthetic protein FlhB [Brucella suis ATCC 23445]
 gi|225616444|gb|EEH13492.1| flagellar biosynthetic protein FlhB [Brucella ceti str. Cudo]
 gi|225642088|gb|ACO02001.1| flagellar biosynthetic protein FlhB [Brucella melitensis ATCC
           23457]
 gi|255997571|gb|ACU49258.1| flagellar biosynthesis protein [Brucella microti CCM 4915]
 gi|260151919|gb|EEW87012.1| type III secretion exporter [Brucella melitensis bv. 1 str. 16M]
 gi|261298216|gb|EEY01713.1| flagellar biosynthetic protein FlhB [Brucella pinnipedialis B2/94]
 gi|261299586|gb|EEY03083.1| flagellar biosynthetic protein FlhB [Brucella neotomae 5K33]
 gi|261302794|gb|EEY06291.1| flagellar biosynthetic protein FlhB [Brucella pinnipedialis
           M163/99/10]
 gi|261739636|gb|EEY27562.1| flagellar biosynthetic protein FlhB [Brucella suis bv. 5 str. 513]
 gi|262764289|gb|EEZ10321.1| flagellar biosynthetic protein FlhB [Brucella melitensis bv. 3 str.
           Ether]
 gi|263000151|gb|EEZ12841.1| flagellar biosynthetic protein FlhB [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263092730|gb|EEZ16939.1| type III secretion exporter [Brucella melitensis bv. 2 str. 63/9]
 gi|264659201|gb|EEZ29462.1| flagellar biosynthetic protein FlhB [Brucella pinnipedialis
           M292/94/1]
 gi|326410307|gb|ADZ67371.1| flagellar biosynthesis protein FlhB [Brucella melitensis M28]
 gi|326553600|gb|ADZ88239.1| flagellar biosynthesis protein FlhB [Brucella melitensis M5-90]
          Length = 356

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 124/353 (35%), Positives = 207/353 (58%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++   ++KTE  + +KI DAL++GN P SREA + + I + L+  +F  +P    +  
Sbjct: 1   MADDADKESKTEEATEQKIRDALDKGNMPFSREAPILAGIASFLVIAVFVAAPAATRLAV 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  L+       L        L + L+L+    ++P  ++  + GI +   Q  P    
Sbjct: 61  FLRELIDRPEDWLLNSAEDATRLFSVLALAVGAALVPVFIIIPLAGIAASAFQNAPRFVG 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P   R+S  +G +RI+     V F+KS  K++    I+ +   +      D ++ +
Sbjct: 121 ERIRPQASRISPLKGWQRIFGRAGQVEFLKSLAKLLAASVIVFLVFFKGNSLFTDAVATD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P ++       V ++L+  +L IA +   D+ WS   W  +L+M++QE+KDE+KQS G+P
Sbjct: 181 PGALPEFLRKNVVRLLVANVLAIAAIAGFDLAWSRIHWRQELRMTRQEVKDELKQSEGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           ++K+R +S+ R R R +M+ A   AT+I+ NPTH+++ALRY   E+ APV+VAKGQ+LIA
Sbjct: 241 LVKSRLRSLGRDRARRRMINAVPTATLIVANPTHFSVALRYKPNEDAAPVVVAKGQDLIA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA  H+IP+FE+  LAR+L+KQV ++  I P FYKAVA+LI  I  ++
Sbjct: 301 LKIREIAASHSIPVFEDVQLARALYKQVNVDQMIAPEFYKAVAELIRIINTRR 353


>gi|256256624|ref|ZP_05462160.1| flagellar biosynthesis protein FlhB [Brucella abortus bv. 9 str.
           C68]
 gi|260882866|ref|ZP_05894480.1| flagellar biosynthetic protein FlhB [Brucella abortus bv. 9 str.
           C68]
 gi|297249980|ref|ZP_06933681.1| flagellar biosynthetic protein FlhB [Brucella abortus bv. 5 str.
           B3196]
 gi|260872394|gb|EEX79463.1| flagellar biosynthetic protein FlhB [Brucella abortus bv. 9 str.
           C68]
 gi|297173849|gb|EFH33213.1| flagellar biosynthetic protein FlhB [Brucella abortus bv. 5 str.
           B3196]
          Length = 356

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 124/353 (35%), Positives = 207/353 (58%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++   ++KTE  + +KI DAL++GN P SREA + + I + L+  +F  +P    +  
Sbjct: 1   MADDADKESKTEEATEQKIRDALDKGNMPFSREAPILAGIASFLVIAVFVAAPAATRLAV 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  L+       L        L + L+L+    ++P  ++  + GI +   Q  P    
Sbjct: 61  FLRELIDRPEDWLLNSAEDATRLFSVLALAVGAALVPVFIIIPLAGIAASAFQNAPRFVG 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P   R+S  +G +RI+     V F+KS  K++    I+ +   +      D ++ +
Sbjct: 121 ERIRPQASRISPLKGWQRIFGRAGQVEFLKSLAKLLAASVIVFLVFFKGDSLFTDAVATD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P ++       V ++L+  +L IA +   D+ WS   W  +L+M++QE+KDE+KQS G+P
Sbjct: 181 PGALPEFLRKNVVRLLVANVLAIAAIAGFDLAWSRIHWRQELRMTRQEVKDELKQSEGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           ++K+R +S+ R R R +M+ A   AT+I+ NPTH+++ALRY   E+ APV+VAKGQ+LIA
Sbjct: 241 LVKSRLRSLGRDRARRRMINAVPTATLIVANPTHFSVALRYKPNEDAAPVVVAKGQDLIA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA  H+IP+FE+  LAR+L+KQV ++  I P FYKAVA+LI  I  ++
Sbjct: 301 LKIREIAASHSIPVFEDVQLARALYKQVNVDQMIAPEFYKAVAELIRIINTRR 353


>gi|294853145|ref|ZP_06793817.1| flagellar biosynthetic protein FlhB [Brucella sp. NVSL 07-0026]
 gi|294818800|gb|EFG35800.1| flagellar biosynthetic protein FlhB [Brucella sp. NVSL 07-0026]
          Length = 356

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 124/353 (35%), Positives = 207/353 (58%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++   ++KTE  + +KI DAL++GN P SREA + + I + L+  +F  +P    +  
Sbjct: 1   MADDADKESKTEEATEQKIRDALDKGNMPFSREAPILAGIASFLVIAVFVAAPAATRLAV 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  L+       L        L + L+L+    ++P  ++  + GI +   Q  P    
Sbjct: 61  FLRELIDRPEDWLLNSAEDATRLFSVLALAVGAALVPVFIIIPLAGIAASAFQNAPRFVG 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P   R+S  +G +RI+     V F+KS  K++    I+ +   +      D ++ +
Sbjct: 121 ERIRPQASRISPLKGWQRIFGRAGQVEFLKSLAKLLAASVIVFLVFFKGNSLFTDAVATD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P ++       V ++L+  +L IA +   D+ WS   W  +L+M++QE+KDE+KQS G+P
Sbjct: 181 PGALPEFLRKNVVRLLVANVLAIAAIADFDLAWSRIHWRQELRMTRQEVKDELKQSEGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           ++K+R +S+ R R R +M+ A   AT+I+ NPTH+++ALRY   E+ APV+VAKGQ+LIA
Sbjct: 241 LVKSRLRSLGRDRARRRMINAVPTATLIVANPTHFSVALRYKPNEDAAPVVVAKGQDLIA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA  H+IP+FE+  LAR+L+KQV ++  I P FYKAVA+LI  I  ++
Sbjct: 301 LKIREIAASHSIPVFEDVQLARALYKQVNVDQMIAPEFYKAVAELIRIINTRR 353


>gi|114706765|ref|ZP_01439665.1| flagellar biosynthesis protein B [Fulvimarina pelagi HTCC2506]
 gi|114537713|gb|EAU40837.1| flagellar biosynthesis protein B [Fulvimarina pelagi HTCC2506]
          Length = 362

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 127/353 (35%), Positives = 203/353 (57%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E++    KTE P+ KKI D + +GN P SREA + +S LA  +++        Y + +
Sbjct: 1   MAESEDRSQKTEQPTEKKIRDTIEKGNLPNSREAPVLASFLAISLFIALQARESGYRLLT 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L     +  Q +LE     + +L+ LS  A+  ++P  +   + GI + ++Q  P +N 
Sbjct: 61  TLQTTFDNPLQWELETSRDALHVLSVLSTEAAIFLVPVAIFLCIGGILASVLQNPPQVNF 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +KP    +S   G+KRI+    L  F K+  K +++G ++   +  N  TM+  + A+
Sbjct: 121 ERIKPKASNISPASGLKRIFGPRGLTEFAKAVFKFLMIGVVVGTLIVSNLGTMIQTMLAD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P  +         K+L  + +    L   DI  +   W   + MSKQEIKDE KQ+ G+P
Sbjct: 181 PVQVPELVLDLAMKLLSGVSIATIVLVAADIAMTRIHWRRDIMMSKQEIKDEHKQTDGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           ++K RQK IAR R R +M+ A   AT++I NPTHYA+ALRY + E  AP++VAKG +L+A
Sbjct: 241 MVKQRQKQIARERSRKRMIAAVPNATLVIANPTHYAIALRYKREEGGAPMVVAKGTDLVA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++A E  IP+ E+  LARS++  V I+  IPP F+KAVA++IY ++ ++
Sbjct: 301 LKIREVAEEKEIPVIEDKLLARSMYDHVHIDQMIPPEFFKAVAEIIYYLHTRE 353


>gi|23499885|ref|NP_699325.1| flagellar biosynthesis protein FlhB [Brucella suis 1330]
 gi|161620208|ref|YP_001594094.1| flagellar biosynthesis protein FlhB [Brucella canis ATCC 23365]
 gi|254702550|ref|ZP_05164378.1| flagellar biosynthesis protein FlhB [Brucella suis bv. 3 str. 686]
 gi|260568543|ref|ZP_05839012.1| type III secretion exporter [Brucella suis bv. 4 str. 40]
 gi|261753127|ref|ZP_05996836.1| flagellar biosynthetic protein FlhB [Brucella suis bv. 3 str. 686]
 gi|23463460|gb|AAN33330.1| flagellar biosynthetic protein FlhB [Brucella suis 1330]
 gi|161337019|gb|ABX63323.1| flagellar biosynthetic protein FlhB [Brucella canis ATCC 23365]
 gi|260155208|gb|EEW90289.1| type III secretion exporter [Brucella suis bv. 4 str. 40]
 gi|261742880|gb|EEY30806.1| flagellar biosynthetic protein FlhB [Brucella suis bv. 3 str. 686]
          Length = 356

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 124/353 (35%), Positives = 207/353 (58%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++   ++KTE  + +KI DAL++GN P SREA + + I + L+  +F  +P    +  
Sbjct: 1   MADDADKESKTEEATEQKIRDALDKGNMPFSREAPILAGIASFLVIAVFVAAPAATRLAV 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  L+       L        L + L+L+    ++P  ++  + GI +   Q  P    
Sbjct: 61  FLRELIDRPEDWLLNSAEDATRLFSVLALAVGAALVPVFIIIPLAGIAASAFQNAPRFVG 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P   R+S  +G +RI+     V F+KS  K++    I+ +   +      D ++ +
Sbjct: 121 ERIRPQASRISPLKGWQRIFGRAGQVEFLKSLAKLLAASVIVFLVFFKGNSLFTDAVATD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P ++       V ++L+  +L IA +   D+ WS   W  +L+M++QE+KDE+KQS G+P
Sbjct: 181 PGALPEFLRKNVVRLLVANVLAIAAIAGFDLAWSRIHWRQELRMTRQEVKDELKQSEGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           ++K+R +S+ R R R +M+ A   AT+I+ NPTH+++ALRY   E+ APV+VAKGQ+LIA
Sbjct: 241 LVKSRLRSLGRDRARRRMINAVPTATLIVANPTHFSVALRYKPNEDAAPVVVAKGQDLIA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA  H+IP+FE+  LAR+L+KQV ++  I P FYKAVA+LI  I  ++
Sbjct: 301 LKIREIAASHSIPVFEDVQLARALYKQVNVDHMIAPEFYKAVAELIRIINTRR 353


>gi|296447442|ref|ZP_06889367.1| flagellar biosynthetic protein FlhB [Methylosinus trichosporium
           OB3b]
 gi|296255062|gb|EFH02164.1| flagellar biosynthetic protein FlhB [Methylosinus trichosporium
           OB3b]
          Length = 358

 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 124/353 (35%), Positives = 210/353 (59%), Gaps = 12/353 (3%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISRE---ASLFSSILACLIYLLFFFSPGIYS 57
           MSE++  D++TE  S KKI DAL +G  P++R+   A LF   L C+ +++    P    
Sbjct: 1   MSESEDDDSRTEEASEKKILDALEQGKTPVARDVAVAVLFLGFLLCVSFVIETVGP---R 57

Query: 58  VTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPV 117
           +   + ++L++  Q  L + +        ++    R + P L +FM+ G+ S  +Q  P 
Sbjct: 58  LALSMELMLSNVGQFSLANGADAFMQSRAVAEEIGRFLAPMLSIFMITGLLSAAMQGAPR 117

Query: 118 LNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFI 177
           L    ++P   R+S ++G+KRI+ +  +V  +KS  KI ++G  +  SLT +   ++D +
Sbjct: 118 LVFKRIEPDLSRISPQQGLKRIFGVTGVVELVKSIAKIAVIGGAVVFSLTVDRDLIIDAM 177

Query: 178 SANPH---SILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIK 234
              P    S+L      +  V+ + ++ IA   + D+ WS  +W   ++MS+QE+K+E K
Sbjct: 178 RMEPAHLPSLLLKLIIRLTSVVCIPVVLIA---LADLAWSKFKWRRDMRMSRQEMKEEHK 234

Query: 235 QSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAK 294
           QS G+P++K R +S+A  R R +MM    +AT++I NPTHYA+ALRY++TE  AP +VAK
Sbjct: 235 QSEGDPLVKARMRSLALERSRKRMMAQVPQATMVIANPTHYAIALRYVRTEGGAPTVVAK 294

Query: 295 GQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIY 347
           G++L+A K+R+IA  H +P+ E P LAR+++  V ++  IP  FY+ VA+LI+
Sbjct: 295 GKDLVALKIREIAEAHGVPVLERPELARAMYNHVEVDQMIPSEFYRPVAELIH 347


>gi|182679720|ref|YP_001833866.1| flagellar biosynthesis protein FlhB [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182635603|gb|ACB96377.1| flagellar biosynthetic protein FlhB [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 360

 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 132/353 (37%), Positives = 210/353 (59%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E    D++TE P++KK++DA+ +GN PISRE  +F+S+L+ LI   F     +  + +
Sbjct: 1   MAEKPDQDSQTEEPTAKKMDDAIEQGNLPISREMIIFASMLSLLIVNAFILRNSLADIVT 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  +  ++ Q  L +    V L   +       ++P +L FM+ GI + + Q    L L
Sbjct: 61  LLKYVFNNSDQIPLRNQLDAVNLFQLILTETGPRLVPIILPFMIAGIAANIGQSKLRLIL 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F  +SL  G K+++   NL  F+K+ +K+  V  ++ + L  N   +++ +  +
Sbjct: 121 ERIQPDFGHLSLISGWKKLFGQKNLAEFLKNVIKLSAVALLLFMVLKGNQDKLINAMFLD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P +I         ++L +I +    L   D+ W  +QW   L+MSKQEIKDE+KQ  G+P
Sbjct: 181 PSAIPELILSLSMRLLSVICIVTIVLATADLLWVKNQWRRDLRMSKQEIKDELKQMEGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           +IK R +S+A  RIR  M+    +AT++I NPTH+A+ALRY++ E   PV+VAKG +LIA
Sbjct: 241 LIKARLRSVALDRIRKSMIADVPKATVVIANPTHFAVALRYVREEGGTPVVVAKGTDLIA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA  HNIPI E+  LARSL   V +N AIP  FY+A+A++I+ +  KK
Sbjct: 301 LKIREIAEAHNIPIVEDRPLARSLHASVEVNQAIPAEFYRAIAEIIHYLNTKK 353


>gi|170741402|ref|YP_001770057.1| flagellar biosynthesis protein FlhB [Methylobacterium sp. 4-46]
 gi|168195676|gb|ACA17623.1| flagellar biosynthetic protein FlhB [Methylobacterium sp. 4-46]
          Length = 354

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 121/356 (33%), Positives = 212/356 (59%), Gaps = 8/356 (2%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++    ++KTE+P+ +++ +A+ +G+ P+SREAS+ +S++  LI L  F      ++  
Sbjct: 1   MADETDQESKTESPTERRVREAIEKGDVPVSREASVLASVIGLLIALTLFVRGQAATLAR 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           +   L+       LE+      LL  ++++A R ++P L +  + G+ + ++Q +P    
Sbjct: 61  EFVPLIDQPRGFTLENARDATLLLQSVAIAAGRFLLPVLAILAVCGLAASMLQNLPRFVG 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + ++P + RVS   G  RI+  +  V F+KS  K + +  +  + L      +L+ ++ +
Sbjct: 121 DRIQPKWSRVSPASGWSRIFGRSGQVEFLKSLFKFLTITVVSLLLLRSERHKVLNAMTVD 180

Query: 181 PHS----ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQS 236
           P      IL  A   V  V I  ++ +A     D+ W+  +W   L+MS+QE KDE KQ 
Sbjct: 181 PSQVPELILSMAIRLVSAVSIATIVLVAA----DLIWARLRWQRSLRMSRQETKDEHKQI 236

Query: 237 YGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQ 296
            G+P++K R +S+A+ R R +M+ A  RAT++I NPTH+A+ALRY + EN AP++VAKGQ
Sbjct: 237 EGDPLVKARLRSLAQDRTRKRMLAAVPRATVVIANPTHFAVALRYERDENPAPLVVAKGQ 296

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
           +LIA K+R+IA  + IP+ E+  LARSL+  V ++  IP  FY+AVAQ+++ ++ +
Sbjct: 297 DLIALKIREIAEANGIPVIEDKPLARSLYDSVQVDQLIPAEFYRAVAQILFYVFAR 352


>gi|62317075|ref|YP_222928.1| flagellar biosynthesis protein FlhB [Brucella abortus bv. 1 str.
           9-941]
 gi|83269068|ref|YP_418359.1| flagellar biosynthesis protein FlhB [Brucella melitensis biovar
           Abortus 2308]
 gi|189022341|ref|YP_001932082.1| flagellar biosynthesis protein FlhB [Brucella abortus S19]
 gi|237816636|ref|ZP_04595628.1| flagellar biosynthetic protein FlhB [Brucella abortus str. 2308 A]
 gi|254698362|ref|ZP_05160190.1| flagellar biosynthesis protein FlhB [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254731807|ref|ZP_05190385.1| flagellar biosynthesis protein FlhB [Brucella abortus bv. 4 str.
           292]
 gi|260544314|ref|ZP_05820135.1| type III secretion exporter [Brucella abortus NCTC 8038]
 gi|260759573|ref|ZP_05871921.1| flagellar biosynthetic protein FlhB [Brucella abortus bv. 4 str.
           292]
 gi|260762817|ref|ZP_05875149.1| flagellar biosynthetic protein FlhB [Brucella abortus bv. 2 str.
           86/8/59]
 gi|62197268|gb|AAX75567.1| flagellar biosynthetic protein FlhB [Brucella abortus bv. 1 str.
           9-941]
 gi|82939342|emb|CAJ12286.1| Type III secretion exporter:Flagellar biosynthetic protein FlhB
           [Brucella melitensis biovar Abortus 2308]
 gi|189020915|gb|ACD73636.1| Type III secretion exporter [Brucella abortus S19]
 gi|237787449|gb|EEP61665.1| flagellar biosynthetic protein FlhB [Brucella abortus str. 2308 A]
 gi|260097585|gb|EEW81459.1| type III secretion exporter [Brucella abortus NCTC 8038]
 gi|260669891|gb|EEX56831.1| flagellar biosynthetic protein FlhB [Brucella abortus bv. 4 str.
           292]
 gi|260673238|gb|EEX60059.1| flagellar biosynthetic protein FlhB [Brucella abortus bv. 2 str.
           86/8/59]
          Length = 356

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 123/353 (34%), Positives = 206/353 (58%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++   ++KTE  + +KI DA ++GN P SREA + + I + L+  +F  +P    +  
Sbjct: 1   MADDADKESKTEEATEQKIRDAQDKGNMPFSREAPILAGIASFLVIAVFVAAPAATRLAV 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  L+       L        L + L+L+    ++P  ++  + GI +   Q  P    
Sbjct: 61  FLRELIDRPEDWLLNSAEDATRLFSVLALAVGAALVPVFIIIPLAGIAASAFQNAPRFVG 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P   R+S  +G +RI+     V F+KS  K++    I+ +   +      D ++ +
Sbjct: 121 ERIRPQASRISPLKGWQRIFGRAGQVEFLKSLAKLLAASVIVFLVFFKGDSLFTDAVATD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P ++       V ++L+  +L IA +   D+ WS   W  +L+M++QE+KDE+KQS G+P
Sbjct: 181 PGALPEFLRKNVVRLLVANVLAIAAIAGFDLAWSRIHWRQELRMTRQEVKDELKQSEGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           ++K+R +S+ R R R +M+ A   AT+I+ NPTH+++ALRY   E+ APV+VAKGQ+LIA
Sbjct: 241 LVKSRLRSLGRDRARRRMINAVPTATLIVANPTHFSVALRYKPNEDAAPVVVAKGQDLIA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA  H+IP+FE+  LAR+L+KQV ++  I P FYKAVA+LI  I  ++
Sbjct: 301 LKIREIAASHSIPVFEDVQLARALYKQVNVDQMIAPEFYKAVAELIRIINTRR 353


>gi|170748134|ref|YP_001754394.1| flagellar biosynthesis protein FlhB [Methylobacterium radiotolerans
           JCM 2831]
 gi|170654656|gb|ACB23711.1| flagellar biosynthetic protein FlhB [Methylobacterium radiotolerans
           JCM 2831]
          Length = 353

 Score =  241 bits (616), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 127/355 (35%), Positives = 214/355 (60%), Gaps = 6/355 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE+   ++KTEA S KKI DA+ EGN P SREA +F+SIL  LI+L+F           
Sbjct: 1   MSEDR--ESKTEAASEKKISDAIAEGNTPFSREAPVFASILGLLIFLVFVARDQGLPFVQ 58

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L ++L       +E     + L+  L+L   R ++P L++ +  GI + + Q  P + +
Sbjct: 59  RLALILEQPRNFSVETRHDAMRLVHALALEMGRFLLPVLIILLAAGITASIFQNAPRVVI 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + ++P + R+S   G  R++S+   + F KS  K   +G +  + L  +   +++ +  +
Sbjct: 119 DRIQPKWSRISPVTGWNRLFSLQGFIEFGKSLFKFFAIGGMSYMVLHADRHEIVNVMFVD 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVL--DIGWSYHQWYSKLKMSKQEIKDEIKQSYG 238
           P  +    F     V ++  + +AT+ ++  D+ W+  +W   L+MS+QE+KDE KQ  G
Sbjct: 179 PVGL--PEFLLTLSVRLVSAVSVATIALVAGDLVWTRLRWQRDLRMSRQEVKDEFKQLEG 236

Query: 239 NPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL 298
           +P++K + +S+A+ R+R +MM A  RAT+I+ NPTHYA+ALRY Q+ENDAP+++AKG +L
Sbjct: 237 DPLVKAKMRSLAQDRLRKQMMAAVPRATMILANPTHYAIALRYDQSENDAPMVLAKGADL 296

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           IA ++R++A +H I +  + +L R+++  V IN AIP  FY+AVA L+  +  +K
Sbjct: 297 IALRIRELAEKHRIEVVVDKALTRAMYDHVEINQAIPAEFYRAVANLLVYVMTRK 351


>gi|254559224|ref|YP_003066319.1| flagellar biosynthetic protein flhB [Methylobacterium extorquens
           DM4]
 gi|254266502|emb|CAX22266.1| Flagellar biosynthetic protein flhB [Methylobacterium extorquens
           DM4]
          Length = 353

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 129/353 (36%), Positives = 204/353 (57%), Gaps = 8/353 (2%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  ++KTEA + +++ DA+ +G+ P SREA +F+S L  LI L  F       +  D  
Sbjct: 3   DDDKESKTEAATERRVRDAIEKGDIPFSREAPVFASTLGLLIALALFARGQAAQLAGDFA 62

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
            LL       LE     + LL+ ++L+A R ++P LL+  +  + + L+Q +P   L+ +
Sbjct: 63  PLLDDPRGFSLESSGDAMLLLSRVALAAGRFLLPILLILAVCSLSASLLQNLPRFVLDRI 122

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISL----TENYFTMLDFISA 179
            P + RVS   G  RI+  +  V F+KS VK + V  +  + L    T     M    S 
Sbjct: 123 TPKWSRVSPMAGFARIFGTSGQVEFLKSLVKFLSVSVVALLLLRSERTRAVNAMFVDPSQ 182

Query: 180 NPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
            P  IL  A   V  V I  ++ +A     D+ W+  +W   L+MS Q+IKDE KQ+ G+
Sbjct: 183 LPELILTVAIRLVSAVAIATIVIVAG----DLVWARLRWQRSLRMSHQDIKDEHKQTEGD 238

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLI 299
           P +K R +S+A+ R R++M+    RAT++I NPTH+A+ALRY  +EN AP+++AKGQ+LI
Sbjct: 239 PSVKARLRSLAQDRARNRMLANVDRATVVIANPTHFAVALRYEPSENPAPLVIAKGQDLI 298

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
           A ++R IA E  I + E+  LARSL+  V ++  IP  FY+AVAQ+++ ++ +
Sbjct: 299 ALRIRAIAEEKGIAVIEDKPLARSLYDAVQVDQTIPAEFYRAVAQILFFLFAR 351


>gi|218528682|ref|YP_002419498.1| flagellar biosynthesis protein FlhB [Methylobacterium
           chloromethanicum CM4]
 gi|240137212|ref|YP_002961681.1| Flagellar biosynthetic protein flhB [Methylobacterium extorquens
           AM1]
 gi|218520985|gb|ACK81570.1| flagellar biosynthetic protein FlhB [Methylobacterium
           chloromethanicum CM4]
 gi|240007178|gb|ACS38404.1| Flagellar biosynthetic protein flhB [Methylobacterium extorquens
           AM1]
          Length = 353

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 129/353 (36%), Positives = 204/353 (57%), Gaps = 8/353 (2%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  ++KTEA + +++ DA+ +G+ P SREA +F+S L  LI L  F       +  D  
Sbjct: 3   DDDKESKTEAATERRVRDAIEKGDIPFSREAPVFASTLGLLIALALFARGQAAQLAGDFA 62

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
            LL       LE     + LL+ ++L+A R ++P LL+  +  + + L+Q +P   L+ +
Sbjct: 63  PLLDDPRGFSLESGGDAMLLLSRVALAAGRFLLPILLILAVCSLSASLLQNLPRFVLDRI 122

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISL----TENYFTMLDFISA 179
            P + RVS   G  RI+  +  V F+KS VK + V  +  + L    T     M    S 
Sbjct: 123 TPKWSRVSPMAGFARIFGTSGQVEFLKSLVKFLSVSVVALLLLRSERTRAVNAMFVDPSQ 182

Query: 180 NPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
            P  IL  A   V  V I  ++ +A     D+ W+  +W   L+MS Q+IKDE KQ+ G+
Sbjct: 183 LPELILTVAIRLVSAVAIATIVIVAG----DLVWARLRWQRSLRMSHQDIKDEHKQTEGD 238

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLI 299
           P +K R +S+A+ R R++M+    RAT++I NPTH+A+ALRY  +EN AP+++AKGQ+LI
Sbjct: 239 PSVKARLRSLAQDRARNRMLANVDRATVVIANPTHFAVALRYEPSENPAPLVIAKGQDLI 298

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
           A ++R IA E  I + E+  LARSL+  V ++  IP  FY+AVAQ+++ ++ +
Sbjct: 299 ALRIRAIAEEKGIAVIEDKPLARSLYDAVQVDQTIPAEFYRAVAQILFFLFAR 351


>gi|163850079|ref|YP_001638122.1| flagellar biosynthesis protein FlhB [Methylobacterium extorquens
           PA1]
 gi|163661684|gb|ABY29051.1| flagellar biosynthetic protein FlhB [Methylobacterium extorquens
           PA1]
          Length = 353

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 129/353 (36%), Positives = 204/353 (57%), Gaps = 8/353 (2%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  ++KTEA + +++ DA+ +G+ P SREA +F+S L  LI L  F       +  D  
Sbjct: 3   DDDKESKTEAATERRVRDAIEKGDIPFSREAPVFASTLGLLIALALFARGQAAQLAGDFA 62

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
            LL       LE     + LL+ ++L+A R ++P LL+  +  + + L+Q +P   L+ +
Sbjct: 63  PLLDDPRGFSLESGGDAMLLLSRVALAAGRFLLPILLILAVCSLSASLLQNLPRFVLDRI 122

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISL----TENYFTMLDFISA 179
            P + RVS   G  RI+  +  V F+KS VK + V  +  + L    T     M    S 
Sbjct: 123 TPKWSRVSPMAGFTRIFGTSGQVEFLKSLVKFLSVSVVALLLLRSERTRAVNAMFVDPSQ 182

Query: 180 NPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
            P  IL  A   V  V I  ++ +A     D+ W+  +W   L+MS Q+IKDE KQ+ G+
Sbjct: 183 LPELILTVAIRLVSAVAIATIVIVAG----DLVWARLRWQRSLRMSHQDIKDEHKQTEGD 238

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLI 299
           P +K R +S+A+ R R++M+    RAT++I NPTH+A+ALRY  +EN AP+++AKGQ+LI
Sbjct: 239 PSVKARLRSLAQDRARNRMLANVDRATVVIANPTHFAVALRYEPSENPAPLVIAKGQDLI 298

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
           A ++R IA E  I + E+  LARSL+  V ++  IP  FY+AVAQ+++ ++ +
Sbjct: 299 ALRIRAIAEEKGIAVIEDKPLARSLYDAVQVDQTIPAEFYRAVAQILFFLFAR 351


>gi|188579884|ref|YP_001923329.1| flagellar biosynthesis protein FlhB [Methylobacterium populi BJ001]
 gi|179343382|gb|ACB78794.1| flagellar biosynthetic protein FlhB [Methylobacterium populi BJ001]
          Length = 354

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 126/354 (35%), Positives = 213/354 (60%), Gaps = 4/354 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E    ++KTEA + +++ +A+ +G+ P SREA +F+S L  LI L  F       +  
Sbjct: 1   MAEETDHESKTEAATERRVREAIEKGDIPFSREAPVFASTLGLLIALALFARGQASQLAR 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           D   LL       LE     + LL+ ++L+A R ++P LL+  +  + + L+Q +P   L
Sbjct: 61  DFAPLLDDPRGFALETGGDAMLLLSRVALAAGRFLLPILLILAVCSLTASLLQNLPRFVL 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + ++P + RVS   G+ RI+  +  V F+KS VK + V  +  + L       ++ +  +
Sbjct: 121 DRIQPKWSRVSPMAGLSRIFGTSGQVEFLKSLVKFLSVSVVALLLLRSERTRAVNAMFVD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVL--DIGWSYHQWYSKLKMSKQEIKDEIKQSYG 238
           P S L     TV  + ++  + IAT+ ++  D+ W+  +W   L+MS+Q+IKDE KQ+ G
Sbjct: 181 P-SQLPELILTV-SIRLVSAVAIATIVIVAGDLVWARLRWQRSLRMSRQDIKDEHKQTEG 238

Query: 239 NPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL 298
           +P +K R +S+A+ R R++M+    RAT++I NPTH+A+ALRY  +EN AP+++AKGQ+L
Sbjct: 239 DPSVKARLRSLAQDRARNRMLANVDRATVVIANPTHFAVALRYEPSENPAPLVLAKGQDL 298

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
           IA ++R IA E  I + E+  LARSL+  V ++  IP  FY+AVAQ+++ ++ +
Sbjct: 299 IALRIRAIAEEKGIAVIEDKPLARSLYDAVQVDQTIPAEFYRAVAQILFFLFAR 352


>gi|254473324|ref|ZP_05086721.1| flagellar biosynthetic protein FlhB [Pseudovibrio sp. JE062]
 gi|211957440|gb|EEA92643.1| flagellar biosynthetic protein FlhB [Pseudovibrio sp. JE062]
          Length = 353

 Score =  238 bits (608), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 121/353 (34%), Positives = 207/353 (58%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE+  PD+KT+ P+ KK+ DAL +GN P+S+EAS+ +S+L  L+ L F        +  
Sbjct: 1   MSEDQDPDSKTQEPTEKKVRDALEKGNIPVSKEASVLASMLGLLLILSFIAVDKAQGLVQ 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L +  +      +  + L++ ++      + P + L + FG+ S  +Q  P L L
Sbjct: 61  FLKWFLDNPGEISFVSAAEPLQLMSAVAFELVWFLGPIVALLIFFGLASSFMQNTPRLVL 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + ++P   ++SL++G  R++S+N  + F+KS  K++ V  +  + L       L  + ++
Sbjct: 121 DRIEPKLSKISLKKGFGRLFSVNGAMEFIKSLFKLVTVIVVAALVLKSQQAVALTSMYSD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P  +          +L  I +    L   D+  +  QW   L+MS QE+KDE KQ+ G+P
Sbjct: 181 PTQLPQLILSVAMTLLSGICVATIFLVGFDLVLARFQWRKNLRMSHQELKDEFKQAEGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           +IK R +S+AR R R +MM +   AT+++ NPTH+A+AL Y +  + AP +VAKGQ++IA
Sbjct: 241 LIKARLRSLARDRARKRMMSSVQDATVVVANPTHFAVALYYERDGDQAPRVVAKGQDIIA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K++++AY H++P+ E+  LARSL+  V I+ +IP  +Y+AVA++I  +Y K+
Sbjct: 301 LKIKELAYIHDVPVVEDRQLARSLYAAVEIDQSIPEEYYRAVAEIISYVYLKR 353


>gi|239834455|ref|ZP_04682783.1| flagellar biosynthetic protein FlhB [Ochrobactrum intermedium LMG
           3301]
 gi|239822518|gb|EEQ94087.1| flagellar biosynthetic protein FlhB [Ochrobactrum intermedium LMG
           3301]
          Length = 356

 Score =  235 bits (600), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 121/349 (34%), Positives = 200/349 (57%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++   ++KTE  + +KI DAL +GN P SRE  + + I + LI  +F   P    +  
Sbjct: 1   MADDADKESKTEEATEQKIRDALEKGNMPFSRETPILAGIASFLIIAVFVAGPATTKLAV 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  L+       L        L   L+L+    ++P  ++  + GI +   Q  P    
Sbjct: 61  FLRELIDRPEDWLLNSAEDASRLFGVLALAVGAALVPVFIIIPLAGIAASAFQNAPRFVG 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P   R+S  +G +RI+  +  V F+KS  K +    I+ +          D ++++
Sbjct: 121 ERIRPQASRISPLKGWQRIFGRSGQVEFLKSLAKFLAASVIVFVVFFSGNSLFTDAVASD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P ++       + ++L+  +L I  +   D+ WS   W  +L+M++QE+KDE+KQS G+P
Sbjct: 181 PSALPEFLRENMVRLLVANVLAITAIAGFDLAWSRIHWRQELRMTRQEVKDELKQSEGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           ++K+R +S+ R R R +M+     AT+I+ NPTH+++ALRY   ++ APV+VAKGQ+LIA
Sbjct: 241 LVKSRLRSLGRDRARRRMINTVPTATLIVANPTHFSVALRYKPDQDAAPVVVAKGQDLIA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKI 349
            K+R+IA +H+IPIFE+  LAR+L+KQV ++  I P FYKAVA+LI  I
Sbjct: 301 LKIREIAAQHSIPIFEDVPLARALYKQVNVDQMIAPEFYKAVAELIRVI 349


>gi|153011537|ref|YP_001372751.1| flagellar biosynthesis protein FlhB [Ochrobactrum anthropi ATCC
           49188]
 gi|151563425|gb|ABS16922.1| flagellar biosynthetic protein FlhB [Ochrobactrum anthropi ATCC
           49188]
          Length = 356

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 125/356 (35%), Positives = 203/356 (57%), Gaps = 14/356 (3%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++   ++KTE  + +KI DAL +GN P SRE  + + I + LI  +F   P     T+
Sbjct: 1   MADDADKESKTEEATEQKIRDALEKGNMPFSRETPILAGIASFLIIAVFVAGPA----TT 56

Query: 61  DLHVLLASATQR-------KLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQ 113
            L V L     R         ED S    L   L+L+    ++P  ++  + GI +   Q
Sbjct: 57  KLAVFLRELIDRPEDWLLNSAEDASR---LFGVLALAVGAALVPVFIIIPLAGIAASAFQ 113

Query: 114 RIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTM 173
             P      ++P   R+S  +G +RI+     V F+KS  K +    I+ +         
Sbjct: 114 NAPRFVGERIRPQASRISPLKGWQRIFGRAGQVEFLKSLAKFLAASVIVFVVFFNGNSLF 173

Query: 174 LDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEI 233
            D ++++P ++       + ++L+  +L I  +   D+ WS   W  +L+M++QE+KDE+
Sbjct: 174 TDAVASDPSALPEFLRENMVRLLVANVLAITAIAAFDLAWSRIHWRQELRMTRQEVKDEL 233

Query: 234 KQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVA 293
           KQS G+P++K+R +S+ R R R +M+     AT+I+ NPTH+++ALRY   ++ AP++VA
Sbjct: 234 KQSEGDPLVKSRLRSLGRDRARRRMINTVPTATLIVANPTHFSVALRYKPDQDAAPIVVA 293

Query: 294 KGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKI 349
           KGQ+LIA K+R+IA +H+IPIFE+  LAR+L+KQV ++  I P FYKAVA+LI  I
Sbjct: 294 KGQDLIALKIREIAAQHSIPIFEDVPLARALYKQVNVDQMIAPEFYKAVAELIRVI 349


>gi|328545474|ref|YP_004305583.1| flagellar biosynthetic protein FlhB [polymorphum gilvum
           SL003B-26A1]
 gi|326415215|gb|ADZ72278.1| Flagellar biosynthetic protein FlhB [Polymorphum gilvum
           SL003B-26A1]
          Length = 358

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 132/358 (36%), Positives = 212/358 (59%), Gaps = 8/358 (2%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS+    + KTE P+ KKI DA+ +GN P S+EAS+ ++ LA L+   F    G   + S
Sbjct: 1   MSDQPDKETKTEEPTEKKIRDAIEKGNTPTSKEASVLATFLAILLIGSFATVTGARRLVS 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  L+  A    L + +  + L   L+L A R + P +    + G+ +   Q  P +  
Sbjct: 61  GLSGLIDDAGGFTLGNGADALLLTHALALEAGRFLAPIVATLAVAGLAAAWFQNAPRIVG 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFI--- 177
           + +KP   R+SL +G +R++ I   V F K+ +K   +  I  + L  N   +++ +   
Sbjct: 121 HRIKPDPSRLSLLKGWQRLFGIQGAVEFGKALLKFGAISLIALLLLRANEAGLVNAMFSD 180

Query: 178 -SANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQS 236
            SA P +IL+ A   +  + I  ++ +A     D+ W+   W   L+M++QEIKDE KQ+
Sbjct: 181 PSALPETILHLAMRLLSGICIATIVLVA----FDLVWARVHWRQNLRMTRQEIKDEHKQT 236

Query: 237 YGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQ 296
            G+P++K RQ+S+AR R R++MM A  +AT++I NPTH+A+ALRY + E  AP++VAKGQ
Sbjct: 237 EGDPLVKARQRSLARDRARNRMMAAVPKATLVIANPTHFAVALRYDRDETAAPIVVAKGQ 296

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKKI 354
           +LIA K+R+IA +++IP+ E   LARSL+    I+  IPP FY+ VA++I  +Y +K+
Sbjct: 297 DLIALKIRQIAEDNDIPVIENRELARSLYASTEIDRMIPPQFYRMVAEVICYVYSRKM 354


>gi|27381988|ref|NP_773517.1| flagellar biosynthesis protein FlhB [Bradyrhizobium japonicum USDA
           110]
 gi|27355158|dbj|BAC52142.1| flagellar biosynthetic protein [Bradyrhizobium japonicum USDA 110]
          Length = 361

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 131/357 (36%), Positives = 214/357 (59%), Gaps = 8/357 (2%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E    ++KTE P+ KK+ D+L +G  P+SREAS+F+S+ A ++  +F    G+  +T 
Sbjct: 1   MAETTDQESKTEEPTEKKVRDSLEQGKIPVSREASIFASMAALMVIQMFLIGQGVQQLTP 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  LL       L   +    LLT + L A R ++P L++ ++FG+ S L+Q  P L L
Sbjct: 61  TLKSLLDDPEGFPLATGADAQNLLTVVGLEALRFLVPLLVVLLVFGLASSLLQNAPNLVL 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKI----ILVGTIITISLTENYFTMLDF 176
             + P   R+S   G  R++    LV F KS  K+    ++V  ++  S  + +  M   
Sbjct: 121 QRIMPDLSRISPVSGWNRLFGTQGLVEFAKSLFKLASVTVVVAFVLRSSEAKAFEAMYTD 180

Query: 177 ISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQS 236
             A P  IL  A   V  + I  ++ +A    +D+ W+   W  +L+M++QEIKDE KQ+
Sbjct: 181 PVALPEMILNIAMRIVSAICIATIVLVA----IDLAWARFHWRRELRMTRQEIKDEHKQA 236

Query: 237 YGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQ 296
            G+P++K R +S+AR R R +M+ + SRAT++I NPTH+A+ALRY + EN AP++VAKG 
Sbjct: 237 EGDPLVKARLRSLARDRSRQRMIASASRATLVIANPTHFAIALRYNREENPAPLVVAKGM 296

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           ++IA K+R++A ++ IP+ E   LAR+L++ V ++  IP  F++ VA++IY +  K+
Sbjct: 297 DVIALKIREVAEKNRIPVIENKVLARALYEAVQVDQVIPAEFFRPVAEIIYFLQSKQ 353


>gi|323139657|ref|ZP_08074699.1| type III secretion exporter [Methylocystis sp. ATCC 49242]
 gi|322395089|gb|EFX97648.1| type III secretion exporter [Methylocystis sp. ATCC 49242]
          Length = 356

 Score =  230 bits (586), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 114/347 (32%), Positives = 200/347 (57%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE+D P+++TE  + KKI D + +G  P SR+      I A L    F        +  
Sbjct: 1   MSESDDPESRTEEATEKKIRDTVEQGKLPSSRDVGTAFGIFALLGAFSFLVDALTPRLIE 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L +L+A+  +  L   +     ++ ++L   R + P LL F++ G+ +   Q  P    
Sbjct: 61  ALGLLIANVGELPLRSGADAYRYVSVVNLELGRYLGPILLGFVIAGLVASFTQGAPQFVF 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + V+P   R+S+  G KRI+ +  +V  +KS VK+I+VG  +  +   ++  ++D +  +
Sbjct: 121 DRVQPDLSRISIIAGWKRIFGLAGVVELLKSVVKMIIVGGAVIFAGLSDHAALVDAMRTD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P  +       +  +  ++ + +  L   D  W+  +W   L+MS+QE+K+E KQ+ G+P
Sbjct: 181 PSRLPGLTLRLIIHLTSVVAISVGVLAAADFVWARFKWRRDLRMSRQELKEEFKQAEGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           ++K R +S+A  R R +MM +   AT ++ NPTHYA+ALRY++ E  AP+++AKG++LIA
Sbjct: 241 LVKARMRSLAMDRSRRRMMASVPNATFVVANPTHYAIALRYVREEGGAPLVLAKGKDLIA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIY 347
            K+R+IA  +N+P+FE+  LAR+++  V ++  IP  FY+ VA+LI+
Sbjct: 301 LKIREIAERNNVPVFEKKELARAMYDMVEVDRMIPAEFYRPVAELIH 347


>gi|254720636|ref|ZP_05182447.1| flagellar biosynthesis protein FlhB [Brucella sp. 83/13]
 gi|265985680|ref|ZP_06098415.1| flagellar biosynthetic protein FlhB [Brucella sp. 83/13]
 gi|306837360|ref|ZP_07470239.1| flagellar biosynthetic protein FlhB [Brucella sp. NF 2653]
 gi|264664272|gb|EEZ34533.1| flagellar biosynthetic protein FlhB [Brucella sp. 83/13]
 gi|306407552|gb|EFM63752.1| flagellar biosynthetic protein FlhB [Brucella sp. NF 2653]
          Length = 356

 Score =  229 bits (585), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 123/353 (34%), Positives = 205/353 (58%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++   ++KTE  + +KI DAL++GN P SREA + + I + L+  +F  +P    +  
Sbjct: 1   MADDADKESKTEEATEQKIRDALDKGNMPFSREAPILAGIASFLVIAVFAAAPAATRLAV 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  L+       L        L + L+L+    ++P  ++  +  I +   Q  P    
Sbjct: 61  FLRELIDHPEDWLLNSAEDATRLFSVLALAVGAALVPVFIIIPLASIAASAFQNAPRFVS 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   R+S  +G +RI+     V F+KS  K++    I+ +   +      D ++ +
Sbjct: 121 ERIHPQASRISPLKGWQRIFGRAGQVEFLKSLAKLLAASVIVFLVFFKGNSLFSDAVATD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P ++       V ++L+  +L IA +   D+ WS   W  +L+M++QE+KDE+KQS G+P
Sbjct: 181 PSALPEFLRKNVVRLLVANVLAIAAIAGFDLAWSRIHWRQELRMTRQEVKDELKQSEGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           ++K+R +S+ R R R +M+ A   AT+I+ NPTH+++ALRY   E+ APV+VAKGQ+LIA
Sbjct: 241 LVKSRLRSLGRDRARRRMINAVPTATLIVANPTHFSVALRYKPNEDAAPVVVAKGQDLIA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA  H+IP+FE+  LAR+L+KQV ++  I P FYKAVA+LI  I  ++
Sbjct: 301 LKIREIAASHSIPVFEDVQLARALYKQVNVDQMIAPEFYKAVAELIRIINTRR 353


>gi|82940565|emb|CAJ44294.1| putative flagellar biosynthetic transmembrane protein FlhB
           [Rhizobium leguminosarum bv. viciae]
          Length = 213

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 151/203 (74%)

Query: 148 FMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLT 207
           F KS  K+++VG I+   L   YF  +D + ++P +IL      +RK++I++L+  A + 
Sbjct: 1   FGKSLFKVVVVGVILFFVLRSEYFGSIDAMFSDPQTILVRMMAAMRKIIIVMLIATAIVA 60

Query: 208 VLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATI 267
           + D+ W+ H W+++LKM++ E+K+E KQ+ G+P +K+RQ+S+ R R R +M+    RAT+
Sbjct: 61  IADLFWTRHHWFTELKMTRHEVKEENKQAQGDPFVKSRQRSLMRDRARRRMIANVHRATL 120

Query: 268 IITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQ 327
           +I NPTHYA+ALRY + ENDAPV++AKGQ+LIA K+R+IA ++ IP+FE+P LARS+F Q
Sbjct: 121 VIANPTHYAVALRYAREENDAPVVLAKGQDLIALKIREIAEQNGIPVFEDPPLARSMFAQ 180

Query: 328 VPINSAIPPVFYKAVAQLIYKIY 350
           V I+S IP VFYKAVA+LI+++Y
Sbjct: 181 VSIDSVIPSVFYKAVAELIHRVY 203


>gi|158422263|ref|YP_001523555.1| flagellar biosynthesis protein FlhB [Azorhizobium caulinodans ORS
           571]
 gi|158329152|dbj|BAF86637.1| flagellar biosynthetic protein [Azorhizobium caulinodans ORS 571]
          Length = 359

 Score =  220 bits (560), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 125/356 (35%), Positives = 210/356 (58%), Gaps = 8/356 (2%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS++   ++KTE  + +K+ DAL +GN P SRE +LF+S+L  L  L FF    +  +T 
Sbjct: 1   MSDDTDKESKTEEATERKVSDALEKGNVPYSRETALFASLLGILGVLTFFVVNPVRILTV 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           +L   L +     L      + L   + L   ++++P +LL    G+ + L Q  P L L
Sbjct: 61  ELTHFLDNPAGFTLAGSDDAIALAWGVLLLMGQVLLPAVLLLAAAGLAASLFQNTPRLVL 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           N ++P F R+   +G  RI+S +  + F KS  K+++V  I  + L      +++ + ++
Sbjct: 121 NRIQPQFSRIDPMKGWTRIFSRDGGIEFGKSAFKLVVVAVICGVLLMSERDKVMNAMYSD 180

Query: 181 P----HSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQS 236
           P      IL  A   +  V +  ++ +A    LD+ WS   W ++L+M+KQE+K+E+KQ 
Sbjct: 181 PLLMPSVILSLATRLISAVCVATIVLVA----LDLVWSRFHWRAELRMTKQEVKEEMKQQ 236

Query: 237 YGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQ 296
            G+P++K R +S+A+ R R +MM +  +AT+++ NPTHYA+AL Y + +  AP +VAKG 
Sbjct: 237 EGDPMVKARMRSLAQQRARQRMMSSVPKATLVVANPTHYAIALYYDRQKGGAPQVVAKGT 296

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
           +LIA K+R+IA   +IP+ E+  LAR+++  V ++  IPP FYK VA+++Y IY +
Sbjct: 297 DLIALKIREIAERCSIPVIEDKPLARAMYDAVEVDQWIPPEFYKPVAKILYFIYSR 352


>gi|300024611|ref|YP_003757222.1| type III secretion exporter [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299526432|gb|ADJ24901.1| type III secretion exporter [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 360

 Score =  219 bits (558), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 125/353 (35%), Positives = 215/353 (60%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE D   ++TE  + KK+ DA N+GN P SRE   F  ++A L+ +          + S
Sbjct: 1   MSEQDQ-QSRTEEATDKKLLDARNDGNVPSSREVPNFLYLMAALLVIAVLGQTFASHLGS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  LLA+A   +L +   ++ L   +  +A+ +  P +L F   G+ + + Q  P+   
Sbjct: 60  LLVGLLANAGSIRLGNGGDVMLLFDVVGKAAAVVTAPIILAFGAAGVIASVAQNPPIPIA 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             V P   R+S  +G+KR++S++ L  F+K  +++++V       L   +    + I  +
Sbjct: 120 KRVIPDISRLSPAKGLKRMFSLSGLFEFLKLSLRLVVVVVTSVAILMYMWHDFTNSIWND 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P +IL  +  +V  +LI + L   TL + D+  ++  W   L+M++QEIKDE KQ  G+P
Sbjct: 180 PSAILTLSQKSVVALLISLALMSFTLLIFDLPVAHVLWRRSLRMARQEIKDEQKQMEGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           ++K R++SIA++R R +M++  S+ATI+I NPTH+A+ALRY+++E  AP +VAKGQ+LIA
Sbjct: 240 LMKARRRSIAKARSRQRMLKGVSKATIVIANPTHFAVALRYVRSEGGAPRVVAKGQDLIA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA E+ IP+ E+ +LARSL+ +V ++  IP  FY+A+A+++ ++  ++
Sbjct: 300 LKIRRIAEENAIPVIEDKALARSLYAKVEVDQMIPAEFYRAIAEILIRLQARR 352


>gi|319409199|emb|CBI82843.1| Flagellar biosynthetic protein flhB [Bartonella schoenbuchensis R1]
          Length = 356

 Score =  216 bits (551), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 126/356 (35%), Positives = 209/356 (58%), Gaps = 8/356 (2%)

Query: 4   NDAPD--NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSD 61
           ++ PD  +KTE P+  KI     +GN P SRE  +FSS+L+  +  +F   P I  ++  
Sbjct: 3   DEKPDKESKTEEPTEHKIHKEEEKGNLPFSRELPIFSSLLSFSVISIFIAFPAISQLSHF 62

Query: 62  LHVLLASATQRKL---EDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVL 118
           L   L      ++   ED+ H+++L+     +    + P L++  + GI +  IQ +P +
Sbjct: 63  LLQWLERPESWRINTAEDVKHLIYLVGG---NVGLALAPILIIIPLIGISASAIQHVPRI 119

Query: 119 NLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFIS 178
            +  ++P + RVSL  G +RI+S   LV F+KS  K+I V  I+ I   +N    ++ + 
Sbjct: 120 IMERIRPQWSRVSLSNGFERIFSKAGLVEFLKSLTKLIGVSIIVYIMFFKNNTIFINALL 179

Query: 179 ANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYG 238
            +  ++  +    +  + +  ++ +A +   D+ WS   W  KL+MSKQEIK+E K   G
Sbjct: 180 TDAPALPEYIREKLVGLSLSFIVAVAAIAGFDLAWSRFHWRQKLRMSKQEIKEEHKSLEG 239

Query: 239 NPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL 298
           NP+IK R +S+A  R+R +M+     AT+I+ NPTH+++ALRY    + APV+VAKGQ++
Sbjct: 240 NPMIKARMRSLAHDRMRLRMISNVPTATLIVANPTHFSVALRYKPPLDYAPVVVAKGQDI 299

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKKI 354
           +A ++R+IA E++IP+ E   LAR+L+KQV ++  IPP  Y++VA LI  I  +KI
Sbjct: 300 LALQIREIAVENDIPVIENVELARTLYKQVEVDQVIPPELYESVAALIRFINSQKI 355


>gi|83309718|ref|YP_419982.1| flagellar biosynthesis protein FlhB [Magnetospirillum magneticum
           AMB-1]
 gi|82944559|dbj|BAE49423.1| Flagellar biosynthesis pathway [Magnetospirillum magneticum AMB-1]
          Length = 355

 Score =  213 bits (542), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 122/354 (34%), Positives = 209/354 (59%), Gaps = 19/354 (5%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+   D+KTE P+ +K+  A  +GN P S+E  +++S++  L+ ++  F+P    +  
Sbjct: 1   MAEDS--DDKTEEPTDRKLSQAREQGNIPTSQEVKIWASLVGALV-VVTLFAP---YMAR 54

Query: 61  DLHVLL------ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQR 114
           D+  LL        A     ED+     LL+ +++   +L+I  +++ ++  I S + Q 
Sbjct: 55  DIGRLLLPFVEHPHAFPMGREDVGQ---LLSGITVDMIKLLIMPMMMLVVLAIASAMGQS 111

Query: 115 IPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTML 174
             +   + +   F ++S  +G++RI+S  NLV F+KS  K+  +G +I + L  +     
Sbjct: 112 GLMFLPDKLTLDFGKLSPGKGLQRIFSGRNLVEFVKSLFKVSAIGFVIFLILKSHMSEYA 171

Query: 175 DFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWY--SKLKMSKQEIKDE 232
              + +  ++L +    V  ++I+++L +  L   D  W Y +W    ++KM+KQEIKDE
Sbjct: 172 GLAALDLMAVLDYLRHQVITMIIVVVLMVFVLAAAD--WFYQRWAFTQQMKMTKQEIKDE 229

Query: 233 IKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLV 292
            KQ+ G+P+IK R +++   R R +MM A  RA++++TNPTHYA+AL+Y Q    APVLV
Sbjct: 230 HKQTEGDPMIKGRLRALRMQRARQRMMAAVPRASVVVTNPTHYAVALQYDQDSMGAPVLV 289

Query: 293 AKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           AKG +LIAK++R +A E+ +PI E P LAR+L+  V ++  IPP  YK VA++I
Sbjct: 290 AKGVDLIAKRIRDLATENEVPIVENPPLARALYATVELDQEIPPEHYKTVAEII 343


>gi|188581880|ref|YP_001925325.1| flagellar biosynthetic protein FlhB [Methylobacterium populi BJ001]
 gi|179345378|gb|ACB80790.1| flagellar biosynthetic protein FlhB [Methylobacterium populi BJ001]
          Length = 355

 Score =  212 bits (540), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 115/346 (33%), Positives = 193/346 (55%), Gaps = 2/346 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++    ++KTE P+ ++IE A+  G+ P S E + F  + A  + L+    P    +T 
Sbjct: 1   MADESDDEDKTEDPTPRRIEQAIERGDVPNSPEINTFFILAAFTLALMLSAKPMAEGLTR 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           D+   L  A     +  +++   L    + A  L +P L + M+  I + LIQ  P+   
Sbjct: 61  DMRGFLEHAGSIPSDAGTYLGVALRAGWVCAKALAVP-LGIAMLAAIAAGLIQHRPIFTA 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R+S   G KR+   +  VNF K   KII+VGTI    L   +     F   +
Sbjct: 120 ESLMPKFARISPMAGAKRLLGTDAWVNFGKGLAKIIVVGTIAGAILWNEHDRAESFAQLD 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + L        K++  +L   A + + D  +  H+W+++L+M+K+E+K E K+S G+P
Sbjct: 180 PGAALQGTLTLALKMMGGMLAAYAAIALGDALYQRHRWHTRLRMTKEEMKQEHKESEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + ++R++ +MM A   AT+++TNPTHYA+ALRY +T   APV VAKG + +A
Sbjct: 240 EVKARIRQLRQARVKKRMMAAVPTATVVVTNPTHYAVALRY-ETGMAAPVCVAKGVDSLA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
            ++R +A +H++P+ E P LAR+L   V +++ IP   Y+AVA++I
Sbjct: 299 LRIRAVAADHDVPVLENPPLARALHATVEVDAEIPAEHYRAVAEVI 344


>gi|319406964|emb|CBI80601.1| Flagellar biosynthetic protein flhB [Bartonella sp. 1-1C]
          Length = 356

 Score =  211 bits (536), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 127/355 (35%), Positives = 206/355 (58%), Gaps = 8/355 (2%)

Query: 4   NDAPD--NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSD 61
           ++ PD  ++TE P+  KI     +GN P SRE  +F+S+++  +  +F   P I  +T  
Sbjct: 3   DEKPDKESQTEEPTEYKIRKEEEKGNLPFSRELPVFASLVSFSLICVFISFPAISKLTYF 62

Query: 62  LHVLLASATQRKL---EDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVL 118
           L   L      ++   ED+ H+++LL     SA   + P L+L  +  I +  +Q +P  
Sbjct: 63  LIQWLERPESWRINTAEDVKHLIYLLGG---SAGLALAPILILIPLLSITASAVQNVPKF 119

Query: 119 NLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFIS 178
            +  ++P + R+S   G KRIYS   LV F+KS  K+I V  II +   ++    ++ + 
Sbjct: 120 VIERIRPQWSRISPANGFKRIYSKAGLVEFLKSLTKLIAVSLIIYMIFFKSNTIFINALL 179

Query: 179 ANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYG 238
            +  ++  +    +  + +  +  +  L  LDI WS   W  +L+M+KQEIK+E K   G
Sbjct: 180 TDASALPKYIHKELINLSLSFITAVIALVGLDIAWSRFHWRQQLRMTKQEIKEEHKNLEG 239

Query: 239 NPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL 298
           NP++K R +S++R RIR +M+     AT+IITNPTH+++ALRY    + APV++AKG ++
Sbjct: 240 NPMVKARMRSLSRDRIRRRMIANVPTATLIITNPTHFSVALRYKPPLDYAPVVIAKGLDI 299

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +A  +R+IA EH IPIFE  +LAR+L+KQV I+  IP   Y++VA LI  I ++K
Sbjct: 300 LALHIREIAVEHEIPIFENVTLARTLYKQVEIDQTIPTELYESVAALIRFINNQK 354


>gi|319403947|emb|CBI77535.1| Flagellar biosynthetic protein flhB [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 356

 Score =  209 bits (532), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 126/355 (35%), Positives = 205/355 (57%), Gaps = 8/355 (2%)

Query: 4   NDAPD--NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSD 61
           ++ PD  ++TE P+  KI     +GN P SRE  +F+S+++  +  +F   P I  +T  
Sbjct: 3   DEKPDKESQTEEPTEYKIRKEEEKGNLPFSRELPVFASLVSFSLICVFISFPAISKLTYF 62

Query: 62  LHVLLASATQRKL---EDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVL 118
           L   L      ++   ED+ H+++LL     S    + P L+L  +  I +  +Q +P  
Sbjct: 63  LIQWLERPESWRINTAEDVKHLIYLLGG---SVGLALAPILILIPLLSITASAVQNVPRF 119

Query: 119 NLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFIS 178
            +  ++P + R+S   G KRIYS   LV F+KS  K+I V  II I   ++    ++ + 
Sbjct: 120 VIERIRPQWSRISPANGFKRIYSKAGLVEFLKSLTKLIAVSLIIYIIFFKSNTIFINALL 179

Query: 179 ANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYG 238
            +  ++  +    +  + +  +  +  L  LDI WS   W  +L+M+KQEIK+E K   G
Sbjct: 180 TDASALPKYIHKELINLSLSFITAVIALVGLDIAWSRFHWRQQLRMTKQEIKEEHKNLEG 239

Query: 239 NPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL 298
           NP++K R +S++R RIR +M+     AT+I+TNPTH+++ALRY    + APV++AKG ++
Sbjct: 240 NPMVKARMRSLSRDRIRRRMIANVPTATLIVTNPTHFSVALRYKPPLDYAPVVIAKGLDI 299

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +A  +R+IA EH IPIFE  +LAR+L+KQV I+  IP   Y++VA LI  I ++K
Sbjct: 300 LALHIREIAIEHEIPIFENVTLARTLYKQVEIDQTIPTELYESVAALIRFINNQK 354


>gi|319405388|emb|CBI79007.1| Flagellar biosynthetic protein flhB [Bartonella sp. AR 15-3]
          Length = 356

 Score =  208 bits (530), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 133/361 (36%), Positives = 204/361 (56%), Gaps = 30/361 (8%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
           ++KTE P+  KI     +GN P SRE  +F+S+++  +  +F   P I  +T  L   L 
Sbjct: 9   ESKTEEPTEYKIRKEEEKGNLPFSRELPIFASLVSFSLICVFISFPAISKLTYFLVQWLE 68

Query: 68  SATQRKL---EDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVK 124
                ++   ED+ H+++L+     +    + P L+L  +  I +  +Q +P   +  ++
Sbjct: 69  RPESWRINTAEDVKHLIYLVGG---NVGLALAPILILIPLLSITASAVQNVPKFIIERIR 125

Query: 125 PSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSI 184
           P + R+S   G  RIYS   LV F+KS  K+I V  II           L F  +N  +I
Sbjct: 126 PQWSRISPANGFNRIYSKAGLVEFLKSLTKLIGVSLII----------YLIFFKSN--TI 173

Query: 185 LYHAFFT--------VRKVLIMILLFIAT----LTVLDIGWSYHQWYSKLKMSKQEIKDE 232
             +A  T        + K LI + L   T    L  LDI WS   W  +L+M+KQEIK+E
Sbjct: 174 FINALLTDASALPKYIHKELINLSLSFTTAVIALVGLDIAWSRFHWRQQLRMTKQEIKEE 233

Query: 233 IKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLV 292
            K   GNP++K R +S++R RIR +M+     AT+I+TNPTH+++ALRY    + APV++
Sbjct: 234 HKNLEGNPVVKARMRSLSRDRIRRRMIANVPTATLIVTNPTHFSVALRYKPPLDYAPVVI 293

Query: 293 AKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
           AKGQ+++A  +R+IA EH+IPIFE  +LAR+L+KQV I+  IP   Y++VA LI  I ++
Sbjct: 294 AKGQDILALHIREIAIEHDIPIFENITLARTLYKQVEIDQTIPTELYESVAALIRFINNQ 353

Query: 353 K 353
           K
Sbjct: 354 K 354


>gi|295690541|ref|YP_003594234.1| flagellar biosynthetic protein Flhb [Caulobacter segnis ATCC 21756]
 gi|295432444|gb|ADG11616.1| flagellar biosynthetic protein FlhB [Caulobacter segnis ATCC 21756]
          Length = 361

 Score =  205 bits (522), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 109/357 (30%), Positives = 202/357 (56%), Gaps = 9/357 (2%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++  P++KTE PS+K++ DA  +G+   S +    +S+   +  ++         +++
Sbjct: 1   MADDTDPESKTEEPSAKRLADARAKGDVVKSADIPQLASLAGAVSVVILAGGWLTRDLSA 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMF----GIGSYLIQRIP 116
            L+  +A A    L     +V +       A+   +P L+L M+     G  +++ Q   
Sbjct: 61  ALYPFIAHAGTIDLSSAGAMVVMK-----QATMAALPPLILVMLVSAFAGAIAHIAQSGF 115

Query: 117 VLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDF 176
           +L  + +KP F ++ L +G+ RI+ I+  V F KS VK ++ G I  + L  +   + + 
Sbjct: 116 LLTPSKLKPDFSKLDLIKGLGRIFGIDGFVQFAKSAVKFLVTGLIAWMVLKPHVGEVRNL 175

Query: 177 ISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQS 236
           +  +P ++L  A    + +L+ +++F+      D  W   ++ ++++M+ QE+KDE KQS
Sbjct: 176 VGMDPAAMLPEALKLSKSLLMAVIIFLTATAAFDWFWQRQRFMNRMRMTLQEVKDEFKQS 235

Query: 237 YGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQ 296
            G+P +K +++ I   R R +MM+A  +AT+++ NPTHYA+AL+Y   E  AP+ VAKG 
Sbjct: 236 DGDPHVKGKRRQIQMQRSRQRMMQAVPKATVVVMNPTHYAVALKYEAGETPAPLCVAKGV 295

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           + +A K+R IA EH +P+ E+P LAR+L+  V ++  IP   ++AVA++I  I + K
Sbjct: 296 DELALKIRAIAEEHGVPVLEDPPLARALYASVEVDEEIPVEHFEAVAKVISFILNGK 352


>gi|319898624|ref|YP_004158717.1| flagellar biosynthetic protein flhB [Bartonella clarridgeiae 73]
 gi|319402588|emb|CBI76133.1| Flagellar biosynthetic protein flhB [Bartonella clarridgeiae 73]
          Length = 356

 Score =  205 bits (522), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 127/359 (35%), Positives = 208/359 (57%), Gaps = 16/359 (4%)

Query: 4   NDAPD--NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSD 61
           ++ PD  ++TE P+  KI     +GN P SRE  +F+S+++  +  +F   P I  +T  
Sbjct: 3   DEKPDKESQTEEPTEYKIRKEEEKGNLPFSRELPIFASLVSFSLICIFISFPAISKLTFF 62

Query: 62  LHVLLASATQRKL---EDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVL 118
           L          ++   EDI H+++L+     S    + P L+L  +  I +  +Q +P  
Sbjct: 63  LVQWFERPESWRINTAEDIKHLIYLVGG---SVGLALAPILILIPLLNIVASAVQNVPRF 119

Query: 119 NLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFIS 178
            +  ++P + RVS   G KRIYS   LV F+KS  K+I V  I+ +   ++    ++ + 
Sbjct: 120 VIERIRPQWSRVSPANGFKRIYSKAGLVEFLKSLTKLIGVSLIVYMIFFKSNTIFINALL 179

Query: 179 ANPHSILYHAFFTVRKVLIMILL----FIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIK 234
            +  ++  +    +RK LI + L     +  L  LD+ WS   W  +L+M+KQEIK+E K
Sbjct: 180 TDASALPEY----IRKELISLSLSFTAAVVALVGLDLAWSRFHWRQQLRMTKQEIKEEHK 235

Query: 235 QSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAK 294
              GNP++K R +S+AR R R +M+     AT+I+TNPTH+++ALRY    + APV++AK
Sbjct: 236 NLEGNPMVKARMRSLARDRTRRRMIANVPTATLIVTNPTHFSVALRYKPPLDYAPVVIAK 295

Query: 295 GQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           GQ+++A  +R+IA +++IPIFE  +LAR+L+KQV I+  IP   Y++VA LI  I ++K
Sbjct: 296 GQDILALHIREIAIKNDIPIFENVTLARTLYKQVEIDQTIPTELYESVAALIRFINNQK 354


>gi|163852023|ref|YP_001640066.1| flagellar biosynthetic protein FlhB [Methylobacterium extorquens
           PA1]
 gi|163663628|gb|ABY30995.1| flagellar biosynthetic protein FlhB [Methylobacterium extorquens
           PA1]
          Length = 354

 Score =  205 bits (522), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 112/346 (32%), Positives = 190/346 (54%), Gaps = 2/346 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS+    ++KTE P+ ++IE A+  G+ P S E + F  + A  + L+    P    +T 
Sbjct: 1   MSDETDDEDKTEDPTPRRIEQAIERGDVPNSPEINTFFILAAFTLALMLSARPVAEGLTR 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           D+   L  A     +  +++   L    + A  L +P L + M+  I + LIQ  P+   
Sbjct: 61  DMRGFLEHAGGLPSDSGTYLGVALRAAWVCAKALAVP-LGIAMLAAIAAGLIQHRPIFTA 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R+S   G KR+  ++  VNF K   KII+VGTI    L   +     F   +
Sbjct: 120 ESLMPKFARISPMAGAKRLLGMDAWVNFGKGLAKIIVVGTIAGTILWSEHDRAESFAQLD 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   L        K++  +L   A + + D  +  ++W+ +L+M+K+E+K E K+S G+P
Sbjct: 180 PGVALQGTLTLALKMMGGMLAVYAVIALGDALYQRNRWHKRLRMTKEEMKQEHKESEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + ++R++ +MM A   AT+++TNPTH+A+ALRY +    AP+ VAKG + +A
Sbjct: 240 EVKARIRQLRQARVKKRMMAAVPTATVVVTNPTHFAVALRY-EAGMAAPICVAKGVDSLA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
            ++R +A +H++P+ E P LAR+L   V ++  IP   Y+AVA++I
Sbjct: 299 LRIRAVATDHDVPVMENPPLARALHATVEVDEEIPAEHYRAVAEVI 344


>gi|121601720|ref|YP_989412.1| flagellar biosynthesis protein FlhB [Bartonella bacilliformis
           KC583]
 gi|120613897|gb|ABM44498.1| flagellar biosynthetic protein FlhB [Bartonella bacilliformis
           KC583]
          Length = 356

 Score =  205 bits (521), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 117/356 (32%), Positives = 204/356 (57%), Gaps = 8/356 (2%)

Query: 4   NDAPD--NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSD 61
           ++ PD  ++TE P+  KI  A  +GN P SRE  + +S+++  +  +F   P + +++  
Sbjct: 3   DEKPDKESQTEEPTEHKIHKAEEKGNLPFSRELPILASLMSFSLITIFVAFPAMSNLSRF 62

Query: 62  LHVLLASATQRKL---EDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVL 118
           L   L       +   ED+ H+++L+   +L  +   +  ++  +     +  IQ  P +
Sbjct: 63  LTEWLERPESWHINTAEDVKHLIYLVGG-NLGLALAALLIIIPLISIAASA--IQNAPRI 119

Query: 119 NLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFIS 178
               + P + R+S   G  RI+     + F+KS VK+I V  I+ I   +N    ++ + 
Sbjct: 120 VTERISPKWSRISPANGFGRIFGKAGFIEFLKSLVKLIGVSIIVYIMFFKNNTIFINALL 179

Query: 179 ANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYG 238
            +  ++  +    +  + +  ++ +A +   D+ WS   W  +L+M+KQE+KDE K   G
Sbjct: 180 TDAPALPEYIRQKLVDLSLSFIVAVAIIAGFDLAWSRFYWRQQLRMTKQEVKDEYKNLEG 239

Query: 239 NPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL 298
           NP++K+R +S+AR RIR KM+     AT+I+TNPTH+++ALRY    + APV++AKGQ++
Sbjct: 240 NPMVKSRMRSLARDRIRRKMIANVPTATLIVTNPTHFSVALRYKPPLDHAPVVIAKGQDI 299

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKKI 354
           +A  +R+IA +H+IPI E+  LAR+L+KQV ++  IPP FY+ VA LI  I  +KI
Sbjct: 300 LALHIREIATKHDIPIIEDQPLARALYKQVEVDQTIPPEFYEGVAALIRFINSQKI 355


>gi|304392516|ref|ZP_07374456.1| flagellar biosynthetic protein FlhB [Ahrensia sp. R2A130]
 gi|303295146|gb|EFL89506.1| flagellar biosynthetic protein FlhB [Ahrensia sp. R2A130]
          Length = 354

 Score =  204 bits (519), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 121/353 (34%), Positives = 199/353 (56%), Gaps = 9/353 (2%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS+ D   +K+E PS KKI+DAL++G   +SRE ++ +S++   +++  F       ++ 
Sbjct: 1   MSDED-DGSKSEEPSEKKIKDALDKGQTAVSREVAIVASLIVLTVFVSTFARDMAVGLSD 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  L   A   ++   S    L   ++  AS  +   L++ ++  + S  IQ  P +  
Sbjct: 60  KLGGLWEHAGTIRILSGSDAATLSGSIAAEASLALAAFLIMVIIGALISAFIQAEPRMVA 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + + P ++R+S  +G KR++    L +F K   K+ +  T +   L      M+  +   
Sbjct: 120 DRITPKYERISPAKGAKRLFGQQGLFDFAKQLAKLSVATTAVVSVLAGAPEKMMQAMPLG 179

Query: 181 PHSILYHAFFTVRK----VLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQS 236
           P    Y+   TVR     +L  ILL +  + V+D+ W+   W   L+MS +E+KDE+KQS
Sbjct: 180 P----YYIGDTVRDLLGGMLTAILLAMVFVAVVDVVWTRFSWRKGLRMSLKEVKDEVKQS 235

Query: 237 YGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQ 296
            G+PI+K RQ+S+AR R R++MMEA   AT+++ NP H A+ALRY  T++ APV+VAKGQ
Sbjct: 236 DGDPIVKARQQSVARDRARNRMMEAVPNATLVVANPIHVAVALRYDPTKDVAPVVVAKGQ 295

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKI 349
             +  ++R+IA E  +P+ E   +AR L K VP+ + IP  FY  VA+LI ++
Sbjct: 296 ERLCWRIREIAEEAGVPVVENIPVARGLHKSVPLGALIPESFYVVVAELIKQL 348


>gi|218530777|ref|YP_002421593.1| flagellar biosynthetic protein FlhB [Methylobacterium
           chloromethanicum CM4]
 gi|218523080|gb|ACK83665.1| flagellar biosynthetic protein FlhB [Methylobacterium
           chloromethanicum CM4]
          Length = 354

 Score =  203 bits (517), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 111/346 (32%), Positives = 189/346 (54%), Gaps = 2/346 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS+    ++KTE P+ ++IE A+  G+ P S E + F  + A  + L+    P    +T 
Sbjct: 1   MSDETDDEDKTEDPTPRRIEQAIERGDVPNSPEINTFFILAAFTLALMLSARPVAEGLTR 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           D+   L  A     +  +++   L    +    L +P L + M+  I + LIQ  P+   
Sbjct: 61  DMRGFLEHAGGLPSDSGTYLGVALRAAWVCTKALAVP-LGIAMLAAIAAGLIQHRPIFTA 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R+S   G KR+  ++  VNF K   KII+VGTI    L   +     F   +
Sbjct: 120 ESLMPKFARISPMAGAKRLLGMDAWVNFGKGLAKIIVVGTIAGTILWSEHDRAESFAQLD 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   L        K++  +L   A + + D  +  ++W+ +L+M+K+E+K E K+S G+P
Sbjct: 180 PGVALQGTLTLALKMMGGMLAVYAVIALGDAFYQRNRWHKRLRMTKEEMKQEHKESEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + ++R++ +MM A   AT+++TNPTH+A+ALRY +    AP+ VAKG + +A
Sbjct: 240 EVKARIRQLRQARVKKRMMAAVPTATVVVTNPTHFAVALRY-EAGMAAPICVAKGVDSLA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
            ++R +A +H++P+ E P LAR+L   V ++  IP   Y+AVA++I
Sbjct: 299 LRIRAVAADHDVPVMENPPLARALHATVEVDEEIPAEHYRAVAEVI 344


>gi|240139290|ref|YP_002963765.1| flagellar biosynthetic protein flhB [Methylobacterium extorquens
           AM1]
 gi|254561746|ref|YP_003068841.1| flagellar biosynthetic protein flhB [Methylobacterium extorquens
           DM4]
 gi|240009262|gb|ACS40488.1| flagellar biosynthetic protein flhB [Methylobacterium extorquens
           AM1]
 gi|254269024|emb|CAX24985.1| flagellar biosynthetic protein flhB [Methylobacterium extorquens
           DM4]
          Length = 354

 Score =  203 bits (517), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 111/346 (32%), Positives = 189/346 (54%), Gaps = 2/346 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS+    ++KTE P+ ++IE A+  G+ P S E + F  + A  + L+    P    +T 
Sbjct: 1   MSDETDDEDKTEDPTPRRIEQAIERGDVPNSPEINTFFILAAFTLALMLSARPVAEGLTR 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           D+   L  A     +  +++   L    +    L +P L + M+  I + LIQ  P+   
Sbjct: 61  DMRGFLEHAGGLPSDSGTYLGVALRAAWVCTKALAVP-LGIAMLAAIAAGLIQHRPIFTA 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R+S   G KR+  ++  VNF K   KII+VGTI    L   +     F   +
Sbjct: 120 ESLMPKFARISPMAGAKRLLGMDAWVNFGKGLAKIIVVGTIAGTILWSEHDRAESFAQLD 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   L        K++  +L   A + + D  +  ++W+ +L+M+K+E+K E K+S G+P
Sbjct: 180 PGVALQGTLTLALKMMGGMLAVYAVIALGDALYQRNRWHKRLRMTKEEMKQEHKESEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + ++R++ +MM A   AT+++TNPTH+A+ALRY +    AP+ VAKG + +A
Sbjct: 240 EVKARIRQLRQARVKKRMMAAVPTATVVVTNPTHFAVALRY-EAGMAAPICVAKGVDSLA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
            ++R +A +H++P+ E P LAR+L   V ++  IP   Y+AVA++I
Sbjct: 299 LRIRAVAADHDVPVMENPPLARALHATVEVDEEIPAEHYRAVAEVI 344


>gi|312115253|ref|YP_004012849.1| type III secretion exporter [Rhodomicrobium vannielii ATCC 17100]
 gi|311220382|gb|ADP71750.1| type III secretion exporter [Rhodomicrobium vannielii ATCC 17100]
          Length = 353

 Score =  201 bits (511), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 120/352 (34%), Positives = 206/352 (58%), Gaps = 1/352 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++N   DNKTEAPS K++ D+L++   P SRE +  +++ A +++L+         V  
Sbjct: 1   MADNSETDNKTEAPSEKRLRDSLDKDGGPSSREVNSAAALFALVLFLMTMAPADFGEVVK 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           +L V +   +   LE+ +   F+L    L+     +P +L+ +   + +   Q  P L  
Sbjct: 61  NLSVFIEDPSGFSLENGADAFFILQLAGLTIFNFALPLVLMLLAATLLASFAQNPPTLIF 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           N + P   R+S + G+KR+++ + +V+ +KSF+K  +V     ++       +L   + +
Sbjct: 121 NKIAPDLARISPQAGLKRLFAFDAVVDLLKSFIKFGIVAIAFYVAFQGGAAALLVLQTDS 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             +I        + +LI  L   A L V D+ W+  +W  KLKMS+Q++KDE KQS G+P
Sbjct: 181 ASTIELIKRLAFKAILICALA-CAVLAVADVFWTRFRWLRKLKMSRQDLKDEHKQSEGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           +++ R ++IAR+R+R  MM +   AT++I NPTHYA+ALRY++ ++ AP  +AKG+N +A
Sbjct: 240 MLRARARAIARARVRRNMMTSVPNATVVIANPTHYAVALRYVRGQDRAPQTLAKGKNKLA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
            ++R IA ++N+P+ E  +LA+SL   V ++  IP  FYKAVA++I  I  K
Sbjct: 300 LRIRSIAEDNNVPVVENKALAKSLHDAVRVDQPIPHEFYKAVAEVIIYINKK 351


>gi|89068708|ref|ZP_01156094.1| flagellar biosynthesis protein [Oceanicola granulosus HTCC2516]
 gi|89045671|gb|EAR51733.1| flagellar biosynthesis protein [Oceanicola granulosus HTCC2516]
          Length = 373

 Score =  197 bits (502), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 110/351 (31%), Positives = 200/351 (56%), Gaps = 7/351 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYS-VT 59
           M+E++   +KTE PS +K++ A ++G+ P SRE    + ++  L+ L  F  P + S + 
Sbjct: 1   MAEDEDKHSKTEQPSERKLKKARDKGDVPASRETGT-AMVVFSLMLLSAFLIPSVGSGLV 59

Query: 60  SDLHVLLASATQRKLE----DISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRI 115
           + L  L+  A Q +++     ++ +  L + L+    R++ P  LL ++  +   LIQ  
Sbjct: 60  AALGALIDVAGQVEIDSGRAGLADVSALSSELTGQVGRVLAPLFLLMIVGALFGVLIQGE 119

Query: 116 PVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLD 175
            V++L  ++P + ++S   G+KR++S + +V F+K+ +K+++V  I T  +     + + 
Sbjct: 120 TVVSLERIRPKYSKISPLGGVKRLFSADMIVEFLKNTLKVVIVAAIGTW-IARRAVSQVW 178

Query: 176 FISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQ 235
             S  P ++       V  +L+     +    + DI W   QW  K +MS +E++DE K+
Sbjct: 179 MGSLAPEALPGFVRGEVTAMLMATAALLVPFAIADILWKRAQWTKKQRMSLKEVRDEHKE 238

Query: 236 SYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKG 295
           + G+P IK ++  I R R R ++  A  +AT+IITNPTH+A+ALRY    + APV VAKG
Sbjct: 239 TEGDPFIKQKRTDIRRERARQRIATAVPKATVIITNPTHFAVALRYQPGVDQAPVCVAKG 298

Query: 296 QNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
            + +A ++R++  E++IPI E   LARSL     I++ +P   ++A+A++I
Sbjct: 299 ADHVAARIRELGRENDIPILENKPLARSLHAVAEIDAVVPVEHWQALAEII 349


>gi|328543170|ref|YP_004303279.1| flagellar biosynthesis protein B [polymorphum gilvum SL003B-26A1]
 gi|326412916|gb|ADZ69979.1| Flagellar biosynthesis protein B [Polymorphum gilvum SL003B-26A1]
          Length = 359

 Score =  196 bits (497), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 116/349 (33%), Positives = 193/349 (55%), Gaps = 8/349 (2%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++     KTE P+ K++++A  +G+ P S+E S + + LA    ++  F+P   +VT+
Sbjct: 1   MADDTDDSEKTEDPTQKRLKEAHEKGDLPKSQEVSTWFT-LAGAAMMIALFAP---AVTT 56

Query: 61  DLHVLLASATQRKLE---DISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPV 117
           +L   L    +   E   D   +  L      S + +V   LL  +   +   L+Q   V
Sbjct: 57  ELGTQLKWYLEHAHEIPADGYALKALWRDTGQSVALIVGLPLLALVAMAVAGNLVQHEAV 116

Query: 118 LNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFI 177
                +KP   +VS   G KR++S  +L+NF K  +KI++VG ++   L          I
Sbjct: 117 FTAEPIKPKLSKVSPLSGFKRLFSGQSLMNFAKGMLKIVIVGAVMVAVLWPQRDRAEAVI 176

Query: 178 SANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSY 237
             +  S+L  A   V ++L  +L  +  +   D  W  H+W+ K KMS +E+K+E KQ+ 
Sbjct: 177 FVDVSSLLEEARGLVLQLLAAVLAIMTVVAGADYVWQRHKWFEKQKMSMRELKEEYKQTE 236

Query: 238 GNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQN 297
           G+P++K + + +   R R +MM A  +AT+++TNPTHYA+ALRY +    AP+ VAKG +
Sbjct: 237 GDPLVKGKIRQLRMERSRKRMMAAVPQATVVVTNPTHYAVALRY-EEGMGAPLCVAKGTD 295

Query: 298 LIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
            IA K+R++A +H +P+ E P LAR+L+  V ++  IP   YKAVA++I
Sbjct: 296 AIALKIREVARQHEVPVVENPPLARALYASVDVDREIPEDHYKAVAEVI 344


>gi|254501745|ref|ZP_05113896.1| flagellar biosynthetic protein FlhB [Labrenzia alexandrii DFL-11]
 gi|222437816|gb|EEE44495.1| flagellar biosynthetic protein FlhB [Labrenzia alexandrii DFL-11]
          Length = 359

 Score =  196 bits (497), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 119/360 (33%), Positives = 194/360 (53%), Gaps = 22/360 (6%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++      KTE P+ K+++DA ++G+ P S+E S + + LA    ++   +PG  +   
Sbjct: 1   MADETDDSEKTEDPTQKRLKDAHDKGDVPKSQEVSTWFT-LAGATLMIAIMAPGAAASLG 59

Query: 61  DL--------HVLLASATQRK--LEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSY 110
           +L        H +       K    D    V L+  L L A       L++  +FG    
Sbjct: 60  NLLKGYIEHAHQIPVDGYALKALWRDTGQSVALIVGLPLLA-------LVVMAVFG---N 109

Query: 111 LIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENY 170
           LIQ  P+L    +KP   +VS   G KR++S  +LVNF K  VKI++VG ++   L  + 
Sbjct: 110 LIQHQPLLTAETIKPKLSKVSPLSGFKRLFSSESLVNFAKGMVKILVVGAVMVAVLWPHR 169

Query: 171 FTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIK 230
                 I A+   IL  A   + +VL  IL  +  +   D  +  ++W++K KMS +E+K
Sbjct: 170 DEAEIMIFADEMIILEEARILILQVLAAILAVMTVVAAADFVYQKNKWFNKQKMSLKEVK 229

Query: 231 DEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPV 290
           +E KQ+ G+P +K + + +   R R +MM A   AT+++TNPTHYA+AL+Y +    AP+
Sbjct: 230 EEFKQTEGDPHVKGKIRQLRMERSRKRMMSAVPAATVVVTNPTHYAVALQY-EEGMGAPL 288

Query: 291 LVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
            VAKG + +A ++R +A EH +P+ E P LAR+L+  V I   +P   +KAVA++I  ++
Sbjct: 289 CVAKGTDALALRIRDVAKEHEVPVIENPPLARALYASVEIEQEVPEEHFKAVAEVIGFVF 348


>gi|307945650|ref|ZP_07660986.1| flagellar biosynthetic protein FlhB [Roseibium sp. TrichSKD4]
 gi|307771523|gb|EFO30748.1| flagellar biosynthetic protein FlhB [Roseibium sp. TrichSKD4]
          Length = 359

 Score =  195 bits (496), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 119/356 (33%), Positives = 198/356 (55%), Gaps = 12/356 (3%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGI-YSVT 59
           M+++     KTE P+ K+++DAL++G+   S+E S + + LA    L+  F+P I  +V 
Sbjct: 1   MADDQDDAEKTEDPTQKRLKDALDKGDVAKSQEVSTWFT-LAGTTLLIALFAPTIGAAVG 59

Query: 60  SDLHVLLASATQRKLEDISHIVFLLTHL--SLSASRLVIPGLLL--FMMFGIGSYLIQRI 115
           + L   +  A      DI    F L  L      S  +I GL L   ++  I   ++Q  
Sbjct: 60  NHLKGFMEHA-----HDIPVDGFALKALWRDTGQSIALIVGLPLMALVVMAIAGNMVQHQ 114

Query: 116 PVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLD 175
            V     +KP   +VS   G KR++S ++LVNF K   KI +VG ++ + L  +      
Sbjct: 115 LVFTAETMKPKLSKVSPLSGFKRLFSKDSLVNFAKGLAKIFVVGALMVLVLWPHRDEADI 174

Query: 176 FISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQ 235
            I A+P  +L  A F + ++L  ++ F+  +   D  +  ++W++K KMS +++KDE KQ
Sbjct: 175 MIFADPVILLEEARFLILQLLGAVMAFMTVVAAADYAYQKNKWFNKQKMSLRDVKDEYKQ 234

Query: 236 SYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKG 295
           + G+P +K + + +   R R +MM A   AT+++TNPTH+A+AL+Y +    AP+ +AKG
Sbjct: 235 TEGDPHVKGKIRQLRMERSRKRMMAAVPDATVVVTNPTHFAVALKY-EEGMGAPLCLAKG 293

Query: 296 QNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            + +A K+R++A E  IP+ E P LAR+L+  V I   +P   YKAVA++I  +Y 
Sbjct: 294 TDAVALKIRELAKEKKIPVVENPPLARALYASVEIEQEVPEEHYKAVAEVIGFVYR 349


>gi|118588696|ref|ZP_01546104.1| flagellar biosynthesis protein B [Stappia aggregata IAM 12614]
 gi|118438682|gb|EAV45315.1| flagellar biosynthesis protein B [Stappia aggregata IAM 12614]
          Length = 359

 Score =  195 bits (495), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 111/346 (32%), Positives = 194/346 (56%), Gaps = 2/346 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++     KTE P+ K++++A ++G+ P S+E S + ++    + +  F      S+  
Sbjct: 1   MADDSDDSEKTEDPTHKRLKEAHDKGDVPKSQEVSTWFTLAGATLMIAIFAPSTAVSLGE 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L  A Q  ++  + +  L      S + +V   LL  ++  +   L+Q  P+L  
Sbjct: 61  MMKGYLEHAHQIAVDGYA-LKALWRDTGQSVALIVGIPLLALVIMAVAGNLVQHQPLLTA 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +KP   +VS   G KR++S  +LVNF K  +KI +VG I+   +  +       + A+
Sbjct: 120 ETIKPKLSKVSPASGFKRLFSSESLVNFAKGMIKISVVGAIMVAVMWPHRDEAEVMVFAD 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            + IL  A   + ++L  +L  +  +   D  +  ++W++K KMS +E+K+E KQ+ G+P
Sbjct: 180 TNIILEEARILILQLLSAVLAVMTVVAGADFIYQRNKWFNKQKMSLREVKEEYKQTEGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK + + +   R R +MM A  +AT+++TNPTHYA+AL+Y +    AP+ +AKG + IA
Sbjct: 240 QIKGKIRQLRMERSRKRMMSAVPQATVVVTNPTHYAVALKY-EEGMGAPLCLAKGTDAIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
            K+R+IA E +IP+ E P LAR+L+  V I+  +P   YKAVA++I
Sbjct: 299 LKIREIAKESDIPVVENPPLARALYATVEIDQEVPEEHYKAVAEVI 344


>gi|144900464|emb|CAM77328.1| Type III secretion exporter [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 357

 Score =  194 bits (493), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 115/344 (33%), Positives = 194/344 (56%), Gaps = 2/344 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           ++A D+KTE P+ K++ DA  EGN P + EA    S++   I L F      +++ + + 
Sbjct: 3   DEASDDKTEEPTGKRLGDARTEGNIPQTMEAKAMMSLVLAAIMLGFLAPDMAHNIKAVIT 62

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL-NH 122
             +      ++        LL         ++IP   L +  G+ + L Q    L +   
Sbjct: 63  PYIEQVHLMEVGPDGLGELLLHLSLGVLQSMIIP-FALVIFLGVVASLAQTKGFLWVPKK 121

Query: 123 VKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPH 182
           + P FK+++  EG KRI+S+N L+   K  +K+ ++G ++   L  +   + +  +    
Sbjct: 122 IAPDFKKLNPLEGYKRIFSVNQLMELGKQLIKLTVLGLLLGWVLWGSIGEIENLANLELM 181

Query: 183 SILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPII 242
           +IL +    +  ++++ L+ +  L V D  +   +W  K+KM+KQE+KDE KQ+ G+P +
Sbjct: 182 AILEYISDKIFWMVLVTLMMVTLLAVGDYLFQRWRWMEKMKMTKQEVKDEHKQAEGDPQV 241

Query: 243 KNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKK 302
           K + KS+   R R +MM A  +A ++ITNPTHYA+AL+Y      AP+LVAKG +L+AK+
Sbjct: 242 KAKIKSLRFQRARKRMMAAVPKADVVITNPTHYAVALKYDLDAMSAPILVAKGTDLVAKR 301

Query: 303 MRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           +R +A EH++PI E P +AR+LF  V ++  IPP  YKAVA++I
Sbjct: 302 IRDLADEHDVPIVENPPVARALFAAVELDQEIPPEHYKAVAEII 345


>gi|299131771|ref|ZP_07024966.1| flagellar biosynthetic protein FlhB [Afipia sp. 1NLS2]
 gi|298591908|gb|EFI52108.1| flagellar biosynthetic protein FlhB [Afipia sp. 1NLS2]
          Length = 356

 Score =  193 bits (490), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 114/344 (33%), Positives = 197/344 (57%), Gaps = 4/344 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYS-VTSDL 62
            +  ++KT+ P++K++EDA   G+   S E + +  ++A   +++  FS  I + +T  L
Sbjct: 3   EEGDEDKTQDPTAKRLEDAHKRGDVAKSIEVNTWF-MIAGATFIMSSFSGSIANKLTVPL 61

Query: 63  HVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNH 122
             LL  A + K +  S ++ +    ++  + L IP   L ++  +GS+LIQ  PV +++ 
Sbjct: 62  KNLLEHAGRMKTDGPSLLLLVGRLETVMLTALGIP-FALLIVAAVGSHLIQHRPVWSVDP 120

Query: 123 VKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPH 182
           + P F ++S   G KR++      NF K   K+I++G ++ + +   +      +  +P 
Sbjct: 121 ITPKFSKLSPMSGAKRLFGKQAAANFAKGLFKVIVLGVVMAMVMWPEHERADVMVRIDPS 180

Query: 183 SILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPII 242
            +L        K++  ++  +A +  LD  + Y  W+ + KMS QE+KDE KQS G+P I
Sbjct: 181 LMLDLTRSMALKLMGTVVAMLAIVATLDYLFQYRSWFERQKMSLQEVKDEYKQSEGDPHI 240

Query: 243 KNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKK 302
           K R +++  +R+R +MM A   A+++ITNPTHYA+AL+Y +    AP+ VAKG +LIA K
Sbjct: 241 KGRIRALRVARMRKRMMAAVPTASVVITNPTHYAVALKY-ERGMPAPICVAKGVDLIAFK 299

Query: 303 MRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           +R++A  H+IP+ E   LAR+L   V I+  IP   Y AVA++I
Sbjct: 300 IREVAAAHDIPVVENVPLARALHASVEIDDEIPVEHYHAVAEVI 343


>gi|254470232|ref|ZP_05083636.1| flagellar biosynthetic protein FlhB [Pseudovibrio sp. JE062]
 gi|211960543|gb|EEA95739.1| flagellar biosynthetic protein FlhB [Pseudovibrio sp. JE062]
          Length = 358

 Score =  192 bits (489), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 116/350 (33%), Positives = 194/350 (55%), Gaps = 10/350 (2%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+     KTE P+ K+++DA  +G+ P S+E S + S++   + + F     + SV++
Sbjct: 1   MAEDTDDSEKTEDPTQKRLDDAFEKGDIPKSQEVSSWFSLVGTALVISFLAPTMVSSVST 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L    A A    + D   +VFLL         +V   LL  M   +   ++Q  P+   
Sbjct: 61  ILKGFFAHADTIAV-DPGALVFLLEITGPEILGVVALPLLTLMALAVVGNVVQHKPLWTA 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +KP   ++S   G+KR++S ++L NF+K  VKII V   + + L       LD +   
Sbjct: 120 ERLKPKLNKISPLSGMKRLFSKDSLANFLKGLVKIIAVAAAVFLVLWPER-DRLDTVVFR 178

Query: 181 PHSILYHAFFTVRKVLIMIL-LFIATLTVL---DIGWSYHQWYSKLKMSKQEIKDEIKQS 236
              ++      VR++ IM++   +A +TV+   D+ W   +W+ K KM++QE+K+E KQS
Sbjct: 179 ETGLVLE---EVRELAIMVIGAILALMTVVAGADLVWQRKKWFEKQKMTQQEVKEEYKQS 235

Query: 237 YGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQ 296
            G+P IK + + +   R R++MM +   AT++ITNPTHYA+AL Y +    AP  VA G 
Sbjct: 236 EGDPKIKAKIRELRLQRSRNRMMASVPDATVVITNPTHYAVALSY-EEGMGAPQCVALGV 294

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           + +A ++R++A E ++PI E P LAR+L+  + +N  +P   Y AVA++I
Sbjct: 295 DDLALRIREVAKESDVPIVENPPLARALYASIELNDYVPEEHYAAVAKVI 344


>gi|209884540|ref|YP_002288397.1| flagellar biosynthetic protein FlhB [Oligotropha carboxidovorans
           OM5]
 gi|209872736|gb|ACI92532.1| flagellar biosynthetic protein FlhB [Oligotropha carboxidovorans
           OM5]
          Length = 355

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 116/348 (33%), Positives = 190/348 (54%), Gaps = 8/348 (2%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+   D+KT+ P++K++E+A   G+   S E + +  +      +  F      S+T 
Sbjct: 1   MAEDS--DDKTQDPTAKRLEEAHKRGDVAKSIEVNTWFMVAGATFVMSSFSDSVASSITV 58

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGL--LLFMMFGIGSYLIQRIPVL 118
            L  LL  A + +++  S    L     L    LV  GL  LL ++  I S+L+Q  PV 
Sbjct: 59  PLKNLLQHAGEMRVDGAS---LLQLAARLEIMLLVALGLPFLLLVIAAIASHLVQHRPVW 115

Query: 119 NLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFIS 178
           + + + P + ++S   G KR++      NF K   K+I +G ++ + +   +      + 
Sbjct: 116 STDPITPKWSKLSPLAGAKRLFGKQAAANFAKGLFKVITIGVVMAVVMWPEHERADAMVR 175

Query: 179 ANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYG 238
            +P  +L        K++  ++  +A +  LD  + Y  W+ + KMS QE+KDE KQS G
Sbjct: 176 LDPSLMLDLTRSMALKLMGTVVAMLALVAALDYLFQYRSWFERQKMSLQEVKDEYKQSEG 235

Query: 239 NPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL 298
           +P IK R +++  +R+R +MM A   A+++ITNPTHYA+ALRY +    AP+ VAKG +L
Sbjct: 236 DPQIKGRIRALRMARVRKRMMAAVPTASVVITNPTHYAVALRY-ERGMPAPICVAKGVDL 294

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           IA K+R++A  H++PI E   LAR+L   V I+  IP   Y AVA++I
Sbjct: 295 IAFKIREVATAHDVPIVENVPLARALHASVEIDDEIPVEHYHAVAEVI 342


>gi|74317263|ref|YP_315003.1| flagellar biosynthetic protein FlhB [Thiobacillus denitrificans
           ATCC 25259]
 gi|74056758|gb|AAZ97198.1| Flagellar biosynthetic protein FlhB [Thiobacillus denitrificans
           ATCC 25259]
          Length = 390

 Score =  190 bits (482), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 110/356 (30%), Positives = 191/356 (53%), Gaps = 17/356 (4%)

Query: 3   ENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDL 62
           E+D    +TEAPS +++E A  EG    SRE + F         +L      ++++ S L
Sbjct: 4   ESD--QERTEAPSPQRLEKAREEGQVLQSRELATF--------VVLMTGGAALWAMASQL 53

Query: 63  HVLLASATQRKLE-------DISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRI 115
              L+   +  L+       D +H++  L+     A+  + P LLL ++    S ++ R 
Sbjct: 54  GQTLSQIVRGGLQFHPAVARDSAHVMTQLSQQFFDATLALAPFLLLVVIATFASPILLRG 113

Query: 116 PVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLD 175
            + +     P FKR+S   G KR++S   LV  +K+  K+ L+G +    +  N   ++ 
Sbjct: 114 WLFSTKAFMPDFKRLSPLAGFKRMFSSQGLVELVKALAKVGLLGGVAAWLVWSNVEAIVS 173

Query: 176 FISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQ 235
                P + + H    + KV ++    +  + VLD+ +    +Y+KLKM+K++++ E K+
Sbjct: 174 LSLEAPTAAIGHMGDIIGKVFLLASGAMIFIVVLDLPYQLWNFYNKLKMTKEQLRQEAKE 233

Query: 236 SYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKG 295
           S G+P +K R ++  R   R +MM     A +++TNPTHYA+AL+Y + +  AP +VAKG
Sbjct: 234 SEGDPHVKARIRAQQREVARRRMMAEVPSADVVVTNPTHYAVALKYSEGKMGAPRVVAKG 293

Query: 296 QNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            +L+A K+R+IA EH +P+ E P LAR+LF+   I + IP   Y AVA+++  ++ 
Sbjct: 294 ADLVAAKIREIAAEHRVPLLEAPPLARALFRHTDIGNEIPATLYAAVAEVLAYVFQ 349


>gi|163794129|ref|ZP_02188102.1| flagellar biosynthesis protein B [alpha proteobacterium BAL199]
 gi|159180743|gb|EDP65262.1| flagellar biosynthesis protein B [alpha proteobacterium BAL199]
          Length = 358

 Score =  190 bits (482), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 115/354 (32%), Positives = 203/354 (57%), Gaps = 3/354 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIY-SVT 59
           MS++     KTE P+ KK+ DA  +G    S+E + F+S+LA L + +   +P +   + 
Sbjct: 1   MSDSQDDSQKTEEPTGKKLGDARKKGQIAQSKEVTNFASLLA-LTFAVTILAPYMAIQLY 59

Query: 60  SDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLN 119
           S + V++  A   ++ D      +L  L +     + P L   M+ G+ + L Q   +  
Sbjct: 60  SSMAVVIEHAAVARI-DAGSTSEILMGLVIDTFLALAPTLGTVMVLGVAATLGQSGILFT 118

Query: 120 LNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISA 179
            + + P  +++S   G KR++S+ ++V F+K  +K+ +V  I  + ++       + ++ 
Sbjct: 119 TDPIMPKLEKLSPLAGFKRLFSLKSIVEFIKGIIKLAIVAFIAYVLMSPELDRAEELLTM 178

Query: 180 NPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
           +   +L      V ++++ +L F+A + + D  +  ++ Y +L+MS+Q+I+DE KQ+ G+
Sbjct: 179 DLIEVLKEIQTLVIRLMMGVLAFMAVVAIADYIYQRYEHYKQLRMSRQDIRDEHKQAEGD 238

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLI 299
           P IK R + I   R R +MM A  +A ++ITNPTH+A+AL+Y  +   APV+VAKG + +
Sbjct: 239 PQIKARLRQIRADRARRRMMAAVPKADVVITNPTHFAVALQYDTSAMAAPVVVAKGSDAV 298

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A ++R++A EH +PI E P LAR+LF  V I+  IP  +YKAVAQ+I  +Y  K
Sbjct: 299 AFRIREVAKEHKVPIVENPPLARALFASVEIDEQIPETYYKAVAQVISYVYRLK 352


>gi|253688980|ref|YP_003018170.1| flagellar biosynthetic protein FlhB [Pectobacterium carotovorum
           subsp. carotovorum PC1]
 gi|251755558|gb|ACT13634.1| flagellar biosynthetic protein FlhB [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 383

 Score =  189 bits (481), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 114/353 (32%), Positives = 190/353 (53%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D+   KTEAP+ +K E A  EG  P SRE    +S+L  +  L   +  G  ++   L 
Sbjct: 3   DDSDLEKTEAPTPQKEEKAREEGQIPRSRE---LTSVLMMVAGLAILWIGG-DAMAGRLA 58

Query: 64  VLLASATQRKLEDISHIVFLLTHLS---LSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +++ +       I     +L H+      A+  +IP +   ++  + + L+    + + 
Sbjct: 59  RIVSQSLNFDYATIGDDTQMLRHVGSLLRQAASALIPIMFGAVLVALSAPLLLGGVLFST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K +FK++    G+KR++S  +L    K+ +K ++VG I T+ L  N+  +L  IS +
Sbjct: 119 KSLKVNFKKLDPISGLKRLFSAQSLAELFKAILKSVMVGIISTLFLIHNWPKILHLISES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P S L  A         +I++ +  +   D+ W       KL+MSKQEI+DE KQS G+P
Sbjct: 179 PISALGDALELAVMCGFLIIMGLIPMVAFDVFWQVWSHIKKLRMSKQEIRDEHKQSEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  + +MM    +A +I+TNPTHYA+ALRY + + +AP ++AKG   IA
Sbjct: 239 HVKGRIRQQQRAIAQRRMMADVPKADVIVTNPTHYAVALRYDEKKMNAPKVLAKGAGEIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++  EH +PI E P LAR+LF+   I   IP   Y AVA+++  +Y  K
Sbjct: 299 LRIRELGTEHRVPILEAPPLARALFRHSEIGEHIPAALYAAVAEVLAWVYQLK 351


>gi|261821144|ref|YP_003259250.1| flagellar biosynthesis protein FlhB [Pectobacterium wasabiae
           WPP163]
 gi|261605157|gb|ACX87643.1| flagellar biosynthetic protein FlhB [Pectobacterium wasabiae
           WPP163]
          Length = 383

 Score =  189 bits (480), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 111/353 (31%), Positives = 188/353 (53%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+   KTEAP+ +K E A  EG  P SRE    +S+L  +  L   +  G  ++   L 
Sbjct: 3   EDSDLEKTEAPTPQKEEKAREEGQVPRSRE---LTSVLMMVAGLAILWMGG-DAMAGRLA 58

Query: 64  VLLASATQRKLEDISHIVFLLTHLSL---SASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           V++A +       I     +L H+      A+  +IP +L  ++  + + ++    + + 
Sbjct: 59  VIVAQSLNFDYATIGDDTQMLRHVGSLLHQAASALIPIMLGSVLVALSAPMLLGGILFST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K  FK++    G+KR++S  +L    K+ +K ++VG I T+ L  N+  +L  +S  
Sbjct: 119 KSLKVDFKKLDPISGLKRLFSAQSLAELFKAILKSVMVGVISTLFLIHNWPKILHLVSEA 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + L  A         +I++ +  +   D+ W       KL+M+KQEI+DE KQS G+P
Sbjct: 179 PIAALGDALELAVMCGFLIIMGLIPMVAFDVFWQVWSHIKKLRMTKQEIRDEHKQSEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  + +MM    +A +I+TNPTHYA+ALRY   + +AP ++AKG   IA
Sbjct: 239 HVKGRIRQQQRAMAQRRMMADVPKADVIVTNPTHYAVALRYDDKKMNAPKVLAKGAGEIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++  +H +PI E P LAR+LF+   +   IP   Y AVA+++  +Y  K
Sbjct: 299 LRIRELGIDHRVPILEAPPLARALFRHSEVGEHIPAALYAAVAEVLAWVYQLK 351


>gi|167645349|ref|YP_001683012.1| flagellar biosynthesis protein FlhB [Caulobacter sp. K31]
 gi|167347779|gb|ABZ70514.1| flagellar biosynthetic protein FlhB [Caulobacter sp. K31]
          Length = 360

 Score =  189 bits (479), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 104/350 (29%), Positives = 192/350 (54%), Gaps = 10/350 (2%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++    +KTE P++KK+ DA  +G+ P S + S  +S+      ++         + +
Sbjct: 1   MADDQDEASKTEEPTAKKLSDARAKGDVPKSADISQLASLSGAFGVVVIAGGWLTRDLVN 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFM----MFGIGSYLIQRIP 116
            L    A A    +E        +  ++ +A    +P L+L M    + G  + + Q   
Sbjct: 61  QLTPFFAHAGTMDVEG------GVNAIAKTAVMAALPALVLVMVVSGLLGAAANVAQSGF 114

Query: 117 VLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDF 176
           +L+ + +KP  +++ + +G+KR++ ++  V F KS VK ++ G I    +  +   + + 
Sbjct: 115 ILSADKIKPDLQKLDIIKGLKRVFGMDGFVQFAKSAVKFLVTGLIAWYVVKPDAAQIPNL 174

Query: 177 ISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQS 236
           +  +  +I+  +     K+  M+L+F+      D  W   ++  +++MS Q+IKDE KQS
Sbjct: 175 VGMDVGAIIPLSMKLCTKLFWMVLIFLMATAGFDWFWQRLRFNKRMRMSLQDIKDEHKQS 234

Query: 237 YGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQ 296
            G+P +K +QK +   R R +MM A  +AT++I NPTHYA+AL+Y Q EN AP+ VAKG 
Sbjct: 235 EGDPHVKGKQKQLRMQRSRQRMMAAVPKATVVIMNPTHYAVALKYEQGENAAPICVAKGV 294

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           + +A ++R +A E  + I E+P LAR+L+  + ++  IP   ++AVA++I
Sbjct: 295 DDLALRIRAVAEEAGVYILEDPPLARALYAAMDVDEQIPAEHFEAVAKVI 344


>gi|84502407|ref|ZP_01000543.1| putative flagellar biosynthetic protein flhB [Oceanicola batsensis
           HTCC2597]
 gi|84389219|gb|EAQ02016.1| putative flagellar biosynthetic protein flhB [Oceanicola batsensis
           HTCC2597]
          Length = 374

 Score =  189 bits (479), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 110/350 (31%), Positives = 194/350 (55%), Gaps = 4/350 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+   NKTE P+ +K+  A  +G+ P SRE     S+++  +  +FF      ++  
Sbjct: 1   MAENEDQTNKTEEPTPRKLRQAREKGDVPSSREVGNMMSVMSLFLVAIFFLPQLGPTLVG 60

Query: 61  DLHVLLASATQRKL-EDISHIVFL---LTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIP 116
            L  +  +A Q ++ ED+  +  L      LS   + ++ P     ++  + + LIQ   
Sbjct: 61  TLRRVFENAGQVRIGEDVQGLRDLGQVTMELSGGLATVLAPVAATMLLAAVAAVLIQGEV 120

Query: 117 VLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDF 176
           V+ ++ + P   +++  +G K+I+SI++ V F+KS  K+++VG I           +   
Sbjct: 121 VVAVDRITPKLSKINPIQGFKKIFSIDSFVEFLKSVAKVLVVGGISIYIAQIAVRGIWQT 180

Query: 177 ISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQS 236
               P S+L +       +LI + L +  L+V D+ W   QW  K +MS QEI+DE K+ 
Sbjct: 181 EGVTPESVLSYIGRYAALLLITVTLLLTVLSVADVMWKRFQWMKKQRMSVQEIRDEHKEM 240

Query: 237 YGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQ 296
            G+P+I+ ++    R R + ++  A  +AT+++TNPTH+A+ALRY    + APV VAKG 
Sbjct: 241 EGDPLIRAKRAEQRRKRAQQRITTAVPQATVVLTNPTHFAVALRYDNGTDQAPVCVAKGV 300

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           +L+A ++RK+A E+ +P+ E   LAR+L+    I+  IP   ++AVA++I
Sbjct: 301 DLMAAQVRKVARENEVPVVENKPLARALYDVAEIDEEIPFEHWQAVAEII 350


>gi|306820134|ref|ZP_07453782.1| flagellar biosynthetic protein FlhB [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
 gi|304551912|gb|EFM39855.1| flagellar biosynthetic protein FlhB [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
          Length = 379

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 125/358 (34%), Positives = 198/358 (55%), Gaps = 26/358 (7%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISRE----ASLFSSILACLIYLLFFFSPGIYSVTSD--- 61
            KTE  + KK ED   +GN   SRE    ASLF+++ A     +  FS  I  V  D   
Sbjct: 27  EKTEEATPKKKEDTRKKGNVLQSRELTGAASLFAAVFA-----INTFSKEILKVIVDAWN 81

Query: 62  --LHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLN 119
               +L +     +++       LL     +   ++IP +L+       ++L+Q+  V N
Sbjct: 82  YYTGMLNSFELTNQMQAYKLFTTLLIFCVKAMLFIIIPVVLV-------AFLVQKAQVGN 134

Query: 120 L---NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDF 176
           +     ++P  +R+S+  G KR++S+ + V  +KS +KI+LVG +    + +N   ++  
Sbjct: 135 IFTAETIRPKLERISILSGFKRMFSMQSTVTLIKSLLKIMLVGYVGYAYIKDNMPLVMKS 194

Query: 177 ISANPHSILYHAF-FTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQ 235
            S N     Y  F F++   L M+ + IA L + D  +  H +   ++MSKQEIKDE KQ
Sbjct: 195 FSLNDKQFSYMLFHFSINMALRMVYVIIA-LGIFDYVYQRHSYNKNIRMSKQEIKDEYKQ 253

Query: 236 SYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKG 295
           S G+P IK++ K   R     +MM+   +A +IITNPTH+A+AL+Y + + DAP +VAKG
Sbjct: 254 SEGDPQIKSKIKERQRQSAMRRMMQDLPKADVIITNPTHFAVALKYDEDKYDAPYVVAKG 313

Query: 296 QNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           Q+ IAKK+R+ A E +IPI E   LAR+L+ ++ I S I P  Y+AVA+++  I+  K
Sbjct: 314 QDFIAKKIREKAKELDIPIVENKPLARALYSEIDIGSVITPQLYEAVAEVLAYIFSLK 371


>gi|311279222|ref|YP_003941453.1| flagellar biosynthetic protein FlhB [Enterobacter cloacae SCF1]
 gi|308748417|gb|ADO48169.1| flagellar biosynthetic protein FlhB [Enterobacter cloacae SCF1]
          Length = 387

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 107/367 (29%), Positives = 198/367 (53%), Gaps = 29/367 (7%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLF----------- 49
           +++N   ++KTEAP+ ++++ A  EG  P SRE +    +L  +  L F           
Sbjct: 4   VADNSDSEDKTEAPTPQRLDKAREEGQIPRSRELTSLLILLVGVCVLWFGGESMARRLAA 63

Query: 50  FFSPGIY---SVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFG 106
             S G++   S+ +D +++L        + +  ++ L+T + + A  +V P +L  ++F 
Sbjct: 64  LLSSGLHFDHSIVNDPNLILGQIILLIKQAMLALLPLITGVVVVA--IVAPMMLGGLVFS 121

Query: 107 IGSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISL 166
             S   +             F +++   GIKR++S  +    +K+ +K +LVG +    +
Sbjct: 122 PKSLAFK-------------FDKLNPLPGIKRLFSAQSAAELLKAILKSVLVGCVAGTYV 168

Query: 167 TENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSK 226
             ++  M+  IS +P + + +A   V    +++ L +  +   D+ W  H    KL+MS+
Sbjct: 169 WSHWPDMMRLISESPLAAMGNALNMVGLCAMLVALGVIPMVGFDVFWQIHSHIKKLRMSR 228

Query: 227 QEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEN 286
           Q+I+DE KQ+ G+P +K R + + R+  R +MM    +A +I+TNPTHY++AL+Y++ + 
Sbjct: 229 QDIRDEFKQNEGDPHVKGRIRQMQRAAARRRMMGDVPKADVIVTNPTHYSVALQYVEGKM 288

Query: 287 DAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
            AP +VAKG  LIA ++R+I  EH +P+ E P LAR+L++   I   IP   Y AVA+++
Sbjct: 289 SAPKVVAKGAGLIALRIREIGQEHRVPVLEAPPLARALYRHAEIGQQIPGTLYAAVAEVL 348

Query: 347 YKIYHKK 353
             ++  K
Sbjct: 349 AWVWQLK 355


>gi|209963536|ref|YP_002296451.1| flagellar biosynthetic protein FlhB [Rhodospirillum centenum SW]
 gi|209957002|gb|ACI97638.1| flagellar biosynthetic protein FlhB [Rhodospirillum centenum SW]
          Length = 373

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 114/350 (32%), Positives = 188/350 (53%), Gaps = 8/350 (2%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE      KTE P+ +K+++A  +G+ P+SRE S    +LA +I +    S     +T 
Sbjct: 1   MSERPEDSQKTEEPTQRKLDEARRKGDVPVSREVSSMMLVLAGVILVGGLGSWMGGHLTD 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           DL  L+ +     L+  +    LL  L+     +++P   + +   + + + Q   V   
Sbjct: 61  DLLPLVENPGDFPLQAPADAFRLLAWLAGEIGLVLLPAAAILLAAVLLAAVGQNGIVFTT 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTM----LDF 176
             +KP  +R+S   G++R+ S+  LV F+K   K+  VG  + + L      M    L  
Sbjct: 121 ERLKPKLERISPIAGLRRLVSLRTLVEFLKGLAKVAAVGAALLVVLEPELHRMEALALTD 180

Query: 177 ISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQS 236
           ++A P   L  +  T  ++L+  L+    + +LD+ W    W  + +M+ QE+K+E +Q+
Sbjct: 181 VAALPE--LLTSVLT--RLLVATLIASIAIALLDLVWQQFSWRRQQRMTLQELKEEFRQA 236

Query: 237 YGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQ 296
            G+P +K R   + R R R +M     RAT++ITNPTH+A+ALRY  +E  APV +AKG 
Sbjct: 237 EGDPHVKARISQLRRERARQRMFSDIPRATVVITNPTHFAVALRYDLSEAPAPVCLAKGM 296

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           +L+A+++R+ A  H +PI E P LAR+L K V I   + P  Y AVA++I
Sbjct: 297 DLVARRIREAAMGHKVPIVENPPLARALHKSVEIGEEVQPEHYMAVAEVI 346


>gi|291278828|ref|YP_003495663.1| flagellar biosynthetic protein FlhB [Deferribacter desulfuricans
           SSM1]
 gi|290753530|dbj|BAI79907.1| flagellar biosynthetic protein FlhB [Deferribacter desulfuricans
           SSM1]
          Length = 359

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 122/364 (33%), Positives = 203/364 (55%), Gaps = 23/364 (6%)

Query: 2   SENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFF-------FSPG 54
            +NDA   +TE  + ++ + A  EGN P SRE S     L  +I+L F+       FS  
Sbjct: 3   EKNDA--ERTEEATPRRRQKAREEGNVPKSRELSTAIIFLISVIFLYFYTPILIDNFSKL 60

Query: 55  IYSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLL-FMMFGIGSYLIQ 113
           I    S +   L+ +   +L +     +L     L A  LV+ GLL+    FG       
Sbjct: 61  ISHTLSKVGYTLSKSATVELFNFVFQFYLKVLFPLFAL-LVVAGLLVNVAQFGF------ 113

Query: 114 RIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTM 173
              +++   ++P + R++   G++ ++S  +LV  +KS  KI +VG +  I +      +
Sbjct: 114 ---LISPKALEPKWDRLNPINGLQNLFSKRSLVELIKSIFKIFVVGFVAYIIVRGKIGVI 170

Query: 174 LDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEI 233
           L+   A+P S +      V ++   I L I  +++LD  +   Q+   LKM+KQE+K+E 
Sbjct: 171 LNLADADPFSSMVFFGKLVFELCFKIGLLILLMSILDFFYQKWQYEQDLKMTKQEVKEEF 230

Query: 234 KQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVA 293
           KQ  G+P+I+ R +S+ R   R +MME   +A ++ITNPTHYA+A++Y   ++ APV+VA
Sbjct: 231 KQMEGDPLIRQRIRSMQREMARKRMMEEVPKADVVITNPTHYAVAIKYDINKDRAPVVVA 290

Query: 294 KGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQ---LIYKIY 350
           KGQ L+A+K+++IA E+ + I E+P LAR+L+ QV I   IP   YKA+A+   ++YK+ 
Sbjct: 291 KGQRLMAQKIKEIAKENGVFIHEDPPLARTLYSQVEIGDEIPENLYKAIAEILAIVYKMK 350

Query: 351 HKKI 354
           +K++
Sbjct: 351 NKRV 354


>gi|83858790|ref|ZP_00952312.1| flagellar biosynthesis protein [Oceanicaulis alexandrii HTCC2633]
 gi|83853613|gb|EAP91465.1| flagellar biosynthesis protein [Oceanicaulis alexandrii HTCC2633]
          Length = 358

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 112/353 (31%), Positives = 187/353 (52%), Gaps = 15/353 (4%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E +    KTE P+ +K+  A  EG+ P S+E S + ++ A L  +L F +PG+ +  +
Sbjct: 1   MAEGEDKSEKTEEPTDRKLRQAREEGDVPKSQEVSGWFTLTAGL-AMLAFLAPGMVTNLA 59

Query: 61  D-LHVLLASATQRKLEDISHIVFLLTHLSLSASRLVI------PGLLLFMMFGIGSYLIQ 113
           + L V LA   +  ++    +    T  + +A RLV+        LL+  +FG    L+Q
Sbjct: 60  EMLLVFLAQPHELAVDPTGAV----TLAAATAMRLVLVVGLAFATLLVAAIFG---NLVQ 112

Query: 114 RIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTM 173
              +     + P   ++   +G+ R++     +NF K   K+ +VG  I   L      +
Sbjct: 113 TGVMFTPKKIAPKLDKLDPIKGLTRMFGPEGWMNFFKGVGKMTIVGLAIAAVLWPRRNEL 172

Query: 174 LDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEI 233
                  P  IL   +    +++I  L+    + VLD  +   Q+  + KMS++EI+DE+
Sbjct: 173 AVLPGVAPIGILQEVYSAAIQLMIAALIAYTAIAVLDFLFQRKQYIDRHKMSRKEIRDEM 232

Query: 234 KQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVA 293
           K + G+P+I+ + + I + R + +MM     A ++ITNPTHYA+AL Y Q    AP+ VA
Sbjct: 233 KDTEGDPMIRAKLRQIRQERAQRRMMARVPDAAVVITNPTHYAVALEYEQGRTPAPICVA 292

Query: 294 KGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           KG + +A ++R +A EH+IPI E+P LAR LF  V +   IPP  + AVA++I
Sbjct: 293 KGTDEVALRIRALAEEHDIPIVEDPPLARGLFASVELEEVIPPEHFTAVAKII 345


>gi|313672722|ref|YP_004050833.1| flagellar biosynthetic protein flhb [Calditerrivibrio nitroreducens
           DSM 19672]
 gi|312939478|gb|ADR18670.1| flagellar biosynthetic protein FlhB [Calditerrivibrio nitroreducens
           DSM 19672]
          Length = 353

 Score =  187 bits (476), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 112/353 (31%), Positives = 199/353 (56%), Gaps = 4/353 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M +ND+  ++TE  + ++ + A+ EGN P SRE S   + L  ++ L F+    +    +
Sbjct: 1   MPDNDS--DRTEEATPRRKQKAIEEGNVPRSRELSTGITFLIAVLILYFYIPSMVEEFKT 58

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           D     +    R  ++ +++  LL  +  S +++ +P L + +   I + ++Q   V + 
Sbjct: 59  DFIRYFSMYNYRINKESAYL--LLIEVIKSMAKVTLPLLFVLVFVAILANIVQFGVVFSS 116

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++  + R++   G  R++S  +L   +KS +KI L+G    + +     T+L    A+
Sbjct: 117 KVLELKWDRLNPISGFGRLFSKKSLFELLKSILKISLIGFAAFLIIKSKIPTILTLADAD 176

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             S ++     + +V   + + I  + ++D  +   Q+Y  LKM+KQE+K+E KQ  G+P
Sbjct: 177 AVSSIHFLGKLIYEVSFKLAIIIMVIALIDFLYQRWQYYEDLKMTKQEVKEEFKQMEGDP 236

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           +IK R +S+ R   R +MME   +A ++ITNPTHYA+A++Y   ++ AP +VAKGQ LIA
Sbjct: 237 LIKQRIRSMQREMARKRMMEEVPKADVVITNPTHYAVAIKYDMAKDRAPKVVAKGQRLIA 296

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA ++N+ I E+P LAR+L+  V I   IP   YKAVA+++  +Y  K
Sbjct: 297 LKIREIASKNNVLIHEDPPLARTLYSSVEIGEEIPENLYKAVAEILAMVYRLK 349


>gi|117923329|ref|YP_863946.1| flagellar biosynthetic protein FlhB [Magnetococcus sp. MC-1]
 gi|117607085|gb|ABK42540.1| flagellar biosynthetic protein FlhB [Magnetococcus sp. MC-1]
          Length = 355

 Score =  187 bits (476), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 116/355 (32%), Positives = 193/355 (54%), Gaps = 6/355 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++ D  D+KTE P+SK++ D+ N+G    S+E      +LA L   L   +    ++  
Sbjct: 1   MADEDK-DSKTEEPTSKRLSDSRNKGQVVSSKEVPTALLMLAALAVFLVQGNELWQALQR 59

Query: 61  DLHVLLASATQRKLEDIS--HIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVL 118
            +H  L+       +DI+   +  +   +  +    + P   LF++  I S LIQ   ++
Sbjct: 60  KMHFFLSGQIS---DDITPTGVSLIFNEIIRAVVMDLAPFFALFLVVAIISGLIQHGWLI 116

Query: 119 NLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFIS 178
               + P F +V+  +G+KR++S+ +LV   KS VKI ++   + +++  N   +L    
Sbjct: 117 TFEPLMPKFSKVNPLQGLKRLFSVRSLVEAFKSIVKIFVISFAVYLAMRNNIDQILGLAD 176

Query: 179 ANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYG 238
                     F    ++L  + L    + VLD  +    +   L+MSKQEIKDE+KQ  G
Sbjct: 177 TTITEFTTLMFKDSLEILWRVTLAFLLIAVLDFIYQKFDYIKGLRMSKQEIKDEMKQMEG 236

Query: 239 NPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL 298
           +P++K R + I R   + +MM+   +A +IITNPTHYA AL+Y   +  AP LVAKG+ L
Sbjct: 237 DPLLKGRIRQIQRELAQSRMMQEVPKADVIITNPTHYACALQYTPGQMSAPKLVAKGKGL 296

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           IA ++R++A E+NIP  E P LAR+L++ V +   IPP  +KAVA+++  ++  K
Sbjct: 297 IAARIRELADENNIPRVENPPLARTLYRDVELEQFIPPELFKAVAEVLAYVFSLK 351


>gi|85716547|ref|ZP_01047517.1| flagellar biosynthesis protein [Nitrobacter sp. Nb-311A]
 gi|85696548|gb|EAQ34436.1| flagellar biosynthesis protein [Nitrobacter sp. Nb-311A]
          Length = 359

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 113/347 (32%), Positives = 191/347 (55%), Gaps = 4/347 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++      KTE P+ K+++DAL  G+   S+E + + +I    + L  F          
Sbjct: 1   MADESDDTEKTEDPTQKRLDDALERGDVAKSQEVNAWFAIAGATLVLSTFAGSIGDGFRM 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLS-ASRLVIPGLLLFMMFGIGSYLIQRIPVLN 119
            L  L+A++ Q +  D   ++ L   +    A+ L +P LLL  M  +   ++Q   V +
Sbjct: 61  PLRNLIANSWQIR-TDGPGLLALAEQIGYCLAAALGVP-LLLLTMAAVAGNVVQHRFVWS 118

Query: 120 LNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISA 179
              +KP   ++S+  G KRI+    + NF K   K++ +G ++T  L      +   +  
Sbjct: 119 GETLKPKLSKISVVSGAKRIFGKQAVANFAKGLFKVLALGAVMTAVLWPERSRLDAMVRL 178

Query: 180 NPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
           +P+++L        ++L  +++ +A + + D  + Y QW+ + KMS +E+K+E KQS G+
Sbjct: 179 DPNALLGITKSLTLQLLGAVMVMLALVAIADYLFQYRQWFERQKMSLREMKEEFKQSEGD 238

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLI 299
           P IK R + +   R++ +MM A  +A++IITNPTHY++AL Y +    APV VAKG + I
Sbjct: 239 PHIKARIRQLRHVRMKKRMMAAVPQASVIITNPTHYSVALSY-ERGMSAPVCVAKGVDNI 297

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           A K+R+IA EH+IP+ E   LAR+L+  V I+  IP   Y AVA++I
Sbjct: 298 ALKIREIAREHDIPVVENVPLARALYAAVEIDDEIPVEHYHAVAEII 344


>gi|75675330|ref|YP_317751.1| flagellar biosynthesis protein FlhB [Nitrobacter winogradskyi
           Nb-255]
 gi|74420200|gb|ABA04399.1| Flagellar biosynthetic protein FlhB [Nitrobacter winogradskyi
           Nb-255]
          Length = 359

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 117/348 (33%), Positives = 195/348 (56%), Gaps = 6/348 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++      KTE P+ K+++DAL  G+   S+E + +  ++A    +L  FS  I S   
Sbjct: 1   MADESDDTEKTEDPTQKRLDDALERGDVAKSQEVNTWF-VIAGATLVLSTFSGSIGSGFE 59

Query: 61  -DLHVLLASATQRKLEDISHIVFLLTHLSLS-ASRLVIPGLLLFMMFGIGSYLIQRIPVL 118
             L  L+A++ Q +  D   ++ L   +    A+ L +P LLL MM  +   +IQ   V 
Sbjct: 60  LPLRNLIANSWQIR-TDGPGLLALAEQIGYRLAAALGVP-LLLLMMAAVAGNVIQHRFVW 117

Query: 119 NLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFIS 178
           +   +KP   ++S+  G KRI+      NF K   K++ +G ++T  L      +   + 
Sbjct: 118 SGETLKPKLSKISMVSGAKRIFGKQAAANFAKGLFKVLALGAVMTAVLWPERSRLDAMVR 177

Query: 179 ANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYG 238
            +P+++L        ++L  +++ +A + + D  + Y QW+ + KMS +E+K+E KQS G
Sbjct: 178 LDPNALLGITKSLTLQLLGAVIVMLALVAIADYLFQYRQWFERQKMSLREMKEEFKQSEG 237

Query: 239 NPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL 298
           +P IK R + +   R++ +MM A  +A++IITNPTHY++AL Y +    APV VAKG + 
Sbjct: 238 DPHIKARIRQLRHVRMKKRMMAAVPQASVIITNPTHYSVALSY-ERGMSAPVCVAKGVDN 296

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           IA K+R+IA EH+IP+ E   LAR+L+  V I+  +P   Y AVA++I
Sbjct: 297 IALKIREIAREHDIPVVENVPLARALYAAVEIDDEVPVEHYHAVAEII 344


>gi|227328329|ref|ZP_03832353.1| flagellar biosynthesis protein FlhB [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 383

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 111/353 (31%), Positives = 188/353 (53%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+   KTEAP+ +K E A  EG  P SRE    +S+L  +  L   +  G  ++   L 
Sbjct: 3   EDSDLEKTEAPTPQKEEKAREEGQIPRSRE---LTSVLMMVAGLAILWMGG-DAMAGRLA 58

Query: 64  VLLASATQRKLEDISHIVFLLTHLS---LSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +++ +       I     +L H+      A+  +IP +L  ++  + + L+    + + 
Sbjct: 59  RIVSQSLNFDYATIGDDTQMLRHVGSLLRQAASALIPIMLGAVLVALSAPLLLGGILFST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K  FK++    G+KR++S  +L    K+ +K ++VG I T+ L  N+  +L  +S  
Sbjct: 119 KSLKVDFKKLDPISGLKRLFSAQSLAELFKAILKSVMVGIISTLFLIHNWPKILHLVSEA 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + +  A         +I++ +  +   D+ W       KL+MSKQEI+DE KQS G+P
Sbjct: 179 PIAAMGDALELAVMCGFLIIMGLIPMVAFDVFWQVWSHIKKLRMSKQEIRDEHKQSEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  + +MM    +A +I+TNPTHYA+ALRY + + +AP ++AKG   IA
Sbjct: 239 HVKGRIRQQQRAIAQRRMMADVPKADVIVTNPTHYAVALRYDEKKMNAPRVLAKGAGEIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++  EH +PI E P LAR+LF+   +   IP   Y AVA+++  +Y  K
Sbjct: 299 LRIRELGAEHRVPILEAPPLARALFRHSEVGQHIPAALYAAVAEVLAWVYQLK 351


>gi|288962718|ref|YP_003453012.1| flagellar biosynthetic protein [Azospirillum sp. B510]
 gi|288914984|dbj|BAI76468.1| flagellar biosynthetic protein [Azospirillum sp. B510]
          Length = 359

 Score =  186 bits (472), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 118/358 (32%), Positives = 204/358 (56%), Gaps = 24/358 (6%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D  + KTE P+ K++ +A  +G+ P +R+  L S+++A  + +L   +PG+ S  S
Sbjct: 1   MAEQD-DEQKTEEPTEKRLREAAEKGDVPRARDVGLLSAMVAAWMIVLMA-APGVASNLS 58

Query: 61  DLHV-LLASATQRKLE----DISH-IVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQR 114
            L + L+ +    +++    D+ H + +L+  ++++    ++P L + ++  + S L Q 
Sbjct: 59  ALLLPLIENPDDIRIDGGAIDVIHSLAWLIGGVAVA----LLPVLGILLVGAVVSALGQG 114

Query: 115 IPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIIT------ISLTE 168
             V+  + ++P +  +S   G KR+     LV F KS VK+ ++           I+ TE
Sbjct: 115 PFVVASDRIRPKWSHLSPAAGWKRMAGRPALVEFAKSLVKLAIISAAAWRALAPYIAWTE 174

Query: 169 NYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQE 228
           +   M   ++  P+ +L      +   +++  + +A + VL   W+  +W  +L+MS QE
Sbjct: 175 DTVGM--DVAGLPN-LLRDVTLRLLLAVLLATVLMAAVDVL---WNRLEWRRRLRMSPQE 228

Query: 229 IKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDA 288
           IKDE KQ  G+P  K R + I RSR + +MM    RAT++ITNPTH+A+AL Y +    A
Sbjct: 229 IKDEFKQIEGDPNAKARLRDIRRSRSKKRMMANVPRATVVITNPTHFAVALEYERGRTAA 288

Query: 289 PVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           P+ +AKG +LIA ++R +A EH IPI E P LAR+L  Q  +++AIP   Y+AVA++I
Sbjct: 289 PICLAKGADLIALRIRALAQEHGIPIVENPPLARALHAQAEVDAAIPLQHYQAVAEVI 346


>gi|39936944|ref|NP_949220.1| flagellar biosynthesis protein FlhB [Rhodopseudomonas palustris
           CGA009]
 gi|192292772|ref|YP_001993377.1| flagellar biosynthesis protein FlhB [Rhodopseudomonas palustris
           TIE-1]
 gi|39650801|emb|CAE29324.1| putative flagellar biosynthetic protein flhB [Rhodopseudomonas
           palustris CGA009]
 gi|192286521|gb|ACF02902.1| flagellar biosynthetic protein FlhB [Rhodopseudomonas palustris
           TIE-1]
          Length = 357

 Score =  186 bits (472), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 113/348 (32%), Positives = 194/348 (55%), Gaps = 8/348 (2%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE+   D KTE P+ K+++DAL  G+   S+E + +  I    + L  F       + +
Sbjct: 1   MSEDS--DEKTEEPTQKRLDDALKRGDVVKSQEVNTWFLIAGATLVLSSFHESIGTGILA 58

Query: 61  DLHVLLASATQRKLEDISHIVFL--LTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVL 118
            +  L+  +   +++    I     L++ +L+A  + IP LL+ ++  I S +IQ   V 
Sbjct: 59  PMRNLIEKSWMLRVDGDGLIALAKSLSYATLAA--IGIP-LLMLVIVAIASNMIQHRLVF 115

Query: 119 NLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFIS 178
           +   + P F ++S  EG KR++    + NF+K   KI+ +G ++   L   +  +   + 
Sbjct: 116 SAEALTPKFSKLSPLEGAKRLFGKQAMANFLKGLFKIVALGIVMVAVLYPEHDRLDALLK 175

Query: 179 ANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYG 238
            +  ++L        K+L  ++  +A + V D  + Y QW+ K KMS QEIK+E KQS G
Sbjct: 176 MDVSALLGVTVALTLKLLGAVVAMLAFVAVGDYFFQYRQWHEKQKMSLQEIKEEFKQSEG 235

Query: 239 NPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL 298
           +P IK R + +   R++ +MM     A+++ITNPTH+++AL+Y +    AP+ VAKG + 
Sbjct: 236 DPHIKGRLRQLRYQRMKKRMMAEVPNASVVITNPTHFSVALKY-ERGMSAPICVAKGVDA 294

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           +A K+R++A EH++PI E   LAR+L+  V I+  IP   Y+AVA++I
Sbjct: 295 VAFKIREVAKEHDVPIVENVPLARALYATVEIDEEIPVEHYQAVAEVI 342


>gi|152997434|ref|YP_001342269.1| flagellar biosynthetic protein FlhB [Marinomonas sp. MWYL1]
 gi|150838358|gb|ABR72334.1| flagellar biosynthetic protein FlhB [Marinomonas sp. MWYL1]
          Length = 378

 Score =  186 bits (472), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 119/360 (33%), Positives = 194/360 (53%), Gaps = 19/360 (5%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+    KTE+ SSKK++DA N+GN P S++    SS L  ++     +  G   V  
Sbjct: 1   MAENEDGSEKTESASSKKLQDARNKGNLPRSKD---LSSALLLIVAAATIYGTGTLLV-R 56

Query: 61  DLHVLLA---SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPV 117
           DL VL        +  + D+S +VF   HL  S   ++   +LL  +  +   ++  I +
Sbjct: 57  DLAVLFDFNFLVERADVFDLSRMVF---HLYESVVAMMDSMVLLMAVLAVAG-IVGSIAL 112

Query: 118 LNLNH----VKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYF-- 171
             LN     + P   ++S   G+KR++S+ +LV   KS  K+ LVG I+++ L  NYF  
Sbjct: 113 GGLNFSWEPLTPKLSKMSPIAGLKRMFSVQSLVELFKSIAKVTLVG-IVSV-LVVNYFLP 170

Query: 172 TMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKD 231
             L     +    + H    V    + + L +A +  +D+ +       KLKM+KQE+KD
Sbjct: 171 ETLGLTFQSIELAIAHGIDIVIWSFVFVTLALALIAAIDVPFQVWSHKEKLKMTKQEVKD 230

Query: 232 EIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVL 291
           E KQ  G+P+++ R + + R    ++MM     A +IITNPTH+++AL+Y Q    APVL
Sbjct: 231 EYKQQEGDPLVRGRIRQMQRQAAMNRMMSDVPSADVIITNPTHFSVALKYDQAGGAAPVL 290

Query: 292 VAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           +AKG + IA K+R++   ++IP+ + P+LAR+++    I   IP   +K VAQL+  +Y 
Sbjct: 291 LAKGGDFIALKIREVGNHYDIPVIQSPALARAIYHHTEIGDEIPQGLFKVVAQLLAYVYQ 350


>gi|148256775|ref|YP_001241360.1| flagellar biosynthesis protein FlhB [Bradyrhizobium sp. BTAi1]
 gi|146408948|gb|ABQ37454.1| Flagellar biosynthetic protein FlhB [Bradyrhizobium sp. BTAi1]
          Length = 359

 Score =  186 bits (472), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 111/346 (32%), Positives = 192/346 (55%), Gaps = 2/346 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++ D  ++KTE P+ K+++ AL  G+   S+E + +  I A  + +  F      +V  
Sbjct: 1   MADEDDSEDKTEDPTQKRLDQALERGDVVKSQELNTWFVIAAATLVMSTFSGSIGTAVLV 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L+A++      D + ++ L   LS +    +   +L+ M+  I   ++Q   V + 
Sbjct: 61  PMRNLIANSWMIH-TDGAGLLALARSLSFAVIAAIGVPILMVMLAAIAGNMMQHRLVWSG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +KP+F ++S   G KR++      NF K   K++L+GT++ + L      +   +  +
Sbjct: 120 EPLKPNFGKISPLAGAKRLFGKQAAANFAKGIFKLVLLGTVMVMILWPERLRLESLLHMD 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
              +L       + ++  ++  +A + + D  + Y QWY + KMS QE+K+E KQS G+P
Sbjct: 180 VSELLGVTISLTKHLMGSVVALLALVAIGDYLFQYRQWYERQKMSVQEMKEEFKQSEGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + I + R++ +MM A  +A++IITNPTHY++AL Y +    APV VAKG + IA
Sbjct: 240 HVKGRIRQIRQQRMKKRMMAAVPKASVIITNPTHYSVALAY-ERGMSAPVCVAKGVDNIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
            K+R+IA  H+IPI E   LAR+L+  V I++ IP   Y AVA++I
Sbjct: 299 FKIREIAKAHDIPIVENVPLARALYATVEIDAEIPVEHYHAVAEII 344


>gi|197104398|ref|YP_002129775.1| flagellar biosynthesis protein FlhB [Phenylobacterium zucineum
           HLK1]
 gi|196477818|gb|ACG77346.1| flagellar biosynthesis protein FlhB [Phenylobacterium zucineum
           HLK1]
          Length = 359

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 109/347 (31%), Positives = 198/347 (57%), Gaps = 4/347 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE +   +KTE  + +K+E A ++G+   + + S F+++ A    L          + S
Sbjct: 1   MSETEQ-SSKTEEATPRKLEKARSQGDVAKTMDLSSFATLAAGAAALAVTGGWLARKMAS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           +L   +       L      V +  H+ ++A+  +   L    + G+ ++L+Q   + + 
Sbjct: 60  ELLPFVERPHAIDLHGAGG-VDIARHVIMAAAPALAIVLGATAICGVAAHLMQTGLIFSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISA- 179
             +KP  K++S   G+K+I+ ++NLVNF+KS VK+I+ G +    L + Y   L  ++A 
Sbjct: 119 EKMKPDLKKLSPIAGLKKIFGLDNLVNFLKSLVKVIVTGAL-GWWLLQPYIPQLAELAAL 177

Query: 180 NPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
           +P +++  A   +++++  +     ++   D  W   ++  ++KM+++E+KD+ KQ  G+
Sbjct: 178 DPLAMMPFAVDILKRLVFAVAALTLSIAGADWIWQKRRYLHRMKMTREEVKDDFKQVEGD 237

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLI 299
           P +K RQK I  +R R +MM A   AT+++ NPTHYA+AL+Y  +E  AP+ VAKG + +
Sbjct: 238 PHVKARQKQIRFTRARQRMMAAVPDATVVVMNPTHYAVALKYDASETPAPMCVAKGLDSL 297

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           A K+R +A E  +P+ E+P LAR+L+  V I+  IPP  Y+AVA++I
Sbjct: 298 ALKIRAVAEEAGVPVIEDPPLARALYAAVEIDDMIPPAHYEAVAKII 344


>gi|316932838|ref|YP_004107820.1| flagellar biosynthetic protein FlhB [Rhodopseudomonas palustris
           DX-1]
 gi|315600552|gb|ADU43087.1| flagellar biosynthetic protein FlhB [Rhodopseudomonas palustris
           DX-1]
          Length = 357

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 108/343 (31%), Positives = 186/343 (54%), Gaps = 2/343 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D KTE P+ KK++DAL  G+   S+E + +  I    + L  F       +   L 
Sbjct: 2   SDDSDEKTEEPTQKKLDDALKRGDVAKSQEVNTWFLIAGGTLVLSSFHGSIGAGILGPLR 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
            L+  +   +++    I    + +  + + + +P L L M+  +   LIQ   V +   +
Sbjct: 62  SLIEKSWMLRVDGDGLIALTKSLMYATVAAIGVP-LFLVMITAVIGNLIQHRLVFSAEGL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
            P   ++S  +G KR++    L NF+K   K++ +G ++   L   +  +   ++ +  +
Sbjct: 121 TPKLSKLSPLQGAKRVFGKQALANFLKGLFKVVALGIVMVAVLYPEHDRLDALLTMDVAA 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
           +L        K+L  ++  +A + V D  + Y QW+ K KMS QEIKDE KQS G+P IK
Sbjct: 181 LLGVTVTLTLKLLGAVVAMLAFVAVADYFFQYRQWHEKQKMSLQEIKDEYKQSEGDPHIK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + +   R++ +MM     A+++ITNPTH+++AL+Y +    AP+ VAKG + +A K+
Sbjct: 241 GRLRQLRYQRMKKRMMAEVPGASVVITNPTHFSVALKY-ERGMPAPICVAKGVDAVAFKI 299

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           R++A E+N+PI E   LAR+L+  V I+  IP   Y+AVA++I
Sbjct: 300 REVAKENNVPIVENVPLARALYATVEIDEEIPVEHYQAVAEVI 342


>gi|296101781|ref|YP_003611927.1| flagellar biosynthesis protein FlhB [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295056240|gb|ADF60978.1| flagellar biosynthesis protein FlhB [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 382

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 115/367 (31%), Positives = 201/367 (54%), Gaps = 31/367 (8%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISRE-ASLFSSILA-CLIY---------LLF 49
           M+E +  D+KTEAP+  ++E A  EG  P SRE  SL   I+  C+I+         L  
Sbjct: 1   MAEEN--DDKTEAPTPHRLEKAREEGQIPRSRELTSLLILIVGVCIIWWGGESLARKLAG 58

Query: 50  FFSPGI---YSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFG 106
             S G+   +S+ +D +++L+   Q     +  ++ L+T + L A  L+ P +L  ++F 
Sbjct: 59  MLSAGLRFDHSMVNDPNLILSQIIQLIKGAMVALLPLITGVVLVA--LISPVMLGGLVFS 116

Query: 107 IGSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISL 166
             S             ++P F +++   GI +++S       +K+ +K  L+G+     L
Sbjct: 117 TKS-------------LQPKFSKLNPLSGIAKMFSAQTGAELLKAILKAALMGSAAGFYL 163

Query: 167 TENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSK 226
             N+  M+  IS +P + + +A   V    ++++L I  +   D+ +  +  + KL+MS+
Sbjct: 164 WHNWPEMMRLISESPLTAMSNALNLVGLCALLVVLSIIPMVGFDVIFQLYSHFKKLRMSR 223

Query: 227 QEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEN 286
           Q+I+DE KQ  G+P +K R + + R+  R +MME   +A +I+TNPTHY++AL+Y + + 
Sbjct: 224 QDIRDEYKQMEGDPHVKGRIRQMQRAAARRRMMEDVPKADVIVTNPTHYSVALQYDENKM 283

Query: 287 DAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
            AP +VAKG  LIA ++R+I  E+ +PI E P LAR+L++   I   IP   Y AVA+++
Sbjct: 284 SAPKVVAKGAGLIALRIREIGTENRVPILEAPPLARALYRHAEIGQQIPGQLYAAVAEVL 343

Query: 347 YKIYHKK 353
             ++  K
Sbjct: 344 AWVWQLK 350


>gi|227112512|ref|ZP_03826168.1| flagellar biosynthesis protein FlhB [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 383

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 111/353 (31%), Positives = 186/353 (52%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+   KTEAP+ +K E A  EG  P SRE    +S+L  +  L   +  G  ++   L 
Sbjct: 3   EDSDLEKTEAPTPQKEEKAREEGQIPRSRE---LTSVLMMVAGLAILWMGG-EAMAGRLA 58

Query: 64  VLLASATQRKLEDISHIVFLLTHLS---LSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +++ +       I     +L H+      A   +IP LL  ++  + + L+    + + 
Sbjct: 59  RIVSQSLNFDYATIGDDTQMLRHVGSLLRQAVSALIPILLGAVLVALSAPLLLGGILFST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K  FK++    G+KR++S  +L    K+ +K ++VG I T  L  N+  +L  +S  
Sbjct: 119 KSLKVDFKKLDPISGLKRLFSAQSLAELFKAILKSVMVGIISTFFLIHNWPKILHLVSEA 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + +  A         +I++ +  +   D+ W       KL+MSKQEI+DE KQ+ G+P
Sbjct: 179 PITAMGDALELAVMCGFLIIMGLIPMVAFDVFWQVWSHIKKLRMSKQEIRDEHKQNEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  + +MM    +A +I+TNPTHYA+ALRY + + +AP ++AKG   IA
Sbjct: 239 HVKGRIRQQQRAIAQRRMMADVPKADVIVTNPTHYAVALRYDEKKMNAPRVLAKGAGEIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++  EH +PI E P LAR+LF+   +   IP   Y AVA+++  +Y  K
Sbjct: 299 LRIRELGAEHRVPILEAPPLARALFRHSEVGQHIPAALYAAVAEVLAWVYQLK 351


>gi|223038713|ref|ZP_03609006.1| flagellar biosynthetic protein FlhB [Campylobacter rectus RM3267]
 gi|222880115|gb|EEF15203.1| flagellar biosynthetic protein FlhB [Campylobacter rectus RM3267]
          Length = 358

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 110/356 (30%), Positives = 198/356 (55%), Gaps = 30/356 (8%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACL---IYLLFFFSPGIYSVTSDLHVL 65
            KTE P+SKKIEDA  +GN P S++ + F +I   +   + LL F     + + +    L
Sbjct: 7   EKTEEPTSKKIEDARKDGNVPKSQDLAGFVTIAVAIFVVVALLGFIKDQFFMLYNYYQDL 66

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVI-PGLLLFMMFGIGSYLIQRIPVLNLNHVK 124
           +     RKL      +F +T +++  + L+I P  +   + G+ + L+Q   +     ++
Sbjct: 67  IGQEFTRKL------LFSVTIITIFRTLLIILPIAVCIAIAGVFANLMQFGFIFTTKPLE 120

Query: 125 PSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSI 184
           P+  +++  +G+K ++S+  L++ +K  +K+  V T+        +   L FI   PH++
Sbjct: 121 PNLNKINPLKGLKNLFSLKKLIDGIKMILKVTAVFTV-------GFLMFLSFIKELPHTL 173

Query: 185 LY----------HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIK 234
            +               +  V+++++  I  L VL + +   Q++  L+MSKQEIKDE K
Sbjct: 174 FFSMAAQLAWLKEKMLILAAVMLIVMFIIGLLDVLIVRF---QYFRDLRMSKQEIKDEYK 230

Query: 235 QSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAK 294
           Q  G+P +K R + +     R++MM+   +A +IITNPTHYA+ALRY +T+  APV++AK
Sbjct: 231 QMEGDPQVKGRIRQLQMRAARNRMMQNIPQADVIITNPTHYAVALRYDKTKEKAPVILAK 290

Query: 295 GQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           G + +A ++++I  ++N+ I E P LAR L+K   +N  IP   ++AVA+++  +Y
Sbjct: 291 GVDFLALRIKQIGVQNNVKIVENPPLARELYKMCEVNDMIPAELFRAVAEVLSFVY 346


>gi|225569959|ref|ZP_03778984.1| hypothetical protein CLOHYLEM_06054 [Clostridium hylemonae DSM
           15053]
 gi|225161429|gb|EEG74048.1| hypothetical protein CLOHYLEM_06054 [Clostridium hylemonae DSM
           15053]
          Length = 353

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 117/353 (33%), Positives = 196/353 (55%), Gaps = 16/353 (4%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACL-IYLLFFFSPGIYSVTSDLH- 63
           A D+KTE  + KK  D   EGN  I + + + + +   L  Y+L    PGIY  + +   
Sbjct: 2   AADSKTEKATPKKRRDERKEGN--IFQSSDVVNVVFVFLSFYILKLIFPGIYETSGNFMK 59

Query: 64  ---VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
               L  S T    + +    + +  LS +A+R V+P   + M+ GI  + IQ   +   
Sbjct: 60  RFISLAGSITDLSGQSVGK--YGMEFLS-AAARTVLPFACICMVTGIVMHGIQTRFLFTS 116

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
            + +P   R+S  +GIKRI+++ N +  +K+ +K+I++  II   L ++    ++ I   
Sbjct: 117 KNFRPKLNRISPLQGIKRIFALKNAIELVKNLLKVIVLVAIIYTLLKQD---AVNVIRTM 173

Query: 181 PHSILYHAFFTVRKVLIMIL---LFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSY 237
             SI   A +T   ++ MIL   +  A +  LD  + +  +  K+KMSKQE+K+E KQ+ 
Sbjct: 174 DMSISASAAYTFDMIISMILRVSMVFAVIAFLDYLFQWWDYERKIKMSKQEVKEEFKQTE 233

Query: 238 GNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQN 297
           GNP IK R + I + R R +MM+A   A +II NPTH+A+AL Y   +N+APV+VAKG +
Sbjct: 234 GNPEIKGRIRDIQKQRARSRMMQAVPNADVIIRNPTHFAVALSYDTEKNNAPVVVAKGVD 293

Query: 298 LIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
            +A ++ +   E+++ + E+  LARSL+ +  +N  IP  +Y AVA+++  +Y
Sbjct: 294 ELALRIVRTGEENHVAVIEDRPLARSLYAETELNREIPSEYYGAVAEILVYVY 346


>gi|154253017|ref|YP_001413841.1| flagellar biosynthetic protein FlhB [Parvibaculum lavamentivorans
           DS-1]
 gi|154156967|gb|ABS64184.1| flagellar biosynthetic protein FlhB [Parvibaculum lavamentivorans
           DS-1]
          Length = 359

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 110/346 (31%), Positives = 184/346 (53%), Gaps = 3/346 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++ D    KTE P+ +K+E+A  +G+   S+E S +  ++     +         S+  
Sbjct: 1   MADQD-DSEKTEEPTHRKLEEAHKKGDLVKSQEVSTWFVMIGGATAIALMAPSTASSLMG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L V LA      + D  H+  +  ++  SA   +I  L + +   +  +LIQ  PV   
Sbjct: 60  SLTVFLAQPETIPM-DAEHLRRIWLNVGSSAFMSMIGPLAVLVGAALVGHLIQHAPVFTA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
            ++KP   ++S +EG++R++   +L+N  K  +K+ +VG++  + +      +   ++  
Sbjct: 119 ENMKPKLSKISPKEGLQRLFGPKSLMNLAKGILKLTIVGSVSVLIIWPERDRLALMMTWE 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
              +L        K+   ++  +  +  LD  +   QW  K +MS QE+KDE KQ  G+P
Sbjct: 179 IAQLLPLVQMLALKMFAGVIAVMTVVAALDYLFERMQWMKKQRMSIQEVKDEYKQMEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + I   R R +MM A   AT+IITNPTHYA+AL+Y Q    APV+VAKG + +A
Sbjct: 239 TVKAKLRQIRAERGRKRMMAAVPTATVIITNPTHYAVALKYEQGMG-APVVVAKGVDAVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
            ++R++  EH +PI E P LAR+L   V I+  I P  YKAVA++I
Sbjct: 298 FRIREVGQEHEVPIIENPPLARALHATVDIDQEIQPEHYKAVAEVI 343


>gi|288958052|ref|YP_003448393.1| flagellar biosynthetic protein [Azospirillum sp. B510]
 gi|288910360|dbj|BAI71849.1| flagellar biosynthetic protein [Azospirillum sp. B510]
          Length = 358

 Score =  184 bits (466), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 103/353 (29%), Positives = 195/353 (55%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE+    +KTE P+ KK+++A  +G   ++REA+ +  + A L+ L+      +  +  
Sbjct: 1   MSEDADESSKTEDPTGKKLDEAHRQGQFAMTREAANWLMVAAMLVVLVSVLPGTMKGLVF 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L+    +  Q   +       L   +      L +P +LLF++ G+ + + Q    ++ 
Sbjct: 61  RLNYYFENLDQFTFDRAGVGALLFRVMRDVMWALWLP-ILLFVVAGVMATIGQTGFHVSW 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   G+  ++  N  V  +KS VK+ +VG +  ++L   +  +  +I  +
Sbjct: 120 QLIEPKFSKLNPLPGLMNMFKANQAVELLKSIVKLAVVGGVAYMALRPMFGGIETYIGID 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             ++L        ++LI +L+ +  +   D  W   Q+  ++KM+KQE+KDE KQ  G+P
Sbjct: 180 LITMLSQMDGLAHRLLIWVLVVLTFIAAGDFLWQKKQFDKQMKMTKQEVKDEHKQQEGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           ++K R + I   R R +MM A   A +++TNPTH+A+AL+Y  ++  AP+++AKG + +A
Sbjct: 240 VVKGRIRQIRFERARKRMMAAVPDADVVVTNPTHFAVALKYDPSQMGAPLVLAKGVDQVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA  +N+P+ E P LAR+L+    I+  +P   Y+AVA++I  ++  K
Sbjct: 300 FKIREIAESNNVPVIENPPLARALYAACDIDEEVPSEHYRAVAEVITYVFKLK 352


>gi|329849682|ref|ZP_08264528.1| flagellar biosynthetic protein FlhB [Asticcacaulis biprosthecum
           C19]
 gi|328841593|gb|EGF91163.1| flagellar biosynthetic protein FlhB [Asticcacaulis biprosthecum
           C19]
          Length = 358

 Score =  183 bits (465), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 117/361 (32%), Positives = 196/361 (54%), Gaps = 15/361 (4%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASL---FSSILACLIYLLFFFSPGIYS 57
           M+E    ++KTE  S+KK+  A  +G+  +++ A L    S I AC +  L+   P + S
Sbjct: 1   MAEEPDSEDKTEEASAKKLSQAREKGD--VAKSADLPQALSLIGACAVIALY--GPSLSS 56

Query: 58  -VTSDLHVLLASATQ--RKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQR 114
            +  DL   LA   Q    LE    +  ++  +  +   +VI  + + ++ GIG +++Q 
Sbjct: 57  DLVDDLIPFLAHPQQLLGSLEGDGGVT-IMREMVFAFLPIVIIVMGVTLLLGIGGHVMQT 115

Query: 115 IPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTML 174
             +     +KPS  +++   G KR++  + L+ F K+ VK+I+ G I+   L    + ++
Sbjct: 116 GLMFTTEKLKPSLTKLNPMSGFKRLFGFDALIQFAKTVVKLIITGAIVWQVLKGKLYEIM 175

Query: 175 DFISANPHSILYHAF--FTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDE 232
               A+P  IL +A   F    + + I LFI      D  W   ++  ++KMSKQE K+E
Sbjct: 176 ALAKASPLLILPYAMDVFVALAIAVCIFLFIEGAA--DYMWQRFRFMQRMKMSKQEQKEE 233

Query: 233 IKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLV 292
            KQ  G+P IK + + I   + R +MM     AT++ITNPTHYA+AL++   +  AP+ V
Sbjct: 234 YKQMEGDPHIKAKLRQIRMEKSRRRMMSNVKDATVVITNPTHYAVALQFEMGQMQAPLCV 293

Query: 293 AKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
           AKG + +A K+R+ A +HN+PI E+  LAR+L+  + ++  IP   + AVAQ+I  +  K
Sbjct: 294 AKGVDTLALKIREEAGKHNVPIVEDVPLARALYAAIDVDETIPEEHFAAVAQVISFVLAK 353

Query: 353 K 353
           K
Sbjct: 354 K 354


>gi|291613025|ref|YP_003523182.1| flagellar biosynthetic protein FlhB [Sideroxydans lithotrophicus
           ES-1]
 gi|291583137|gb|ADE10795.1| flagellar biosynthetic protein FlhB [Sideroxydans lithotrophicus
           ES-1]
          Length = 381

 Score =  183 bits (464), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 118/365 (32%), Positives = 200/365 (54%), Gaps = 29/365 (7%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   KTE+PS ++++ A  EG    SRE S F+ ++A           GI+ +  
Sbjct: 1   MAEQDSDLEKTESPSQRRLDQAREEGQVARSRELSTFAVLMAG--------GAGIWLMGG 52

Query: 61  DLHVLLASATQRKLEDISHIVF-------LLTHLSLSASRLVIPGLLLFMMFGIGSYLIQ 113
            L   L S  +  L   + + F        L  LS+S   + +P L L +     S L+ 
Sbjct: 53  MLSQQLISLIREGLTLDTGLAFHSELLVPRLHDLSMSTLLVFLPLLGLLLAVAAFSPLLL 112

Query: 114 RIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTM 173
              +  L  ++P+F +++   GI R++S N+L+   K+  K ++VG I  + +  N   +
Sbjct: 113 NGWLFTLKPLQPNFGKLNPITGIGRMFSTNSLMELAKAIAKAVVVGGIGALVIWHNKNAV 172

Query: 174 LDFIS-----ANPH--SILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSK 226
           L  +S     A PH  S+++ +F  V   L++I+        +D+ +   +   KLKM+K
Sbjct: 173 LLLVSEPIASAIPHLGSLVWGSFAAVMGGLLLIV-------AVDVPFQLWEHNKKLKMTK 225

Query: 227 QEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEN 286
           +E++ E K++ G+P +K R +S+ R   R +MM    +A +++TNPTHY++AL+Y  ++ 
Sbjct: 226 EEVRQESKETEGDPQVKARVRSMQREMARRRMMAEIPKADVVVTNPTHYSVALKYSDSKM 285

Query: 287 DAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
            APV+VAKG +L+A K+++IA EHN+PI E P LAR+L K   +  AIP   Y AVA+++
Sbjct: 286 RAPVVVAKGSHLMAAKIKEIAKEHNVPILEAPPLARALHKHCELGEAIPEALYTAVAEVL 345

Query: 347 YKIYH 351
             +Y 
Sbjct: 346 AYVYQ 350


>gi|254691439|ref|ZP_05154693.1| flagellar biosynthesis protein FlhB [Brucella abortus bv. 6 str.
           870]
          Length = 210

 Score =  183 bits (464), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 86/207 (41%), Positives = 137/207 (66%)

Query: 147 NFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATL 206
            F+KS  K++    I+ +   +      D ++ +P ++       V ++L+  +L IA +
Sbjct: 1   EFLKSLAKLLAASVIVFLVFFKGDSLFTDAVATDPGALPEFLRKNVVRLLVANVLAIAAI 60

Query: 207 TVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRAT 266
              D+ WS   W  +L+M++QE+KDE+KQS G+P++K+R +S+ R R R +M+ A   AT
Sbjct: 61  AGFDLAWSRIHWRQELRMTRQEVKDELKQSEGDPLVKSRLRSLGRDRARRRMINAVPTAT 120

Query: 267 IIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFK 326
           +I+ NPTH+++ALRY   E+ APV+VAKGQ+LIA K+R+IA  H+IP+FE+  LAR+L+K
Sbjct: 121 LIVANPTHFSVALRYKPNEDAAPVVVAKGQDLIALKIREIAASHSIPVFEDVQLARALYK 180

Query: 327 QVPINSAIPPVFYKAVAQLIYKIYHKK 353
           QV ++  I P FYKAVA+LI  I  ++
Sbjct: 181 QVNVDQMIAPEFYKAVAELIRIINTRR 207


>gi|146341890|ref|YP_001206938.1| flagellar biosynthesis protein FlhB [Bradyrhizobium sp. ORS278]
 gi|146194696|emb|CAL78721.1| Flagellar biosynthetic protein FlhB [Bradyrhizobium sp. ORS278]
          Length = 359

 Score =  182 bits (463), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 111/346 (32%), Positives = 188/346 (54%), Gaps = 2/346 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E    ++KTE P+ K+++ AL  G+   S+E + +  I A  + +  F      +V  
Sbjct: 1   MAEEGDTEDKTEDPTQKRLDQALERGDVVKSQELNTWFVIAAATLVMTTFSGSIGTAVLV 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L+A++      D + ++ L   LS +    +   +L+ M+  I   ++Q   V + 
Sbjct: 61  PMRNLIANSWMIH-TDGAGLLALARSLSFAVIAAIGVPILMVMLAAIAGNMMQHRLVWSG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +KPS  ++S   G KR++      NF K   K++L+GT++ + L      +   +  +
Sbjct: 120 EPLKPSLSKISPLSGAKRLFGKQAAANFAKGLFKLVLLGTVMVMILWPERLRLEALLHMD 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
              +L         ++  ++  +A + + D  + Y QWY + KMS QE+K+E KQS G+P
Sbjct: 180 VAELLGVTMSLTTHLMGSVVALLALVAIGDYLFQYRQWYERQKMSLQEMKEEFKQSEGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + I + R++ +MM A  +A++IITNPTHY++AL Y +    APV VAKG + IA
Sbjct: 240 HVKGRIRQIRQQRMKKRMMAAVPKASVIITNPTHYSVALSY-ERGMQAPVCVAKGVDNIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
            K+R+IA  H+IPI E   LAR+L+  V I+  IP   Y AVA++I
Sbjct: 299 FKIREIAKAHDIPIVENVPLARALYATVEIDEEIPVEHYHAVAEII 344


>gi|260598364|ref|YP_003210935.1| flagellar biosynthetic protein flhB [Cronobacter turicensis z3032]
 gi|260217541|emb|CBA31747.1| Flagellar biosynthetic protein flhB [Cronobacter turicensis z3032]
          Length = 392

 Score =  182 bits (462), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 116/360 (32%), Positives = 189/360 (52%), Gaps = 21/360 (5%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPG-------IY 56
           +D  D+KTEAP+  + E A  EG  P SRE    +S+L  L+ +   +  G         
Sbjct: 12  SDDSDDKTEAPTPHRREKAREEGQIPRSRE---LTSMLMLLVGVAVIWMGGSLLARQLAA 68

Query: 57  SVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFG---IGSYLIQ 113
            ++  LH   +     KL  +  I FL+   +L A   +I G+++  +F    +G  L  
Sbjct: 69  MLSHGLHFDHSIINDPKLV-VGQISFLIKQ-ALVALVPLIMGVVIVALFAPMLLGGLL-- 124

Query: 114 RIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTM 173
                N   V    ++++   GIKRI+S  +L   +K+ +K +LVG +    L  N+  M
Sbjct: 125 ----FNTKAVAFKPEKLNPLPGIKRIFSSQSLAELLKAVLKSVLVGIVTGCFLWYNWPDM 180

Query: 174 LDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEI 233
           +  IS +P S + +A   V    I+I++ +  +   D+ W       KL+MS+Q+I+DE 
Sbjct: 181 MRLISESPISAMRNAMNLVALCCILIVMGLVPMVGFDVFWQIVSHTKKLRMSRQDIRDEF 240

Query: 234 KQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVA 293
           K   G+P +K R +   R   R +MM    +A +I+TNPTHY++AL+Y + +  AP +VA
Sbjct: 241 KNQEGDPHVKGRIRQQQREAARRRMMADVPKADVIVTNPTHYSVALQYDENKMSAPKVVA 300

Query: 294 KGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           KG  L+A ++R+I  EH IP+ E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 KGAGLVALRIREIGNEHRIPMLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 360


>gi|302384124|ref|YP_003819947.1| flagellar biosynthetic protein FlhB [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302194752|gb|ADL02324.1| flagellar biosynthetic protein FlhB [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 362

 Score =  182 bits (462), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 111/361 (30%), Positives = 194/361 (53%), Gaps = 16/361 (4%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFF--------FS 52
           M+E+  P++KTE  S +K+E+A  +G+   S + +   S+L C+  +L           +
Sbjct: 1   MAEDADPESKTEEASPQKLEEARKKGDVAKSADVAPALSLL-CVTGVLIMGGGYFATNMA 59

Query: 53  PGIYSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLI 112
            G     +  H +L         +I   V  +    L A       +L  ++ G+G  + 
Sbjct: 60  QGFLPFIAAPHAMLGGLEAGGGVEIGARVLWVVAPFLGAV------MLAAILGGVGGNVA 113

Query: 113 QRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFT 172
           Q   V++   +KP + +VS   G KRI+  + L+ F ++ +K++ VG I  + L  +   
Sbjct: 114 QSGLVISAEKMKPKWSKVSPMAGFKRIFGPDGLMQFAQTLLKLVAVGVICWMVLKPHARQ 173

Query: 173 MLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDE 232
                + +P +IL  A   +  ++   L+F+A     D  W   ++  +++MSK+E+K+E
Sbjct: 174 FETMAAMSPLTILPLARDLMIALMSSALVFLALTAGGDFVWQKMRFAKRMRMSKEELKEE 233

Query: 233 IKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLV 292
            KQS G+P IK + K I   R R +MM+   +AT+I+TNPTHY++ALRY +  + APV V
Sbjct: 234 YKQSEGDPHIKAKLKQIRMQRSRQRMMQNVPKATVIVTNPTHYSVALRY-EAGDAAPVCV 292

Query: 293 AKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
           AKG + +A ++R++A EH++PI E   LAR+L+  V I+  IP   ++A A++I  +  K
Sbjct: 293 AKGVDAVAMRIREVAREHDVPIVENVPLARALYAAVDIDETIPREHFEAAARVIGFVMKK 352

Query: 353 K 353
           +
Sbjct: 353 R 353


>gi|86750881|ref|YP_487377.1| flagellar biosynthesis protein FlhB [Rhodopseudomonas palustris
           HaA2]
 gi|86573909|gb|ABD08466.1| flagellar biosynthetic protein FlhB [Rhodopseudomonas palustris
           HaA2]
          Length = 358

 Score =  182 bits (461), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 111/343 (32%), Positives = 185/343 (53%), Gaps = 2/343 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D+   K E P+ K+++DAL +G+   S+E + + +I    + L  F       +T  + 
Sbjct: 3   DDSDQEKQEEPTQKRLDDALEKGDVAKSQEVNTWFAIAGATLLLSSFSGSIGSGITGPMR 62

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
            L+  +    ++ +  +    + L +  S L +P L L  +  IGS LIQ   V +   +
Sbjct: 63  TLIEKSWMLPVDGVGLLALTKSLLLMLISVLGVP-LGLLALVAIGSNLIQHRLVFSTEGL 121

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           KP F ++S  EG KR++    L NF+K   K+I +G ++   L      +   +  +  S
Sbjct: 122 KPKFSKLSPLEGAKRLFGKQALANFLKGLFKVIALGVVMVAVLYPERDRLDALLQMDVVS 181

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
           +L        K++  +   +A +   D  + YH W  + KMS QE+KDE KQS G+P IK
Sbjct: 182 LLGVTVSLTLKLMGTVAAVLAFVAAGDFFFQYHTWRERQKMSLQEVKDEYKQSEGDPHIK 241

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + I   R++ +MM A   A+++ITNPTH+++AL+Y +    AP+ VAKG + IA K+
Sbjct: 242 GRIRQIRYQRMKKRMMAAVPGASVVITNPTHFSVALKY-ERGMQAPICVAKGADAIAFKI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           R++A  +++PI E   LAR+LF  V ++  IP   Y AVA++I
Sbjct: 301 REVAKANDVPIVENVPLARALFATVEVDEEIPVEHYHAVAEVI 343


>gi|78485088|ref|YP_391013.1| flagellar biosynthetic protein FlhB [Thiomicrospira crunogena
           XCL-2]
 gi|78363374|gb|ABB41339.1| flagellar biosynthetic protein FlhB [Thiomicrospira crunogena
           XCL-2]
          Length = 381

 Score =  182 bits (461), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 103/351 (29%), Positives = 186/351 (52%), Gaps = 1/351 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+    K+E PS KK+ +A  +G  P S+E +     L   ++L +FF   +     
Sbjct: 1   MAENEDGTEKSEEPSEKKLREAREKGQVPRSKELTTLLMTLGAAVFL-YFFGAQMMQDFE 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L +   S  +    D      L+  L + +  +++P LLL ++  + S ++      + 
Sbjct: 60  TLFIKGLSFDRSHAYDFQMATNLVLGLVVHSIYMMVPFLLLMVLIAVVSPMLLGGWNFST 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   +++   GIK+++S+N L+   K+F K  LV  +    L  +Y  ++      
Sbjct: 120 QALAPKISKLNPVSGIKKMFSMNALMELFKAFAKFTLVSVVAGFFLWYSYEEIISIGIEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   L HA   + +  I + L +  +  +D+ +  HQ  ++LKM+KQE+K+E KQ  G+P
Sbjct: 180 PKQALAHAGQLIVEAFIFVSLSLILIAAIDVPFQIHQHVTQLKMTKQEVKEEHKQQEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM+    A ++ITNPTH+A+AL+Y   E   P+++A G + +A
Sbjct: 240 EVKGRIRQLQREMSQKRMMQKVPEADVVITNPTHFAVALKYAPDEMAEPMVLALGSDFMA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            ++R +A EHNIP+ E P LAR+L+    ++  IP   ++AVA ++  +Y 
Sbjct: 300 AQIRTLAKEHNIPLIEAPPLARALYYNAEVDRPIPYELFRAVAAILAYVYQ 350


>gi|255321961|ref|ZP_05363111.1| flagellar biosynthetic protein FlhB [Campylobacter showae RM3277]
 gi|255301065|gb|EET80332.1| flagellar biosynthetic protein FlhB [Campylobacter showae RM3277]
          Length = 358

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 108/356 (30%), Positives = 197/356 (55%), Gaps = 30/356 (8%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACL---IYLLFFFSPGIYSVTSDLHVL 65
            KTE P+SKKIEDA  +GN P S++ + F ++   +   + LL F     +++ +    L
Sbjct: 7   EKTEEPTSKKIEDARKDGNVPKSQDLAGFVTLAVAIFVVVALLGFIGDQFFTLYNYYQSL 66

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVI-PGLLLFMMFGIGSYLIQRIPVLNLNHVK 124
           +     RKL      +F +   ++  + L+I P  +   + G+ + L+Q   +     ++
Sbjct: 67  IGQEFTRKL------LFSVAITTIFRTLLIILPIAVCIAIAGVVANLMQFGFIFTTKPLE 120

Query: 125 PSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSI 184
           P+  +++  +G+K ++S+  L++ +K  +K+  V T+        +   L FI   PH++
Sbjct: 121 PNLNKINPIKGLKNLFSLKKLIDGIKMVLKVTAVFTV-------GFLMFLSFIKELPHTL 173

Query: 185 LY----------HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIK 234
            +               +  V+++++  I  L VL + +   Q++  L+MSKQEIKDE K
Sbjct: 174 FFSMAAQLAWLKEKMLILAAVMLIVMFIIGLLDVLIVRF---QYFRDLRMSKQEIKDEYK 230

Query: 235 QSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAK 294
           Q  G+P +K R + +     R++MM+   +A +IITNPTHYA+ALRY +T+  APV++AK
Sbjct: 231 QMEGDPQVKGRIRQLQMRAARNRMMQNIPQADVIITNPTHYAVALRYDKTKEKAPVILAK 290

Query: 295 GQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           G + +A ++++I  ++N+ I E P LAR L+K   +N  IP   ++AVA+++  +Y
Sbjct: 291 GVDFLALRIKQIGVQNNVKIVENPPLARELYKMCEVNDMIPAELFRAVAEVLSFVY 346


>gi|148269163|ref|YP_001243623.1| flagellar biosynthetic protein FlhB [Thermotoga petrophila RKU-1]
 gi|281411461|ref|YP_003345540.1| flagellar biosynthetic protein FlhB [Thermotoga naphthophila
           RKU-10]
 gi|147734707|gb|ABQ46047.1| flagellar biosynthetic protein FlhB [Thermotoga petrophila RKU-1]
 gi|281372564|gb|ADA66126.1| flagellar biosynthetic protein FlhB [Thermotoga naphthophila
           RKU-10]
          Length = 374

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 107/350 (30%), Positives = 191/350 (54%), Gaps = 10/350 (2%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A   +TE  + +K      EG AP+SRE ++  + L   + L  F   G+  +T D+   
Sbjct: 29  AEAERTERATPRKRRRVREEGRAPVSRELNMAVTFLVFALALKIFGYQGVERITEDVQAF 88

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPG--LLLFMMFGIGSYLIQRIPVLNLNHV 123
           L+     + ED+     L+  ++     L+I G  ++  M+ G+    +Q   +     +
Sbjct: 89  LSF---EETEDL-----LVNAVNTFKDVLLIIGAFVVFSMVAGVMIGALQTRFLFAPKAL 140

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           KP   R++  EG KR++S+ +LV  +KS +K+ +VG ++   L   +  M+     N + 
Sbjct: 141 KPDLNRINPIEGFKRLFSLRSLVELLKSVLKVAIVGIVVYQVLKNRWDEMILLTEMNVND 200

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
              + +    ++ +   + +  L V D  +   ++   ++M+KQE+KDE+K+  GNP IK
Sbjct: 201 AFANFWDIASEITLKSGMVLLALAVFDYFYQRWEFEKSIRMTKQEVKDELKEVEGNPEIK 260

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            RQ+ +    +R +MME   +A ++ITNPTH+A+AL+Y     +APV+VAKG + +A K+
Sbjct: 261 RRQRQMMYDILRRRMMEEVPKADVVITNPTHFAVALKYDPDTMNAPVVVAKGVDHLALKI 320

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            +IA E+++P+   PSLAR+L+ +  I   IP  FY+ VA+++  +Y KK
Sbjct: 321 IEIAKENDVPVLRNPSLARALYYKTEIGEEIPVEFYRIVAEVLVYVYTKK 370


>gi|222824323|ref|YP_002575897.1| flagellar biosynthesis protein FlhB [Campylobacter lari RM2100]
 gi|222539544|gb|ACM64645.1| flagellar biosynthesis protein FlhB [Campylobacter lari RM2100]
          Length = 358

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 114/357 (31%), Positives = 205/357 (57%), Gaps = 18/357 (5%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+ +D    KTE P+SKKIEDA  EGN P S++AS  + ++  ++ +LF   P +    S
Sbjct: 1   MAADD--QEKTEEPTSKKIEDARKEGNVPKSQDASAVAVLIVAVVVVLFTL-PFMGERIS 57

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L+    S    +L D+  +  ++    +    +V+P  L+ M+ G+   L+Q   +   
Sbjct: 58  GLYRFYQSFIGIEL-DLKILQKIIIKTMIEMFIMVLPITLVIMIAGVLGNLMQFGFIFTT 116

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P+F +++   G+K ++S+  ++  +K  +K   VG +  I+    +  +L F+   
Sbjct: 117 KPITPNFNKINPLNGLKNLFSLKKIIEALKITLK---VGVVFGIA----FVFLLQFMQEL 169

Query: 181 PHSILYHAF-----FTVRKVLIMILLFIATLTV--LDIGWSYHQWYSKLKMSKQEIKDEI 233
           P   LY  +        + +++  ++ IA L +  LD+    +Q++  L+MSKQEIKDE 
Sbjct: 170 PRVELYTIYPQLLWLRDKAIILAAVVIIAFLLIGFLDVLIVRYQYFKNLRMSKQEIKDEY 229

Query: 234 KQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVA 293
           KQ+ G+P++K+R + +     R +M++  + A ++ITNPTHYA+ALRY  ++  AP ++A
Sbjct: 230 KQTEGDPLVKSRIRRLQMEAARRRMVQDVASADVVITNPTHYAVALRYDSSQEAAPKVLA 289

Query: 294 KGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           KG + +A +++ +AYE+N+ I+E P LAR L+K   +N  IPP  +KAVA+++  +Y
Sbjct: 290 KGVDFLALRIKDMAYEYNVMIYENPPLARELYKACEVNDLIPPELFKAVAEVLSFVY 346


>gi|15643671|ref|NP_228717.1| flagellar biosynthesis protein FlhB [Thermotoga maritima MSB8]
 gi|4981445|gb|AAD35990.1|AE001755_13 flagellar biosynthesis protein FlhB [Thermotoga maritima MSB8]
          Length = 374

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 106/350 (30%), Positives = 193/350 (55%), Gaps = 10/350 (2%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A   +TE  + +K      EG AP+SRE ++  + L   + L  F   G+  +T D+ V 
Sbjct: 29  AEAERTERATPRKRRRVREEGRAPVSRELNMAVTFLVFALALKIFGYQGVERITEDVQVF 88

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPG--LLLFMMFGIGSYLIQRIPVLNLNHV 123
           L+     + ED+     L+  +++    L+I G  ++  M+ G+    +Q   +     +
Sbjct: 89  LSF---EETEDL-----LMNAVNIFKDVLLIVGAFVVFSMVAGVMIGALQTRFLFAPKAL 140

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           KP   R++  EG KR++S+ +LV  +KS +K+ +VG ++   L   +  M+     + + 
Sbjct: 141 KPDLNRINPIEGFKRLFSLRSLVELLKSVLKVAIVGIVVYQVLKNRWDEMILLTEMSVND 200

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
              + +    ++ +   + +  L V D  +   ++   ++M+KQE+KDE+K+  GNP IK
Sbjct: 201 AFANFWDITSEITLKSGMILLALAVFDYFYQRWEFEKSIRMTKQEVKDELKEVEGNPEIK 260

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            RQ+ +    +R +M+E   +A ++ITNPTH+A+AL+Y     +APV+VAKG + +A K+
Sbjct: 261 RRQRQMMYDILRRRMLEEVPKADVVITNPTHFAVALKYDPDTMNAPVVVAKGVDHLAFKI 320

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            +IA E+++P+   PSLAR+L+ +  I   IP  FY+ VA+++  +Y KK
Sbjct: 321 IEIAKENDVPVLRNPSLARALYYKTEIGEEIPVEFYRIVAEVLVYVYAKK 370


>gi|170287825|ref|YP_001738063.1| flagellar biosynthetic protein FlhB [Thermotoga sp. RQ2]
 gi|170175328|gb|ACB08380.1| flagellar biosynthetic protein FlhB [Thermotoga sp. RQ2]
          Length = 374

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 107/350 (30%), Positives = 191/350 (54%), Gaps = 10/350 (2%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A   +TE  + +K      EG AP+SRE ++  + L   + L  F   G+  +T D+   
Sbjct: 29  AEAERTERATPRKRRRVREEGRAPVSRELNMAVTFLVFALALKIFGYQGVERITEDVQAF 88

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPG--LLLFMMFGIGSYLIQRIPVLNLNHV 123
           L+     + ED+     L+  ++     L+I G  ++  M+ G+    +Q   +     +
Sbjct: 89  LSF---EETEDL-----LVNAVNTFKDVLLIIGAFVVFSMVAGVMIGALQTRFLFAPKAL 140

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           KP   R++  EG KR++S+ +LV  +KS +K+ +VG ++   L   +  M+     N + 
Sbjct: 141 KPDLNRINPIEGFKRLFSLRSLVELLKSVLKVAIVGIVVYQVLKNRWDEMILLTEMNVND 200

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
              + +    ++ +   + +  L V D  +   ++   ++M+KQE+KDE+K+  GNP IK
Sbjct: 201 AFANFWDIASEITLKSGMVLLALAVFDYFYQRWEFEKSIRMTKQEMKDELKEVEGNPEIK 260

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            RQ+ +    +R +MME   +A ++ITNPTH+A+AL+Y     +APV+VAKG + +A K+
Sbjct: 261 RRQRQMMYDILRRRMMEEVPKADVVITNPTHFAVALKYDPDTMNAPVVVAKGVDHLALKI 320

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            +IA E+++P+   PSLAR+L+ +  I   IP  FY+ VA+++  +Y KK
Sbjct: 321 IEIAKENDVPVLRNPSLARALYYKTEIGEEIPVEFYRIVAEVLVYVYTKK 370


>gi|50120630|ref|YP_049797.1| flagellar biosynthesis protein FlhB [Pectobacterium atrosepticum
           SCRI1043]
 gi|49611156|emb|CAG74602.1| flagellar biosynthetic protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 383

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 109/353 (30%), Positives = 184/353 (52%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+   KTEAP+ +K E A  EG  P SRE    +S+L  +  L   +  G   +   L 
Sbjct: 3   EDSDLEKTEAPTPQKEEKAREEGQIPRSRE---LTSVLMMVAGLAILWIGGDV-MAGRLA 58

Query: 64  VLLASATQRKLEDISHIVFLLTHLS---LSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +++ +       I     +L H+      A   ++P +L  ++  + + ++    + + 
Sbjct: 59  RIVSQSLNFDYATIGDDTQMLRHVGSLLRQAVSALVPIMLGAVLVALSAPMLLGGILFST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K  FK++    G+KR++S   L    K+ +K ++VG I T+ L  N+  +L  +S  
Sbjct: 119 KSLKVDFKKLDPISGLKRLFSSQALAELFKAILKSVIVGIISTLFLIHNWPKILHLVSEA 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + L  A         +I++ +  +   D+ W       KL+M+KQEI+DE KQS G+P
Sbjct: 179 PIAALGDALELAVMCGFLIIIGLIPMVAFDVFWQVWSHIKKLRMTKQEIRDEHKQSEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  + +MM    +A +I+TNPTHYA+ALRY   + +AP ++AKG   IA
Sbjct: 239 HVKGRIRQQQRAMAQRRMMADVPKADVIVTNPTHYAVALRYDDKKMNAPKVLAKGAGDIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++  EH +PI E P LAR+LF+   +   IP   Y AVA+++  +Y  K
Sbjct: 299 LRIRELGTEHRVPILEAPPLARALFRHSEVGQHIPAALYAAVAEVLAWVYQLK 351


>gi|118475475|ref|YP_891544.1| flagellar biosynthesis protein FlhB [Campylobacter fetus subsp.
           fetus 82-40]
 gi|118414701|gb|ABK83121.1| flagellar biosynthetic protein FlhB [Campylobacter fetus subsp.
           fetus 82-40]
          Length = 357

 Score =  180 bits (456), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 118/355 (33%), Positives = 198/355 (55%), Gaps = 28/355 (7%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSIL---ACLIYLLFFFSPGIYSVTSDLHVL 65
            K E P+ KK+EDA N+GN   S++ S F ++L   A L+ L+ F    + ++      L
Sbjct: 6   EKIEEPTGKKLEDARNKGNVAKSQDVSGFVTLLVGFAVLVGLMGFMGERLVNLYLYYQGL 65

Query: 66  LASATQRKLEDISHIVFLLT-HLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVK 124
           +     R+L       F +T H  L    +++P  +  M+ GI S ++Q   +  +  + 
Sbjct: 66  IGVEITREL------FFKITIHSMLQTFLIILPIAICIMIAGIISNIMQFGFLFTVEPIM 119

Query: 125 PSFKRVSLREGIKRIYSINNLVNFMKSFVKIIL-VGTIITISLTENYFTMLDFISANPHS 183
           P+F ++   +GI  ++S+  L++     VKIIL V  +  ++    ++  L F+   PH+
Sbjct: 120 PNFSKIDPIKGIANLFSLKKLIDA----VKIILKVSAVFGVA----FYFFLQFVKELPHT 171

Query: 184 ILYHAF----FTVRKVLI----MILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQ 235
           I +  F    +   K+LI    M+LLF+  + + D+    +Q++  L+MSKQE+KDE KQ
Sbjct: 172 IFFSMFNQLLWLKEKMLILAGVMLLLFL-IIAIADVFIVRYQYFKGLRMSKQEVKDEFKQ 230

Query: 236 SYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKG 295
             G+P +K R + +     R +MM+    A ++ITNPTHYA+ALRY + +  APV++AKG
Sbjct: 231 MEGDPKVKGRIRQLQMQAARKRMMQNIPTADVVITNPTHYAVALRYDKEKEKAPVVLAKG 290

Query: 296 QNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
            + +A ++RKIA E+ I I E P LAR L+K   I+  IP   ++AVA+++  +Y
Sbjct: 291 VDHLALRIRKIATENGIQIVENPPLARELYKLCDIDDQIPGNLFQAVAEVLSFVY 345


>gi|261340264|ref|ZP_05968122.1| flagellar biosynthetic protein FlhB [Enterobacter cancerogenus ATCC
           35316]
 gi|288317353|gb|EFC56291.1| flagellar biosynthetic protein FlhB [Enterobacter cancerogenus ATCC
           35316]
          Length = 382

 Score =  180 bits (456), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 110/367 (29%), Positives = 201/367 (54%), Gaps = 31/367 (8%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREAS--LFSSILACLIY---------LLF 49
           M+E++  D+KTEAP+  ++E A  EG  P SRE +  L   +  C+I+         L  
Sbjct: 1   MAEDN--DDKTEAPTPHRLEKAREEGQVPRSRELTSLLILVVGVCIIWWGGESFARRLAG 58

Query: 50  FFSPGI---YSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFG 106
             S G+   +S+ +D +++L+             + LL   ++ A   +I G++L  +  
Sbjct: 59  MLSAGLRFDHSMVNDPNLILSQ------------IILLVKNAMIALLPLISGVVLVAL-- 104

Query: 107 IGSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISL 166
           +   ++  + V +   ++P F +++   GI +++S       +K+ +K  L+G+     L
Sbjct: 105 VSPVMLGGL-VFSGKSLQPKFSKLNPLPGIAKMFSAQTGAELVKAILKSALMGSTAGFFL 163

Query: 167 TENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSK 226
             ++  M+  IS +P + + +A   V    ++++L I  +   D+ +  +  + KL+MS+
Sbjct: 164 WHHWPEMMRLISESPFNAMNNAMNLVGLCALLVVLSIIPMVGFDVIFQMYSHFKKLRMSR 223

Query: 227 QEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEN 286
           Q+I+DE KQ  G+P +K R + + R+  R +MME   +A +I+TNPTHY++ALRY + + 
Sbjct: 224 QDIRDEYKQMEGDPHVKGRIRQMQRAAARRRMMEDVPKADVIVTNPTHYSVALRYDENKM 283

Query: 287 DAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
            AP +VAKG  LIA ++R+I  E+ +PI E P LAR+L++   I   IP   Y AVA+++
Sbjct: 284 SAPKVVAKGAGLIALRIREIGTENRVPILEAPPLARALYRHAEIGQQIPGQLYAAVAEVL 343

Query: 347 YKIYHKK 353
             ++  K
Sbjct: 344 AWVWQLK 350


>gi|302037621|ref|YP_003797943.1| flagellar biosynthetic protein FlhB [Candidatus Nitrospira
           defluvii]
 gi|300605685|emb|CBK42018.1| Flagellar biosynthetic protein FlhB, export component [Candidatus
           Nitrospira defluvii]
          Length = 360

 Score =  179 bits (455), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 102/352 (28%), Positives = 188/352 (53%), Gaps = 7/352 (1%)

Query: 5   DAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIY-SVTSDLH 63
           D+  N+TE  + K+  DA  +G   +SR+A++   +L  L   L++ +PGI   +   L 
Sbjct: 3   DSGQNRTEQATPKRKADARAKGQVALSRDAAMAVGLLGSL-GALYWMTPGILNGLRESLQ 61

Query: 64  VLLA----SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLN 119
           + L+     +TQR L  + H+  +L  + +    ++ P +    + G+G+ LIQ   +  
Sbjct: 62  LWLSKSMEESTQRTL-SLDHLHLILRQVGVDVFVMLGPVIAGIAVVGVGANLIQTGFLWK 120

Query: 120 LNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISA 179
            + ++  F R+S   G  R++S+ +    +KS++KI  +G +  +++ ++          
Sbjct: 121 RDALQLEFSRISPMAGFSRLFSVRSFSELVKSWLKIFAIGGVGYLTIKQDMVLFSPLTQF 180

Query: 180 NPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
              ++L    +   K  +M+      +  LD G+   +W   L+MS+ EIK+E + + G+
Sbjct: 181 GMETLLPTVGWATFKAALMMGGAALVIGGLDYGFQRFEWERDLRMSRDEIKEESRAAEGD 240

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLI 299
           P +K + +S  R   R +MM A  +A +IITNPTH A+AL+Y      AP++VAKG   +
Sbjct: 241 PGLKAKIRSTQREMSRKRMMAAVPKADVIITNPTHLAVALKYDSKAMGAPIVVAKGAGYV 300

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           A+K+R+I  +H + I E   +AR+LFK V +   +P   Y+AVA+++  +Y 
Sbjct: 301 AEKIREIGRQHGVMIVENKLVARTLFKLVEVGREVPEDLYRAVAEILAFVYR 352


>gi|168238548|ref|ZP_02663606.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|194734592|ref|YP_002114950.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|204931016|ref|ZP_03221842.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|194710094|gb|ACF89315.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197288673|gb|EDY28048.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|204320060|gb|EDZ05265.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|322616914|gb|EFY13822.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322618152|gb|EFY15044.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322625823|gb|EFY22642.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322626275|gb|EFY23085.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322632689|gb|EFY29434.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322639033|gb|EFY35726.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322640473|gb|EFY37126.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322646018|gb|EFY42535.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322649560|gb|EFY45992.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322655468|gb|EFY51776.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322660247|gb|EFY56485.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322662928|gb|EFY59135.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322668113|gb|EFY64272.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674127|gb|EFY70221.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322675519|gb|EFY71593.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322683067|gb|EFY79083.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322686761|gb|EFY82739.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323195348|gb|EFZ80528.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323199240|gb|EFZ84335.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323204035|gb|EFZ89050.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323207496|gb|EFZ92444.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323217480|gb|EGA02199.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323221971|gb|EGA06361.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323224718|gb|EGA08987.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323231502|gb|EGA15615.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323235944|gb|EGA20023.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323240514|gb|EGA24557.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323245406|gb|EGA29406.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323250177|gb|EGA34069.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323253625|gb|EGA37453.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323255054|gb|EGA38842.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323260286|gb|EGA43907.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323266878|gb|EGA50364.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323270708|gb|EGA54149.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
          Length = 383

 Score =  179 bits (455), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 104/353 (29%), Positives = 194/353 (54%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            ++ D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G  S+   L 
Sbjct: 3   EESDDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVCIIWFGG-ESLARQLA 58

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++      R + D + I+  +  L  +A   ++P +   ++  + S ++    + + 
Sbjct: 59  GMLSAGLHFDHRMVNDPNLILGQIILLIKAAMMALLPLIAGVVLVALISPVMLGGLIFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K  LVG +    L  N+  M+  ++ +
Sbjct: 119 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAVLKSTLVGCVTGFYLWHNWPQMMRLMAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE K+S G+P
Sbjct: 179 PIVAMGNALDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + + R+  + +MME   +A +I+TNPTHY++AL+Y + +  AP +VAKG  LIA
Sbjct: 239 HVKGKIRQMQRAAAQRRMMEDVPKADVIVTNPTHYSVALQYDENKMSAPKVVAKGAGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  EH +P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 299 LRIREIGAEHRVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 351


>gi|121613536|ref|YP_001000045.1| flagellar biosynthesis protein FlhB [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|87250257|gb|EAQ73215.1| flagellar biosynthetic protein FlhB [Campylobacter jejuni subsp.
           jejuni 81-176]
          Length = 368

 Score =  179 bits (455), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 115/364 (31%), Positives = 200/364 (54%), Gaps = 44/364 (12%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFS-------------PGI 55
            KTE P+SKKIEDA  EGN P S++A+   +++  +   LF  S                
Sbjct: 7   EKTEEPTSKKIEDARKEGNVPKSQDAAAIVTLIIGVTITLFMMSFMGERIVNLYRYYQSF 66

Query: 56  YSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLL-FMMFGIGSYLIQR 114
             V  DL ++ A      ++ I  ++ +L  + LS   ++I G+L   M FG   ++   
Sbjct: 67  IGVEFDLRIIQAIM----IKSIFEVLIILAPIVLS---IMIAGVLGNIMQFG---FIFTT 116

Query: 115 IPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTML 174
            P++      P+  +++  +G+K ++S+  +V  +K  +K   VG + TI+    +  +L
Sbjct: 117 KPIM------PNLGKINPLKGLKNLFSLKKIVESIKIILK---VGIVFTIA----FIVLL 163

Query: 175 DFISANPHSILYH-----AFFTVRKVLIMILLFIATL--TVLDIGWSYHQWYSKLKMSKQ 227
            F+   P   LY      A+   R +++  ++ +A L   VLD+     Q++  L+MSKQ
Sbjct: 164 KFMQELPRVELYTMVTQLAWLRDRAIVLAAIVIVAFLIIAVLDVFLVRFQYFKGLRMSKQ 223

Query: 228 EIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEND 287
           EIKDE KQ  G+P +K R + +     R +M++  + A ++ITNPTHYA+A+RY  ++  
Sbjct: 224 EIKDEYKQMEGDPQVKGRIRRLQMEAARRRMVQDVAGADVVITNPTHYAVAIRYDTSKEQ 283

Query: 288 APVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIY 347
           AP +VAKG + +A +++++AYE+N+ ++E P LAR L+K   +N  IP   +KAVA+++ 
Sbjct: 284 APRVVAKGVDFLALRIKQVAYENNVVVYENPPLARELYKACDVNDLIPREMFKAVAEVLG 343

Query: 348 KIYH 351
            +Y+
Sbjct: 344 FVYN 347


>gi|27380920|ref|NP_772449.1| flagellar biosynthesis protein FlhB [Bradyrhizobium japonicum USDA
           110]
 gi|27354086|dbj|BAC51074.1| flagellar biosynthetic protein [Bradyrhizobium japonicum USDA 110]
          Length = 359

 Score =  179 bits (454), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 108/346 (31%), Positives = 191/346 (55%), Gaps = 2/346 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E++ P+++TE P+ K++++AL  G+   S+E + +  I    + +  F       + +
Sbjct: 1   MAEDNDPESQTEDPTQKRLDEALERGDVAKSQEINTWFMIAGGTLVVSTFSGSVGSGLVT 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  LLA++   K  D   ++ LL  +  +    +   LL+ ++  +   ++Q   V + 
Sbjct: 61  PMRNLLANSWMIKT-DGRALLALLQQIEFAVLAAIGVPLLMLVLAAVAGNMLQHRLVWSA 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +KP F ++S   G KRI+      NF+K   K+I++G ++   L      M   +  +
Sbjct: 120 ESLKPKFSKLSPAAGFKRIFGKQAAANFLKGLGKLIVLGVVMGTILWPERHRMEAMVRLD 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P ++L         +L  ++  +A + + D  + Y  W+ + KMS QEIK+E KQS G+P
Sbjct: 180 PAAMLGATTSLTIHLLGAVVAALAIIAIGDYFFQYRSWFQRQKMSLQEIKEEFKQSEGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK + + + + R + +MM A  +A++IITNPTH+++AL Y +    AP+ VAKG + +A
Sbjct: 240 HIKGKIRQLRQQRAKKRMMAAVPKASVIITNPTHFSVALSY-ERGMQAPICVAKGVDNLA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
            K+R+IA EH+IPI E   LAR+L+  V I+  IP   Y AVA++I
Sbjct: 299 FKIREIAREHDIPIVENVPLARALYATVEIDQEIPTEHYHAVAEVI 344


>gi|254497495|ref|ZP_05110288.1| flagellar biosynthesis protein FlhB [Legionella drancourtii LLAP12]
 gi|254353310|gb|EET12052.1| flagellar biosynthesis protein FlhB [Legionella drancourtii LLAP12]
          Length = 378

 Score =  179 bits (453), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 108/361 (29%), Positives = 193/361 (53%), Gaps = 22/361 (6%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE +  D KTE PS+K++++A  +G    S++   F++ +A     L F + G  +   
Sbjct: 1   MSEQNN-DEKTEQPSAKRLKEARQKGQVARSKD---FNTTVA-----LLFTAVGFLAFGK 51

Query: 61  DLHVLLASATQRKLEDISHIV----------FLLTHLSLSASRLVIPGLLLFMMFGIGSY 110
            L   LA   +   E  ++++          F L  +   A   ++P L+   +  + + 
Sbjct: 52  QLSDQLALMMRHSFEFDTNVIITPVVSLERLFFLAKMGFWA---LVPILIFIFVVSLAAP 108

Query: 111 LIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENY 170
           L+    V +   V+P F R+++ +G+KR+ S+ N V  +KSF K +LV ++  I L    
Sbjct: 109 LVMGGWVFSAKVVQPKFSRLNVFQGLKRMVSLKNFVEMIKSFFKFVLVASVAVIVLKSQI 168

Query: 171 FTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIK 230
            T+L        + +      V K  +++   +  + +LD+ +  ++    +KM+KQE++
Sbjct: 169 PTLLSLAHVPIETAIGSGALIVVKCFVLVAASLLLIAMLDVPFQLYEHNKNMKMTKQELR 228

Query: 231 DEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPV 290
           DE K++ G P +KN  +   +   + +MM     A +++TNPTHYA+A+RY +  N APV
Sbjct: 229 DEYKETEGKPEVKNAIRRAQQEIAKRRMMTEIPTANVVLTNPTHYAVAIRYKEKGNKAPV 288

Query: 291 LVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           +VAKG++L+A ++ K+A EH IPI   P LAR+L+    +N+ IP   Y AVAQ++  ++
Sbjct: 289 VVAKGKDLVAFQINKVAKEHEIPIISVPPLARALYFSTKLNAEIPRGLYIAVAQVLAYVF 348

Query: 351 H 351
            
Sbjct: 349 Q 349


>gi|92116950|ref|YP_576679.1| flagellar biosynthesis protein FlhB [Nitrobacter hamburgensis X14]
 gi|91799844|gb|ABE62219.1| flagellar biosynthetic protein FlhB [Nitrobacter hamburgensis X14]
          Length = 359

 Score =  179 bits (453), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 114/346 (32%), Positives = 188/346 (54%), Gaps = 2/346 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++      KTE P+ K+++DAL  G+   S+E + +  I    + L  F       V  
Sbjct: 1   MADESDDTEKTEDPTQKRLDDALERGDVAKSQEVNTWFVIAGATLVLATFGGSVGGGVEM 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  L+A++ Q +  D   ++ L   L    +  +   LL+ M+  I   ++Q   V + 
Sbjct: 61  PLRNLIANSWQIRT-DGPGLLALAQQLEYILAAALGLPLLMLMLAAIAGNVVQHRFVWSG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +KP   ++S+  G KRI+      NF K   K++ +G ++T  L      +   +  +
Sbjct: 120 ETLKPKLSKISVVSGAKRIFGKQAAANFAKGLFKVLALGAVMTAVLWPERSRLDALVRLD 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P++IL        ++L  ++  +A + + D  + Y QW+ + KMS +E+K+E KQS G+P
Sbjct: 180 PNAILPTTTTLTLQLLGAVVAMLALVAIADYLFQYRQWFERQKMSLREMKEEFKQSEGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R + +  +R++ +MM A  +A++IITNPTHY++AL Y +    APV VAKG + IA
Sbjct: 240 HIKARIRQLRHARMKKRMMAAVPKASVIITNPTHYSVALSY-ERGMSAPVCVAKGMDNIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
            K+R+IA EH+IPI E   LAR+L+  V I+  IP   Y AVA++I
Sbjct: 299 LKIREIAREHDIPIVENVPLARALYATVKIDDEIPVEHYHAVAEII 344


>gi|237731916|ref|ZP_04562397.1| flagellar biosynthesis protein FlhB [Citrobacter sp. 30_2]
 gi|226907455|gb|EEH93373.1| flagellar biosynthesis protein FlhB [Citrobacter sp. 30_2]
          Length = 383

 Score =  179 bits (453), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 108/367 (29%), Positives = 201/367 (54%), Gaps = 30/367 (8%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREAS--LFSSILACLIY---------LLF 49
           M+E ++ D+KTEAP+  ++E A  EG  P S+E +  L   +  C+I+         L  
Sbjct: 1   MAE-ESDDDKTEAPTPHRLEKAREEGQIPRSKELTSLLILLVGVCIIWIGGESLARRLAG 59

Query: 50  FFSPGI---YSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFG 106
             S G+   +S+ +D +++L+       + +  ++ L+T + L A  L+ P +L  ++F 
Sbjct: 60  MLSAGLRFDHSMVNDPNLILSQIILLIKDAMIALLPLITGVVLVA--LISPVMLGGLIFS 117

Query: 107 IGSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISL 166
             S             ++P F +++   GIKR++S       +K+ +K  LVG++    L
Sbjct: 118 GKS-------------LQPKFSKLNPLPGIKRMFSAQTGAELLKAILKSTLVGSVAGFYL 164

Query: 167 TENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSK 226
             N+  M+  ++ +P + + +A   V    ++++L +  +   D+ +  +    KL+MS+
Sbjct: 165 WHNWPAMMRLMAESPITAMGNALDLVGMCALLVVLGVIPMVGFDVFFQIYSHVKKLRMSR 224

Query: 227 QEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEN 286
           Q+I+DE KQS G+P +K + + + R+  + +MM    +A +I+TNPTHY++AL+Y + + 
Sbjct: 225 QDIRDEFKQSEGDPHVKGKIRQMQRAAAQRRMMADVPKADVIVTNPTHYSVALKYDENKM 284

Query: 287 DAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
            AP +VAKG  L+A ++R+I  EH +P  E P LAR+L++   I   IP   Y AVA+++
Sbjct: 285 SAPKVVAKGAGLVALRIREIGAEHRVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVL 344

Query: 347 YKIYHKK 353
             ++  K
Sbjct: 345 AWVWQLK 351


>gi|46200838|ref|ZP_00207865.1| COG1377: Flagellar biosynthesis pathway, component FlhB
           [Magnetospirillum magnetotacticum MS-1]
          Length = 324

 Score =  179 bits (453), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 94/266 (35%), Positives = 163/266 (61%), Gaps = 4/266 (1%)

Query: 83  LLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSI 142
           LL+ +++   ++++  +++ ++  + S + Q   +   + +   F ++S  +GI RI+S 
Sbjct: 49  LLSMITMDMLKILVLPMMMLVVLALVSAMGQSGLMFLPDKLTMDFSKLSPMKGITRIFSG 108

Query: 143 NNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAFFTVRKVLIMILLF 202
            NLV F KS  K+  +G +I + L  +        + +  ++L +    V  ++++++L 
Sbjct: 109 RNLVEFAKSLFKVSAIGFVIFLVLKSHMSEYAGLAALDLMAVLDYMRHQVIAMIMIVVLM 168

Query: 203 IATLTVLDIGWSYHQWY--SKLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMME 260
           +  L   D  W Y +W    ++KM+KQEIKDE KQ+ G+P+IK R +++   R R +MM 
Sbjct: 169 VFVLAAAD--WFYQRWAFNQQMKMTKQEIKDEHKQTEGDPMIKGRLRALRMQRARQRMMA 226

Query: 261 ATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSL 320
           A  +A++++TNPTHYA+AL+Y Q    APVLVAKG +LIAK++R +A E+ +PI E P L
Sbjct: 227 AVPKASVVVTNPTHYAVALQYDQDSMGAPVLVAKGVDLIAKRIRDLATENEVPIVENPPL 286

Query: 321 ARSLFKQVPINSAIPPVFYKAVAQLI 346
           AR+L+  V ++  IPP  YK VA++I
Sbjct: 287 ARALYATVELDEEIPPEHYKTVAEII 312


>gi|163744325|ref|ZP_02151685.1| flagellar biosynthetic protein FlhB [Oceanibulbus indolifex HEL-45]
 gi|161381143|gb|EDQ05552.1| flagellar biosynthetic protein FlhB [Oceanibulbus indolifex HEL-45]
          Length = 372

 Score =  178 bits (452), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 109/350 (31%), Positives = 191/350 (54%), Gaps = 5/350 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS+ D   +KTE P+ KK+ DA  +G+ P SRE      + A L+ L+F     +  +  
Sbjct: 1   MSDEDK-SSKTEEPTEKKLRDARKKGDVPQSRETGTAMLVFALLMILVFVLPSSVGGIVE 59

Query: 61  DLHVLL----ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIP 116
            L   L     +A       +     +L  L  +    ++P + + ++  +   LIQ   
Sbjct: 60  ALQAPLLEAGVTAIGTGGTGLVEAGSVLKSLGFTLGLAMMPVVGIMVLAALFGVLIQGET 119

Query: 117 VLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDF 176
           V++   +KP   +++   G KR++S    V F K+ VK++++G I   ++ +   ++   
Sbjct: 120 VVSAERIKPKISKLNPLSGFKRLFSAEAFVEFAKNTVKVLVIGFITVWAVRDIAQSLGQT 179

Query: 177 ISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQS 236
            +  P ++L      VR + ++   F+  + + DI W   QW  K  MS +EI+DE K S
Sbjct: 180 QAFVPETLLAATLQKVRWIFLVTATFLVPIAIADIIWKRAQWKKKQMMSLKEIRDEHKDS 239

Query: 237 YGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQ 296
            G+P IK R+  + R+R R ++ +A   A++++TNPTHYA+AL+Y Q  +D PV VAKG 
Sbjct: 240 EGDPQIKGRRAELRRARARQRIAQAIPGASVVLTNPTHYAVALKYEQGVDDVPVCVAKGA 299

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           +++A+++R++A EH+IP+ E   LAR+L   V ++  IP   ++AVA++I
Sbjct: 300 DVMAQRIRELAKEHDIPMIENRPLARALHAAVEVDDRIPMEHWQAVAEII 349


>gi|323977935|gb|EGB73021.1| flagellar biosynthetic protein FlhB [Escherichia coli TW10509]
          Length = 382

 Score =  178 bits (452), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 108/364 (29%), Positives = 197/364 (54%), Gaps = 29/364 (7%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREAS--LFSSILACLIY---------LLFFFS 52
           +D  D+KTEAP+  ++E A  EG  P SRE +  L   +  C+I+         L    S
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVCVIWFGGVSLARRLSGMLS 61

Query: 53  PGIY---SVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGS 109
            G++   ++ +D +++L        E +  ++ L++ + L A  L+ P +L  ++F   S
Sbjct: 62  AGLHFDHNIINDPNLILGQIILLIREAMLGLLPLISGVVLVA--LISPVMLGGLVFSGKS 119

Query: 110 YLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTEN 169
                        ++P F +++   GIKR++S       +K+ +K ILVG++    L  +
Sbjct: 120 -------------LQPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFYLWHH 166

Query: 170 YFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEI 229
           +  M+  ++ +P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I
Sbjct: 167 WPQMMRLMAESPITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDI 226

Query: 230 KDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAP 289
           +DE KQS G+P +K R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP
Sbjct: 227 RDEFKQSEGDPHVKGRIRQMQRAAARRRMMNDVPKADVIVNNPTHYSVALQYDEHKMSAP 286

Query: 290 VLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKI 349
            +VAKG  L+A ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  +
Sbjct: 287 KVVAKGAGLVALRIREIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWV 346

Query: 350 YHKK 353
           +  K
Sbjct: 347 WQLK 350


>gi|218548562|ref|YP_002382353.1| flagellar biosynthesis protein FlhB [Escherichia fergusonii ATCC
           35469]
 gi|218356103|emb|CAQ88720.1| flagellar export pore protein [Escherichia fergusonii ATCC 35469]
 gi|324113614|gb|EGC07589.1| flagellar biosynthetic protein FlhB [Escherichia fergusonii B253]
 gi|325496979|gb|EGC94838.1| flagellar biosynthesis protein FlhB [Escherichia fergusonii ECD227]
          Length = 382

 Score =  178 bits (452), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 104/353 (29%), Positives = 192/353 (54%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G  S+   L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRE---LTSMLILLVGVCVIWFGG-ESLARQLA 57

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++        + D + I+  +  L   A   ++P +   ++  + S ++    + + 
Sbjct: 58  AMLSAGLHFDHHLINDPNLILGQIILLIKQAMMALLPLITGVVLVALISPVLLGGLIFSG 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K  LVG +    L   +  M+  ++ +
Sbjct: 118 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAILKSTLVGCVAGFYLWHKWPEMMRLMAQS 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P
Sbjct: 178 PITAMGNALDLVGLCALLVVLGVIPMVGFDVFYQIFSHLKKLRMSRQDIRDEFKQSEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP ++AKG  L+A
Sbjct: 238 HVKGRIRQMQRAAARRRMMNDVPQADVIVNNPTHYSVALQYDENKMSAPKVIAKGAGLVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+IA EH+IP  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 298 LRIREIAAEHHIPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|308273532|emb|CBX30134.1| Flagellar biosynthetic protein flhB [uncultured Desulfobacterium
           sp.]
          Length = 356

 Score =  178 bits (452), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 118/357 (33%), Positives = 196/357 (54%), Gaps = 10/357 (2%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREAS----LFSSILACLIYLLFFFSPGIY 56
           M+E +A   KTE P+ KK ED   +G    S+E S    LFS + A  IY  F  S  + 
Sbjct: 1   MAE-EASGEKTEKPTPKKREDIRKKGEVAKSKELSSVVVLFSGLFAMGIYGSFMLSK-VQ 58

Query: 57  SVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIP 116
            +T  L   L++ T   L  I  ++    HL +S   ++ P L       + S + Q   
Sbjct: 59  EITKSL---LSNPTITDL-TIHGVMEFSRHLIISFVVILAPLLAAVFAGAVLSNIAQVGF 114

Query: 117 VLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDF 176
           +++   +KP F +++  +G+KR+ S+ +++   KS VK+I+VG    +++T     +   
Sbjct: 115 MVSGELIKPKFSKLNPFKGLKRLVSMQSVMELFKSMVKLIIVGATAYLTITHEMDNVSML 174

Query: 177 ISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQS 236
                 SI ++ F T   + +   + +  L V+D  +   ++  ++KMSKQEIKDE K++
Sbjct: 175 GELELVSIFHYIFATFYNIFLKCSIAMLVLVVIDYAYQRWEFEKRIKMSKQEIKDEYKKT 234

Query: 237 YGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQ 296
            G+P +K+R ++I     R +MM+   +A +IITNPTH+A+A++Y   E +AP ++AKG 
Sbjct: 235 EGDPQVKSRIRAIQMEMARKRMMQDVPKADVIITNPTHFAVAIKYNGLEMNAPKVIAKGA 294

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
             IA +++ +A +HNIP+ E   LAR+L+K V I   IP   Y+AVA ++  IY  K
Sbjct: 295 GEIAARIKSLAADHNIPVVENKELARNLYKLVEIGREIPADLYQAVAGVLAYIYKLK 351


>gi|209964223|ref|YP_002297138.1| flagellar biosynthesis protein FlhB [Rhodospirillum centenum SW]
 gi|209957689|gb|ACI98325.1| flagellar biosynthetic protein FlhB [Rhodospirillum centenum SW]
          Length = 359

 Score =  178 bits (452), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 112/355 (31%), Positives = 201/355 (56%), Gaps = 4/355 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISRE-ASLFSSILACLIYLLFFFSPGIYSVT 59
           M+E+   D+KTE P+ KK+ DA  +G    S E  +LF  ILA  + ++    P    + 
Sbjct: 1   MAEDQDQDSKTEEPTDKKLSDAREKGQVAKSMEVGNLF--ILASGLVMVLLLLPWSGRIL 58

Query: 60  SDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLN 119
            D  +         L   + +  +LT L+L  +  + P L+L ++  + + +IQ   + +
Sbjct: 59  WDAMMPFVERPHAILMAPAALGDVLTDLTLDIAFALAPTLVLLLLAALAAPIIQVGLMFS 118

Query: 120 LNHV-KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFIS 178
             +V K    +V+   G+K   S+ NLV F+KS  K++LVG ++++ L   + ++  F++
Sbjct: 119 AENVFKFDLNKVNPLTGLKNKVSLKNLVEFLKSLGKLVLVGIVVSVLLLPLWTSIEHFLA 178

Query: 179 ANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYG 238
               S++        K++  +++ +  +   D  +  +Q+  +++M+KQE+KDE KQ+ G
Sbjct: 179 LPLPSVIVETRHEAAKLIAAVVIVLGAIAGADYAFQRYQFMQQMRMTKQEVKDEYKQTEG 238

Query: 239 NPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL 298
           +P+IK++ + +   R R++MM A   A +++TNPTH+A+AL+Y  +   AP +VAKG +L
Sbjct: 239 DPLIKSKIRQLRMQRSRNRMMAAVPSADVVVTNPTHFAVALKYDASAMSAPRVVAKGADL 298

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           IAK++R++A E  +P+   P LAR+LF    I+  IP   YKAVAQ+I  ++  K
Sbjct: 299 IAKRIRELAEEAGVPVISNPPLARALFATAEIDEEIPAEHYKAVAQVISYVFKLK 353


>gi|224373568|ref|YP_002607940.1| flagellar biosynthetic protein FlhB [Nautilia profundicola AmH]
 gi|223588472|gb|ACM92208.1| flagellar biosynthetic protein FlhB [Nautilia profundicola AmH]
          Length = 351

 Score =  178 bits (452), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 117/353 (33%), Positives = 197/353 (55%), Gaps = 18/353 (5%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE P+ KK++DA  EGN P S E S F  +   +I ++F+     Y +    ++   S
Sbjct: 6   EKTEDPTPKKLQDARKEGNVPKSMETSGFVVLFVAIIVIIFYLKYITYYL-EKFYMYYTS 64

Query: 69  ATQRKLEDISHIVF-LLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
                +E   +IVF ++   +L+   L+ P L   ++ GI   ++Q   +  +  + P F
Sbjct: 65  FIG--VEITKNIVFEIVLKSALNFFILLAPLLGAVVLAGILGNVMQFGFLFTVKPIIPKF 122

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
           ++++  +GIKR++S+  LV  +K  +K+       +++     +  + F+   P   L  
Sbjct: 123 EKINPIKGIKRLFSLKTLVEGIKMTLKV-------SVAFGVGAWLFMKFLEEIPKLELMS 175

Query: 188 AFFTVR----KVLIMILLFIATLTV---LDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            F  ++    K LI+I   +A   V   +D  +  + +   L+MSKQEIKDE KQ+ GNP
Sbjct: 176 FFEQLKWFEEKALIIISAMLAVFLVFAAIDFIYQRYSYKKSLRMSKQEIKDEYKQTEGNP 235

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK + + + R   + +MM    +A ++ITNPTHYA+A+RY +T+++AP ++AKG + +A
Sbjct: 236 EIKAKIRQLQREMAKKRMMSEVPKADVVITNPTHYAVAIRYDKTKDEAPRVIAKGVDNLA 295

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+++IA EH+I I E P LAR L+K V I+  IP   YKAVA+++  +Y  K
Sbjct: 296 LKIKEIAREHDIMIVENPPLARELYKLVDIDELIPQKLYKAVAEVLAFVYKAK 348


>gi|229544411|ref|ZP_04433469.1| flagellar biosynthetic protein FlhB [Bacillus coagulans 36D1]
 gi|229324896|gb|EEN90573.1| flagellar biosynthetic protein FlhB [Bacillus coagulans 36D1]
          Length = 360

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 109/351 (31%), Positives = 196/351 (55%), Gaps = 14/351 (3%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE  + KK  DA  +G    S++  + ++++   ++L  +F  G  S+ S +  L   
Sbjct: 14  EKTEKATPKKRRDARKKGQTAKSQD--IVTAVMLLAVFLFLYF--GASSIGSPMMALFRQ 69

Query: 69  A-TQRKLEDISH--IVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           A ++  L+D++   +  L+T +    + +++P + + ++ G+   + Q   +     +KP
Sbjct: 70  AFSKYMLQDVTEQSVGKLMTGVMKQLASMLLPVMAVALLAGVVGNVAQTGLLFTGEGLKP 129

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENY--FTMLDFISANPHS 183
           +  +++   G+KRI+SI  LV  +KS +K+ +VG +    +  N    + L F SA    
Sbjct: 130 NINKINPVAGLKRIFSIRALVELLKSVLKMAVVGVVAFYVIWANIQDISGLPFKSAGDTL 189

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
                   +  +   + LF+  L VLD  +    +   ++MSKQEIK+E K   G+P+IK
Sbjct: 190 AAVGHLAAITGISASVALFV--LAVLDYLYQRFDFEKNIRMSKQEIKEEFKNMEGDPLIK 247

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
           ++ +   R     +MM+    A ++ITNPTH+A+ LRY +T++DAP++VAKG + +A+K+
Sbjct: 248 SKIRQKQREMAMRRMMQEVPNADVVITNPTHFAVCLRYDETKSDAPIVVAKGADFLAQKI 307

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQL---IYKIYH 351
           + IA EH+I + E   LAR+L++QV +   IP  F+KAVA++   +YKI H
Sbjct: 308 KSIAKEHDIVMLENRPLARALYEQVEVGGRIPEQFFKAVAEILAYVYKIKH 358


>gi|254420201|ref|ZP_05033925.1| flagellar biosynthetic protein FlhB [Brevundimonas sp. BAL3]
 gi|196186378|gb|EDX81354.1| flagellar biosynthetic protein FlhB [Brevundimonas sp. BAL3]
          Length = 358

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 102/355 (28%), Positives = 190/355 (53%), Gaps = 2/355 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++  P++KTE  + +K+EDA  +G+   S++     S+      +L        S+  
Sbjct: 1   MADDTDPESKTEDATPRKLEDARKKGDVAKSQDVGQVLSLAGAAAVILGAGGWFAGSMAQ 60

Query: 61  DLHVLLASATQR-KLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLN 119
            L   +A+  Q   + D      +L     + +  +   +L  ++ G G +L Q   +  
Sbjct: 61  QLLPFIAAPHQMLGMLDSGAGAQILAQALWAMTPFLGAVMLATIIGGAGGHLAQSGLIFT 120

Query: 120 LNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISA 179
              +KP +  V+   G KRI+  + L+ F+K+F+K+I V  +  + L  +     + ++ 
Sbjct: 121 AEKLKPKWSSVNPMSGFKRIFGPDGLMQFVKTFLKLIAVCVVCWMVLKPHVREFENMVTL 180

Query: 180 NPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
           +P ++L  A      + +  ++ +      D  W   ++  +++M+K+E+K++ KQS G+
Sbjct: 181 SPAALLPLARDMALALFVAAIILLGATAGADFIWQKMRFAKRMRMTKEELKEDYKQSEGD 240

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEND-APVLVAKGQNL 298
           P IK + K I   R R +MM    +AT+I+TNPTHY++ALRY  +E D APV VAKG + 
Sbjct: 241 PHIKAKLKQIRMQRSRQRMMANVPKATVIVTNPTHYSVALRYEPSEGDGAPVCVAKGVDA 300

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +A ++R++A EH +PI E   LAR+L+  V I++ IP   ++A A++I  ++  +
Sbjct: 301 LAMRIREVAKEHGVPIVENVPLARALYASVEIDAVIPKEHFEAAAKIIGFVFQSR 355


>gi|33601532|ref|NP_889092.1| flagellar biosynthesis protein FlhB [Bordetella bronchiseptica
           RB50]
 gi|33575968|emb|CAE33047.1| flagellar biosynthetic protein FlhB [Bordetella bronchiseptica
           RB50]
          Length = 384

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 107/350 (30%), Positives = 178/350 (50%), Gaps = 15/350 (4%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            K+EA S +++E A  EG    SRE   F  + A +         G++   S L+  L  
Sbjct: 8   EKSEAASPRRLEKAREEGQIARSRELGTFMMLAAGVA--------GVWLSGSMLYQGLTG 59

Query: 69  ATQRKL-------EDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLN 121
             +R L       +D   +V    H +  A   V+P   +  +  + S ++    V +  
Sbjct: 60  VLRRGLGFEPRVAQDPGVMVEQAVHGAGRALLTVLPMFGMLAVVAVLSAVLLGGFVFSTK 119

Query: 122 HVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANP 181
            ++P+F ++SL  GIKR++S   +V  +K+  K  LVG +    +   +  ML  +   P
Sbjct: 120 PLEPNFSKLSLWSGIKRMFSAQTVVELVKALAKAALVGGVAVWVIWHYHDDMLGLMHVAP 179

Query: 182 HSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPI 241
            + L  A   V     +I+  +  + +LD+ W       KL+M+K++++ E K+S G+P 
Sbjct: 180 SAALTSAMSLVALCSALIVGSLLFVVLLDVPWQIWNHLKKLRMTKEDVRQEHKESEGDPH 239

Query: 242 IKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAK 301
           +K R +   R+  R +MM     A +++TNPTHYA+AL+Y   E  AP +VAKG  LIA 
Sbjct: 240 VKGRIRQQQRAMARRRMMSEVPGADVVVTNPTHYAVALKYADGEAGAPRVVAKGTGLIAA 299

Query: 302 KMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           ++R++A EH IP  E P LAR+L + V +   IP   Y AVA+++  ++ 
Sbjct: 300 RIRELAAEHRIPTLEAPPLARALHQHVELGQEIPTALYTAVAEVLAWVFQ 349


>gi|163856421|ref|YP_001630719.1| flagellar biosynthesis protein FlhB [Bordetella petrii DSM 12804]
 gi|163260149|emb|CAP42450.1| flagellar biosynthesis protein FlhB [Bordetella petrii]
          Length = 379

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 109/344 (31%), Positives = 179/344 (52%), Gaps = 4/344 (1%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIY-SVTSDLHVLLA 67
            KTEA S +++E A  EG    SRE   F  +LA  +  L+     +Y  +T  L   L 
Sbjct: 8   EKTEAASPRRLEKAREEGQIARSRELGTFL-LLAAGVGGLWLSGSMLYRGLTGVLRNGLG 66

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
               R   D   +V      +  A  LV+P   + M   + + ++    V +   ++P F
Sbjct: 67  F-DARIGRDPGIMVAQAVDGAGQALLLVLPIFGVLMAVAVLASVVLGGFVFSAKPLQPDF 125

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
            ++SL  G+KR+ S   +V  +K+  K +LVG +    +  +   ML  + A P   L  
Sbjct: 126 AKLSLFSGLKRMVSAQTVVELLKAVAKALLVGGVAVAVIGGHRDEMLALMHAAPTEALVK 185

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
           A   V     +I+  +  + +LD+ W       KL+MSK++++ E K+S G+P IK R +
Sbjct: 186 ALTLVALCAALIVASLGIIVLLDVPWQIWSHLKKLRMSKEDVRQEHKESEGDPHIKARIR 245

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              RS  R +MM    RA +++TNPTHYA+ALRY + +  AP +VAKG  L+A ++R++A
Sbjct: 246 QQQRSMARRRMMSEVPRADVVVTNPTHYAVALRYAEGQA-APRVVAKGTGLVAARIRELA 304

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
             H +P+ + P LAR+L++ V +   IP   Y AVA+++  ++ 
Sbjct: 305 AGHRVPLLQAPPLARALYQHVELGQEIPAALYTAVAEVLAWVFQ 348


>gi|284925607|gb|ADC27959.1| flagellar biosynthesis protein FlhB [Campylobacter jejuni subsp.
           jejuni IA3902]
          Length = 362

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 114/364 (31%), Positives = 199/364 (54%), Gaps = 44/364 (12%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFS-------------PGI 55
            KTE P+SKKIEDA  EGN P S++A+   +++  +   LF  S                
Sbjct: 7   EKTEEPTSKKIEDARKEGNVPKSQDAAAIVTLIIGVTITLFMLSFMGERIVNLYRYYQSF 66

Query: 56  YSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLL-FMMFGIGSYLIQR 114
             V  DL ++ A      ++ I  ++ +L  + LS   ++I G+L   M FG   ++   
Sbjct: 67  IGVEFDLRIIQAIM----IKSIFEVLIILAPIVLS---IMIAGVLGNIMQFG---FIFTT 116

Query: 115 IPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTML 174
            P++      P+  +++  +G+K ++S+  +V  +K  +K   VG + TI+    +  +L
Sbjct: 117 KPIM------PNLGKINPLKGLKNLFSLKKIVESIKIILK---VGIVFTIA----FIVLL 163

Query: 175 DFISANPHSILYH-----AFFTVRKVLIMILLFIATL--TVLDIGWSYHQWYSKLKMSKQ 227
            F+   P   LY       +   R +++  ++ +A L   VLD+     Q++  L+MSKQ
Sbjct: 164 KFMQELPRVELYTMVAQLTWLRDRAIVLAAIVIVAFLIIAVLDVFLVRFQYFKGLRMSKQ 223

Query: 228 EIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEND 287
           EIKDE KQ  G+P +K R + +     R +M++  + A ++ITNPTHYA+A+RY  ++  
Sbjct: 224 EIKDEYKQMEGDPQVKGRIRRLQMEAARRRMVQDVAGADVVITNPTHYAVAIRYDTSKEQ 283

Query: 288 APVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIY 347
           AP +VAKG + +A +++++AYE+N+ ++E P LAR L+K   +N  IP   +KAVA+++ 
Sbjct: 284 APRVVAKGVDFLALRIKQVAYENNVVVYENPPLARELYKACDVNDLIPREMFKAVAEVLG 343

Query: 348 KIYH 351
            +Y+
Sbjct: 344 FVYN 347


>gi|317048539|ref|YP_004116187.1| flagellar biosynthetic protein FlhB [Pantoea sp. At-9b]
 gi|316950156|gb|ADU69631.1| flagellar biosynthetic protein FlhB [Pantoea sp. At-9b]
          Length = 384

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 103/354 (29%), Positives = 193/354 (54%), Gaps = 7/354 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++  + ++KTE+P++ ++E A  +G  P SRE    +S+L  L  ++  +  G  S+  
Sbjct: 1   MADESSDEDKTESPTAHRLEKARQDGQIPRSRE---LTSLLMMLSGIMILWLGGT-SIAR 56

Query: 61  DLHVLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPV 117
            L  ++A+        + D   IV  ++ L   A   V+P +   ++  I + ++    V
Sbjct: 57  RLASMVATGFRFDHGMVTDDKVIVAHISSLIGQAVLAVLPLMAGLVLVAIAAPMLLGGIV 116

Query: 118 LNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFI 177
           ++   + P F +++   G+KR+ S       +K+ +K +LVG +    +  ++  ML  I
Sbjct: 117 ISGKSLSPDFTKLNPLSGLKRMVSGQTWAELLKAILKAVLVGLVAGWYIWSHWPEMLRLI 176

Query: 178 SANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSY 237
           S +P + L H    +    ++++L +  +   D+ W  + ++ KL+MS+Q+I+DE KQ  
Sbjct: 177 SESPMNALEHGMDMIAICCVLVMLGLIPMVGFDVFWQLYSYFKKLRMSRQDIRDEFKQQE 236

Query: 238 GNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQN 297
           G+P +K R +   R+  R +MM    +A +I+TNPTHY++AL+Y   +  AP ++AKG  
Sbjct: 237 GDPHVKGRIRQAMRAAARRRMMADVPKADVIVTNPTHYSVALQYNDKKMSAPKVIAKGAG 296

Query: 298 LIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            +A K+R++  EH +PI E P LAR+L++   I   IP   Y AVA+++  ++ 
Sbjct: 297 EVALKIRELGKEHRVPILEAPPLARALYRHTEIGQFIPGALYAAVAEVLAWVWQ 350


>gi|56413166|ref|YP_150241.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197362092|ref|YP_002141729.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|56127423|gb|AAV76929.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197093569|emb|CAR59032.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
          Length = 383

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 104/353 (29%), Positives = 194/353 (54%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            ++ D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G  S+   L 
Sbjct: 3   EESDDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVCIIWFGG-ESLARQLA 58

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++      R + D + I+  +  L  +A   ++P +   ++  + S ++    + + 
Sbjct: 59  GMLSAGLHFDHRMVNDPNLILGQIILLIKAAMMALLPLIAGVVLVALISPVMLGGLIFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K  LVG +    L  ++  M+  ++ +
Sbjct: 119 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAVLKSTLVGCVTGFYLWHHWPQMMRLMAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE K+S G+P
Sbjct: 179 PIVAMGNALDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + + R+  + +MME   +A +I+TNPTHY++AL+Y + +  AP +VAKG  LIA
Sbjct: 239 HVKGKIRQMQRAAAQRRMMEDVPKADVIVTNPTHYSVALQYDENKMSAPKVVAKGAGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  EH +P  E P LAR+L++   I   IP   Y AVA+++  I+  K
Sbjct: 299 LRIREIGAEHRVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWIWQLK 351


>gi|161502970|ref|YP_001570082.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160864317|gb|ABX20940.1| hypothetical protein SARI_01032 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 383

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 103/353 (29%), Positives = 194/353 (54%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            ++ D+KTE P+  ++E A  EG  P SRE    +S+L  L+ +   +  G  S+   L 
Sbjct: 3   EESDDDKTEDPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVCIIWFGG-ESLARQLA 58

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++      R + D + I+  +  L  +A   ++P +   ++  + S ++    + + 
Sbjct: 59  GMLSAGLHFDHRMVNDPNLILGQIILLIKAAMMALLPLIAGVVLVALISPVMLGGLIFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K  LVG +    L  N+  M+  ++ +
Sbjct: 119 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAVLKSTLVGCVTGSYLWHNWPQMMRLMAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE K+S G+P
Sbjct: 179 PITAMGNALNLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + + R+  + +MME   +A +I+TNPTHY++AL+Y + +  AP +VAKG  LIA
Sbjct: 239 HVKGKIRQMQRAAAQRRMMEDVPKADVIVTNPTHYSVALQYEENKMSAPKVVAKGAGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  EH +P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 299 LRIREIGAEHRVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 351


>gi|148926430|ref|ZP_01810113.1| flagellar biosynthetic protein [Campylobacter jejuni subsp. jejuni
           CG8486]
 gi|145844593|gb|EDK21699.1| flagellar biosynthetic protein [Campylobacter jejuni subsp. jejuni
           CG8486]
          Length = 362

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 114/364 (31%), Positives = 199/364 (54%), Gaps = 44/364 (12%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFS-------------PGI 55
            KTE P+SKKIEDA  EGN P S++A+   +++  +   LF  S                
Sbjct: 7   EKTEEPTSKKIEDARKEGNVPKSQDAAAIVTLIIGVTITLFMMSFMGERIVNLYRYYQSF 66

Query: 56  YSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLL-FMMFGIGSYLIQR 114
             V  DL ++ A      ++ I  ++ +L  + LS   ++I G+L   M FG   ++   
Sbjct: 67  IGVEFDLRIIQAIM----IKSIFEVLIILAPIVLS---IMIAGVLGNIMQFG---FIFTT 116

Query: 115 IPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTML 174
            P++      P+  +++  +G+K ++S+  +V  +K  +K   VG + TI+    +  +L
Sbjct: 117 KPII------PNLGKINPLKGLKNLFSLKKIVESIKIILK---VGIVFTIA----FIVLL 163

Query: 175 DFISANPHSILYH-----AFFTVRKVLIMILLFIATL--TVLDIGWSYHQWYSKLKMSKQ 227
            F+   P   LY       +   R +++  ++ +A L   VLD+     Q++  L+MSKQ
Sbjct: 164 KFMQELPRVELYTMVTQLTWLRDRAIVLAAIVIVAFLIIAVLDVFLVRFQYFKGLRMSKQ 223

Query: 228 EIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEND 287
           EIKDE KQ  G+P +K R + +     R +M++  + A ++ITNPTHYA+A+RY  ++  
Sbjct: 224 EIKDEYKQMEGDPQVKGRIRRLQMEAARRRMVQDVAGADVVITNPTHYAVAIRYDTSKEQ 283

Query: 288 APVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIY 347
           AP +VAKG + +A +++++AYE+N+ ++E P LAR L+K   +N  IP   +KAVA+++ 
Sbjct: 284 APRVVAKGVDFLALRIKQVAYENNVVVYENPPLARELYKACDVNDLIPREMFKAVAEVLG 343

Query: 348 KIYH 351
            +Y+
Sbjct: 344 FVYN 347


>gi|86153620|ref|ZP_01071823.1| flagellar biosynthetic protein FlhB [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|157414632|ref|YP_001481888.1| flagellar biosynthesis protein FlhB [Campylobacter jejuni subsp.
           jejuni 81116]
 gi|4105266|gb|AAD02331.1| flagellar biosynthetic protein FlhB [Campylobacter jejuni]
 gi|85842581|gb|EAQ59793.1| flagellar biosynthetic protein FlhB [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|157385596|gb|ABV51911.1| flagellar biosynthetic protein [Campylobacter jejuni subsp. jejuni
           81116]
 gi|307747272|gb|ADN90542.1| Flagellar biosynthetic protein [Campylobacter jejuni subsp. jejuni
           M1]
 gi|315931587|gb|EFV10553.1| flagellar biosynthetic protein FlhB [Campylobacter jejuni subsp.
           jejuni 327]
          Length = 362

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 114/364 (31%), Positives = 199/364 (54%), Gaps = 44/364 (12%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFS-------------PGI 55
            KTE P+SKKIEDA  EGN P S++A+   +++  +   LF  S                
Sbjct: 7   EKTEEPTSKKIEDARKEGNVPKSQDAAAIVTLIIGVTITLFMMSFMGERIVNLYRYYQSF 66

Query: 56  YSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLL-FMMFGIGSYLIQR 114
             V  DL ++ A      ++ I  ++ +L  + LS   ++I G+L   M FG   ++   
Sbjct: 67  IGVEFDLRIIQAIM----IKSIFEVLIILAPIVLS---IMIAGVLGNIMQFG---FIFTT 116

Query: 115 IPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTML 174
            P++      P+  +++  +G+K ++S+  +V  +K  +K   VG + TI+    +  +L
Sbjct: 117 KPIM------PNLGKINPLKGLKNLFSLKKIVESIKIILK---VGIVFTIA----FIVLL 163

Query: 175 DFISANPHSILYH-----AFFTVRKVLIMILLFIATL--TVLDIGWSYHQWYSKLKMSKQ 227
            F+   P   LY       +   R +++  ++ +A L   VLD+     Q++  L+MSKQ
Sbjct: 164 KFMQELPRVELYTMVAQLTWLRDRAIVLAAIVIVAFLIIAVLDVFLVRFQYFKGLRMSKQ 223

Query: 228 EIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEND 287
           EIKDE KQ  G+P +K R + +     R +M++  + A ++ITNPTHYA+A+RY  ++  
Sbjct: 224 EIKDEYKQMEGDPQVKGRIRRLQMEAARRRMVQDVAGADVVITNPTHYAVAIRYDTSKEQ 283

Query: 288 APVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIY 347
           AP +VAKG + +A +++++AYE+N+ ++E P LAR L+K   +N  IP   +KAVA+++ 
Sbjct: 284 APRVVAKGVDFLALRIKQVAYENNVVVYENPPLARELYKACDVNDLIPREMFKAVAEVLG 343

Query: 348 KIYH 351
            +Y+
Sbjct: 344 FVYN 347


>gi|157145338|ref|YP_001452657.1| flagellar biosynthesis protein FlhB [Citrobacter koseri ATCC
           BAA-895]
 gi|157082543|gb|ABV12221.1| hypothetical protein CKO_01078 [Citrobacter koseri ATCC BAA-895]
          Length = 383

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 106/364 (29%), Positives = 197/364 (54%), Gaps = 29/364 (7%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREAS--LFSSILACLIY---------LLFFFS 52
            ++ D+KTEAP+  ++E A  EG  P S+E +  L   +  C+I+         L    S
Sbjct: 3   EESDDDKTEAPTPHRLEKAREEGQVPRSKELTSLLILLVGVCIIWIGGESLARRLAGMLS 62

Query: 53  PGI---YSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGS 109
            G+   +S+ +D +++L        E +  ++ L+T + L A  L+ P +L  ++F   S
Sbjct: 63  AGLRFDHSMVNDPNLILGQIILLIKEAMIALLPLITGVVLVA--LISPVMLGGLIFSGKS 120

Query: 110 YLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTEN 169
                        ++P F +++   GIKR++S       +K+ +K  LVG++    L  +
Sbjct: 121 -------------LQPKFSKLNPLSGIKRMFSAQTGAELLKAILKSTLVGSVAGFYLWHH 167

Query: 170 YFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEI 229
           +  M+  ++ +P + + +A   V    ++++L +  +   D+ +       KL+MS+++I
Sbjct: 168 WPEMMRLMAESPVTAMGNALDLVGLCALLVVLGVIPMVAFDVVFQIFSHLKKLRMSRKDI 227

Query: 230 KDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAP 289
           +DE K+S G+P IK + + + R+  + +MME   +A +I+TNPTHY++AL+Y + +  AP
Sbjct: 228 RDEFKESEGDPHIKGKIRQMQRAAAQRRMMEDVPKADVIVTNPTHYSVALQYDENKMSAP 287

Query: 290 VLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKI 349
            +VAKG  L+A ++R+I  EH +P  E P LAR+L++   I   IP   Y AVA+++  +
Sbjct: 288 KVVAKGAGLVALRIREIGAEHRVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWV 347

Query: 350 YHKK 353
           +  K
Sbjct: 348 WQLK 351


>gi|315498431|ref|YP_004087235.1| flagellar biosynthetic protein flhb [Asticcacaulis excentricus CB
           48]
 gi|315416443|gb|ADU13084.1| flagellar biosynthetic protein FlhB [Asticcacaulis excentricus CB
           48]
          Length = 355

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 107/348 (30%), Positives = 189/348 (54%), Gaps = 12/348 (3%)

Query: 5   DAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHV 64
           D  ++KTE  S++K+E+A  +G+   S +     S++A    ++ +      S+T  L V
Sbjct: 3   DEGEDKTEEASARKLEEARKKGDVAKSADVPQALSLIAACALVMLYGDKIALSLTETLRV 62

Query: 65  LLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSY--LIQRIPVLNLNH 122
            +A+    +   +      + H  L    L I  L+L +    G+   L Q   + +   
Sbjct: 63  FVAAPHLLRDSLMGDGGLTIAH-HLMGQVLPIIALILLVAGAAGAIGSLAQTGLMFSTEK 121

Query: 123 VKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPH 182
           +KP F +++   G KR++ ++ L+ F K+ +K+I VG I  + L      +     A+P 
Sbjct: 122 LKPDFSKLNPMAGFKRLFGVDALIQFAKTVIKLIAVGVITWMILKGRAGDVAGLAGASPL 181

Query: 183 SILYHAFFTVRKVLIMILLFIATLTVLDIGWSYH----QWYSKLKMSKQEIKDEIKQSYG 238
            +L +A    ++V   + + +    +L+ G  Y     ++  ++KM+K E+KDE KQ+ G
Sbjct: 182 MVLPYA----KEVFFSLAVAVCLFMLLEGGADYFIQKLRFSQRMKMTKTEVKDEYKQTEG 237

Query: 239 NPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL 298
           +P +K R K I   + R +MM    +AT++ITNPTHYA+ALRY   E  AP+ VAKG + 
Sbjct: 238 DPHVKGRLKQIRMEKSRQRMMANVPKATVVITNPTHYAVALRY-DEETPAPLCVAKGVDT 296

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           +A K+R++A +H+I I E+P LAR+L+  + ++  IP   ++AVA++I
Sbjct: 297 LALKIREVAGDHDIAIVEDPPLARALYAAIDVDEIIPETHFQAVAKII 344


>gi|302878260|ref|YP_003846824.1| flagellar biosynthetic protein FlhB [Gallionella capsiferriformans
           ES-2]
 gi|302581049|gb|ADL55060.1| flagellar biosynthetic protein FlhB [Gallionella capsiferriformans
           ES-2]
          Length = 379

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 118/359 (32%), Positives = 193/359 (53%), Gaps = 14/359 (3%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   KTE PS ++++ A  +G    S E S FS +LA    L F  +    S+ +
Sbjct: 1   MAE-DSDLEKTEQPSQRRLDQAKEKGQVARSTELSTFSILLAGGATLWFMGA----SLNA 55

Query: 61  DLHVLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPV 117
            +  LL  A    Q  +     ++  L  LS+       P LL+ ++  +G+ LI    +
Sbjct: 56  HMVRLLHDALIFNQDVVFKPELMIPRLYDLSMDMLITFAPVLLMMLITALGAPLILNGWL 115

Query: 118 LNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFI 177
            +   + P F R++   GI RI S N+LV  +K+  K  +VG + T  +  +   ++   
Sbjct: 116 FSTEALVPQFSRMNPITGIGRIISTNSLVELVKALGKATIVGGVATWVIWHHRDDVIQLA 175

Query: 178 SANPHSILYHAFFTVRKVLIMILLFIATLTVLDIG---WSYHQWYSKLKMSKQEIKDEIK 234
           S +  + +    + V    + I+  +  +  +D+    WS+++   KL M+K+EI+ E K
Sbjct: 176 SLSVTTAISQTGYLVCGSFLAIVSGMLLIVAIDVPFQLWSHNK---KLMMTKEEIRQESK 232

Query: 235 QSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAK 294
           ++ GNP +K R +S+ R   R +MM A   A +++TNPTHY++AL+Y      APV+VAK
Sbjct: 233 ETDGNPEVKGRIRSMQREAARRRMMSAIPTADVVVTNPTHYSVALKYSDKGMSAPVVVAK 292

Query: 295 GQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           G +LIA ++R+IA E+N+PI E P LAR+L K   I  AIP   Y AVA+++  +Y  K
Sbjct: 293 GSHLIAHRIREIAQENNVPILEAPPLARALHKHTEIGDAIPEALYTAVAEVLAYVYQLK 351


>gi|197265115|ref|ZP_03165189.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197243370|gb|EDY25990.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
          Length = 383

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 103/353 (29%), Positives = 194/353 (54%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            ++ D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G  S+   L 
Sbjct: 3   EESEDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVCIIWFGG-ESLARQLA 58

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++      R + D + I+  +  L  +A   ++P +   ++  + S ++    + + 
Sbjct: 59  GMLSAGLHFDHRMVNDPNLILGQIILLIKAAMMALLPLIAGVVLVALISPVMLGGLIFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K  LVG +    L  ++  M+  ++ +
Sbjct: 119 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAVLKSTLVGCVTGFYLWHHWPQMMRLMAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE K+S G+P
Sbjct: 179 PIVAMGNALDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + + R+  + +MME   +A +I+TNPTHY++AL+Y + +  AP +VAKG  LIA
Sbjct: 239 HVKGKIRQMQRAAAQRRMMEDVPKADVIVTNPTHYSVALQYDENKMSAPKVVAKGAGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  EH +P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 299 LRIREIGAEHRVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 351


>gi|16760863|ref|NP_456480.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|29141445|ref|NP_804787.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|213163285|ref|ZP_03348995.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213426385|ref|ZP_03359135.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213583527|ref|ZP_03365353.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|289824043|ref|ZP_06543641.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|25322221|pir||AF0745 flagellar biosynthetic protein FlhB [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16503160|emb|CAD05665.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29137072|gb|AAO68636.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
          Length = 383

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 103/353 (29%), Positives = 194/353 (54%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            ++ D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G  S+   L 
Sbjct: 3   EESDDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVCIIWFGG-ESLARQLA 58

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++      R + D + I+  +  L  +A   ++P +   ++  + S ++    + + 
Sbjct: 59  GMLSAGLHFDHRMVNDPNLILGQIILLIKAAMMALLPLIAGVVLVALISPVMLGGLIFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K  LVG +    L  ++  M+  ++ +
Sbjct: 119 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAVLKSTLVGCVTGFYLWNHWPQMMRLMAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE K+S G+P
Sbjct: 179 PIVAMGNALDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + + R+  + +MME   +A +I+TNPTHY++AL+Y + +  AP +VAKG  LIA
Sbjct: 239 HVKGKIRQMQRAAAQRRMMEDVPKADVIVTNPTHYSVALQYDENKMSAPKVVAKGAGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  EH +P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 299 LRIREIGAEHRVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 351


>gi|33596133|ref|NP_883776.1| flagellar biosynthesis protein FlhB [Bordetella parapertussis
           12822]
 gi|33573136|emb|CAE36781.1| flagellar biosynthetic protein FlhB [Bordetella parapertussis]
          Length = 384

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 106/350 (30%), Positives = 178/350 (50%), Gaps = 15/350 (4%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            K+EA S +++E A  EG    SRE   F  + A ++        G++   S L+  L  
Sbjct: 8   EKSEAASPRRLEKAREEGQIARSRELGTFMMLAAGVV--------GVWLSGSMLYQGLTG 59

Query: 69  ATQRKL-------EDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLN 121
             +R L       +D   +V    H +  A   V+P   +  +  + S ++    V +  
Sbjct: 60  VLRRGLGFEPRVAQDPGVMVEQAVHGAGRALLTVLPMFGMLAVVAVLSAVLLGGFVFSTK 119

Query: 122 HVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANP 181
            ++P+F ++SL  GIKR++S   +V  +K+  K  LVG +    +   +  ML  +   P
Sbjct: 120 PLEPNFSKLSLWSGIKRMFSAQTVVELVKALAKAALVGGVAVWVIWHYHDDMLGLMHVAP 179

Query: 182 HSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPI 241
            + L  A   V     +I+  +  + +LD+ W       KL+M+K++++ E K+S G+P 
Sbjct: 180 SAALTSAMSLVALCSALIVGSLLFVVLLDVPWQIWNHLKKLRMTKEDVRQEHKESEGDPH 239

Query: 242 IKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAK 301
           +K R +   R+  R +MM     A +++TNPTHYA+AL+Y      AP +VAKG  LIA 
Sbjct: 240 VKGRIRQQQRAMARRRMMSEVPGADVVVTNPTHYAVALKYADGAAGAPRVVAKGTGLIAA 299

Query: 302 KMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           ++R++A EH IP  E P LAR+L + V +   IP   Y AVA+++  ++ 
Sbjct: 300 RIRELAAEHRIPTLEAPPLARALHQHVELGQEIPTALYTAVAEVLAWVFQ 349


>gi|255021385|ref|ZP_05293433.1| Flagellar biosynthesis protein FlhB [Acidithiobacillus caldus ATCC
           51756]
 gi|254969248|gb|EET26762.1| Flagellar biosynthesis protein FlhB [Acidithiobacillus caldus ATCC
           51756]
          Length = 375

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 112/358 (31%), Positives = 198/358 (55%), Gaps = 10/358 (2%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  +   +TEA + KK EDA  +G  P SRE S  + +L     L +     I ++ +
Sbjct: 1   MAEEQS-QERTEAATPKKREDARKKGQVPRSRELSTSALLLLSASLL-YGLGSEIQTMAT 58

Query: 61  DL---HVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPV 117
           D     + L  A     +D+   +  +  L+LS    V+P  L  M+  + + +      
Sbjct: 59  DFLRAGLRLTPAVMSNHQDLLRHLVQMAGLALSD---VLPLWLALMLVVVLASIALGGWN 115

Query: 118 LNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFI 177
            +   + P+F  +   EGI+R++S    +  +K+ +K ++VG I    +      +L  I
Sbjct: 116 FSTKTLIPNFSHLDPIEGIQRLFSRRGFLELVKAALKTLVVGGIGVTVIWAQRGELLGLI 175

Query: 178 SANPHSILYHAFFTVRKVLIMILLFIATLTVL-DIGWSYHQWYSKLKMSKQEIKDEIKQS 236
             +P S +  +  ++  ++ +I+     L VL D+ +    +  KLKMS+Q+IKDE+K+ 
Sbjct: 176 QISPKSAMV-SLLSMSGLVFLIMAVGTLLIVLFDVPFQLWSFNEKLKMSRQDIKDEMKEM 234

Query: 237 YGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQ 296
            GNP IK + +S+ R   R +MM A   A++++TNPTHYA+ALRY+++EN APV++AKG 
Sbjct: 235 DGNPQIKTKVRSMQREMARRRMMAAIPSASVVVTNPTHYAVALRYVESENRAPVVLAKGA 294

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKKI 354
             +A ++R++A EH +P+ E P LAR+L+  V +   IP + Y+AVA+++  ++  ++
Sbjct: 295 GNVALRIRELAQEHGVPLVEAPPLARALYHHVELEQEIPALLYRAVAEVLAYLHQLRL 352


>gi|16765256|ref|NP_460871.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|161613526|ref|YP_001587491.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167994220|ref|ZP_02575312.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168234020|ref|ZP_02659078.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168462551|ref|ZP_02696482.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|168820742|ref|ZP_02832742.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|194445536|ref|YP_002041180.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194472731|ref|ZP_03078715.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|197251527|ref|YP_002146107.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|238912509|ref|ZP_04656346.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|729522|sp|P40727|FLHB_SALTY RecName: Full=Flagellar biosynthetic protein flhB
 gi|633115|dbj|BAA06902.1| flagellar protein FlhB [Salmonella enterica subsp. enterica serovar
           Typhimurium]
 gi|16420451|gb|AAL20830.1| putative part of export apparatus for flagellar proteins
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. LT2]
 gi|161362890|gb|ABX66658.1| hypothetical protein SPAB_01246 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194404199|gb|ACF64421.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194459095|gb|EDX47934.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|195634185|gb|EDX52537.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197215230|gb|ACH52627.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|205327877|gb|EDZ14641.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205331965|gb|EDZ18729.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205342676|gb|EDZ29440.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|261247084|emb|CBG24905.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267993900|gb|ACY88785.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|312912908|dbj|BAJ36882.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|320085466|emb|CBY95247.1| Flagellar biosynthetic protein flhB [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|321224557|gb|EFX49620.1| Flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|332988807|gb|AEF07790.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 383

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 103/353 (29%), Positives = 194/353 (54%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            ++ D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G  S+   L 
Sbjct: 3   EESDDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVCIIWFGG-ESLARQLA 58

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++      R + D + I+  +  L  +A   ++P +   ++  + S ++    + + 
Sbjct: 59  GMLSAGLHFDHRMVNDPNLILGQIILLIKAAMMALLPLIAGVVLVALISPVMLGGLIFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K  LVG +    L  ++  M+  ++ +
Sbjct: 119 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAVLKSTLVGCVTGFYLWHHWPQMMRLMAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE K+S G+P
Sbjct: 179 PIVAMGNALDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + + R+  + +MME   +A +I+TNPTHY++AL+Y + +  AP +VAKG  LIA
Sbjct: 239 HVKGKIRQMQRAAAQRRMMEDVPKADVIVTNPTHYSVALQYDENKMSAPKVVAKGAGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  EH +P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 299 LRIREIGAEHRVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 351


>gi|307131618|ref|YP_003883634.1| flagellar biosynthesis protein flhB [Dickeya dadantii 3937]
 gi|306529147|gb|ADM99077.1| Flagellar biosynthesis protein flhB [Dickeya dadantii 3937]
          Length = 383

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 105/353 (29%), Positives = 184/353 (52%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D+   KTEAP+ ++ E A  EG  P SRE    +S+L  +  L   +  G   + + L 
Sbjct: 3   DDSDLEKTEAPTPQRTEKAREEGQIPRSRE---LTSVLMLIAGLAILWGSG-SGMAARLT 58

Query: 64  VLLASATQRKLEDISHIVFLLTHLS---LSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            ++A         IS    +++H+      A   ++P L   ++  + + ++    + + 
Sbjct: 59  DMMAKGLIFDHNFISDERLIISHVGSLIEQAVMALVPILFGLVLVALAAPVLLGGLIFST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +   F +++   G+KR++S + L    K+ +K ++VG I    L  N+ +ML  +S  
Sbjct: 119 KAISFDFGKMNPLSGLKRMFSTHVLAELFKAILKAVIVGCITFWFLKHNWNSMLHLVSEP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             S +  A          ++L +  +   D+GW       +L+MSKQEI+DE K+  G+P
Sbjct: 179 LGSAIKDALNIAFLCCFWVILGLFPMVAFDVGWQIWSHIKRLRMSKQEIRDEYKEHEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  + +MM    +A +I+TNPTHYA+AL+Y + +  AP ++AKG + IA
Sbjct: 239 HVKGRVRQQQRAMAQRRMMADVPKADVIVTNPTHYAVALKYDEKKMHAPKVLAKGADQIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++  EH IPI E P LAR+L++   I   IP   Y AVA+++  +Y  K
Sbjct: 299 LRIRELGSEHRIPILEAPPLARALYRHTEIGHHIPTGLYAAVAEVLSWVYQLK 351


>gi|283955760|ref|ZP_06373251.1| flagellar biosynthetic protein [Campylobacter jejuni subsp. jejuni
           1336]
 gi|283792715|gb|EFC31493.1| flagellar biosynthetic protein [Campylobacter jejuni subsp. jejuni
           1336]
          Length = 362

 Score =  177 bits (448), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 115/364 (31%), Positives = 199/364 (54%), Gaps = 44/364 (12%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREAS-------------LFSSILACLIYLLFFFSPGI 55
            KTE P+SKKIEDA  EGN P S++A+             L  S +   I  L+ +    
Sbjct: 7   EKTEEPTSKKIEDARKEGNVPKSQDAAAIVTLIIGVTITLLMMSFMGERIVNLYRYYQSF 66

Query: 56  YSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLL-FMMFGIGSYLIQR 114
             V  DL ++ A      ++ I  ++ +L  + LS   ++I G+L   M FG   ++   
Sbjct: 67  IGVEFDLRIIQAIM----IKSIFEVLIILAPIVLS---IMIAGVLGNIMQFG---FIFTT 116

Query: 115 IPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTML 174
            P++      P+  +++  +G+K ++S+  +V  +K  +K   VG + TI+    +  +L
Sbjct: 117 KPIM------PNLGKINPLKGLKNLFSLKKIVESIKIILK---VGIVFTIA----FIVLL 163

Query: 175 DFISANPHSILYH-----AFFTVRKVLIMILLFIATL--TVLDIGWSYHQWYSKLKMSKQ 227
            F+   P   LY       +   R +++  ++ +A L   VLD+     Q++  L+MSKQ
Sbjct: 164 KFMQELPRVELYTMVAQLTWLRDRAIVLAAIVIVAFLIIAVLDVFLVRFQYFKGLRMSKQ 223

Query: 228 EIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEND 287
           EIKDE KQ  G+P +K R + +     R +M++  + A ++ITNPTHYA+A+RY  ++  
Sbjct: 224 EIKDEYKQMEGDPQVKGRIRRLQMEAARRRMVQDVAGADVVITNPTHYAVAIRYDTSKEQ 283

Query: 288 APVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIY 347
           AP +VAKG + +A +++++AYE+N+ ++E P LAR L+K   +N  IP   +KAVA+++ 
Sbjct: 284 APRVVAKGVDFLALRIKQVAYENNVVVYENPPLARELYKACDVNDLIPREMFKAVAEVLG 343

Query: 348 KIYH 351
            +Y+
Sbjct: 344 FVYN 347


>gi|198245714|ref|YP_002215169.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|197940230|gb|ACH77563.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
          Length = 383

 Score =  177 bits (448), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 103/353 (29%), Positives = 195/353 (55%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            ++ D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G  S+   L 
Sbjct: 3   EESDDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVCIIWFGG-ESLARQLA 58

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++      R + D + I+  +  L  +A   ++P +   ++  + S ++    + + 
Sbjct: 59  GMLSAGLHFDHRMVNDPNLILGQIILLIKAAMMALLPLIAGVVLVALISPVMLGGLIFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K  LVG +    L  ++  M+  ++ +
Sbjct: 119 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAVLKSTLVGCVTGFYLWYHWPQMMRLMAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE K+S G+P
Sbjct: 179 PIVAMGNALDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + + R+  + +MME   +A +I+TNPTHY++AL+Y +++  AP +VAKG  LIA
Sbjct: 239 HVKGKIRQMQRAAAQRRMMEDVPKADVIVTNPTHYSVALQYDESKMSAPKVVAKGAGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  EH +P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 299 LRIREIGAEHRVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 351


>gi|326622917|gb|EGE29262.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
          Length = 383

 Score =  177 bits (448), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 103/353 (29%), Positives = 195/353 (55%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            ++ D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G  S+   L 
Sbjct: 3   EESDDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVCIIWFGG-ESLARQLA 58

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++      R + D + I+  +  L  +A   ++P +   ++  + S ++    + + 
Sbjct: 59  GMLSAGLHFDHRMVNDPNLILGQIILLIKAAMMALLPLIAGVVLVALISPVMLGGLIFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K  LVG +    L  ++  M+  ++ +
Sbjct: 119 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAVLKSTLVGCVTGFYLWYHWPQMMRLMAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE K+S G+P
Sbjct: 179 PIVAMGNALDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + + R+  + +MME   +A +I+TNPTHY++AL+Y +++  AP +VAKG  LIA
Sbjct: 239 HVKGKIRQMQRAAAQRRMMEDVPKADVIVTNPTHYSVALQYDESKMSAPKVVAKGAGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  EH +P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 299 LRIREIGAEHRVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLSWVWQLK 351


>gi|57237386|ref|YP_178399.1| flagellar biosynthesis protein FlhB [Campylobacter jejuni RM1221]
 gi|86149065|ref|ZP_01067297.1| flagellar biosynthetic protein FlhB [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|88597389|ref|ZP_01100624.1| flagellar biosynthetic protein FlhB [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|205356015|ref|ZP_03222783.1| flagellar biosynthetic protein [Campylobacter jejuni subsp. jejuni
           CG8421]
 gi|218561994|ref|YP_002343773.1| flagellar biosynthesis protein FlhB [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|57166190|gb|AAW34969.1| flagellar biosynthetic protein FlhB [Campylobacter jejuni RM1221]
 gi|85840423|gb|EAQ57680.1| flagellar biosynthetic protein FlhB [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|88190450|gb|EAQ94424.1| flagellar biosynthetic protein FlhB [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|112359700|emb|CAL34486.1| flagellar biosynthetic protein [Campylobacter jejuni subsp. jejuni
           NCTC 11168]
 gi|205346139|gb|EDZ32774.1| flagellar biosynthetic protein [Campylobacter jejuni subsp. jejuni
           CG8421]
 gi|315928679|gb|EFV07962.1| flagellar biosynthetic protein FlhB [Campylobacter jejuni subsp.
           jejuni 305]
          Length = 362

 Score =  177 bits (448), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 114/364 (31%), Positives = 198/364 (54%), Gaps = 44/364 (12%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFS-------------PGI 55
            KTE P+SKKIEDA  EGN P S++A+   +++  +   LF  S                
Sbjct: 7   EKTEEPTSKKIEDARKEGNVPKSQDAAAIVTLIIGVTITLFMMSFMGERIVNLYRYYQSF 66

Query: 56  YSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLL-FMMFGIGSYLIQR 114
             V  DL ++ A      ++ I  ++ +L  + LS   ++I G+L   M FG   ++   
Sbjct: 67  IGVEFDLRIIQAIM----IKSIFEVLIILAPIVLS---IMIAGVLGNIMQFG---FIFTT 116

Query: 115 IPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTML 174
            P++      P+  +++  +G+K ++S+  +V  +K  +K   VG + TI+    +  +L
Sbjct: 117 KPIM------PNLGKINPLKGLKNLFSLKKIVESIKIILK---VGIVFTIA----FIVLL 163

Query: 175 DFISANPHSILYH-----AFFTVRKVLIMILLFIATL--TVLDIGWSYHQWYSKLKMSKQ 227
            F+   P   LY       +   R +++  ++ +A L   VLD+     Q++  L+MSKQ
Sbjct: 164 KFMQELPRVELYTMVAQLTWLRDRAIVLAAIVIVAFLIIAVLDVFLVRFQYFKGLRMSKQ 223

Query: 228 EIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEND 287
           EIKDE KQ  G+P +K R + +     R +M++  + A ++ITNPTHYA+A+RY   +  
Sbjct: 224 EIKDEYKQMEGDPQVKGRIRRLQMEAARRRMVQDVAGADVVITNPTHYAVAIRYDTGKEQ 283

Query: 288 APVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIY 347
           AP +VAKG + +A +++++AYE+N+ ++E P LAR L+K   +N  IP   +KAVA+++ 
Sbjct: 284 APRVVAKGVDFLALRIKQVAYENNVVVYENPPLARELYKACDVNDLIPREMFKAVAEVLG 343

Query: 348 KIYH 351
            +Y+
Sbjct: 344 FVYN 347


>gi|329888173|ref|ZP_08266771.1| flagellar biosynthetic protein FlhB [Brevundimonas diminuta ATCC
           11568]
 gi|328846729|gb|EGF96291.1| flagellar biosynthetic protein FlhB [Brevundimonas diminuta ATCC
           11568]
          Length = 358

 Score =  177 bits (448), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 105/358 (29%), Positives = 196/358 (54%), Gaps = 8/358 (2%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYS--V 58
           M++   P++KTE  + +K+E+A  +G+  +++   + +++       +     G +S  +
Sbjct: 1   MADGPDPESKTEDATPRKLEEARKKGD--VAKSPDVAAALSLAGAAGVLLAGGGWFSTRI 58

Query: 59  TSDLHVLLAS--ATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIP 116
              L   LA   A    LE     V +  H   +A+  +   +   ++ G+G  L Q   
Sbjct: 59  AEALTPFLAQPHAMIGGLE-AGGGVEIGMHAVWAAAPFLAALMFAVILGGVGGNLAQSGL 117

Query: 117 VLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDF 176
           +   + VKP + +V+  EG KRI+  + LV F+K+F+K++ +G +    L  +   + + 
Sbjct: 118 IFTADKVKPKWSKVNPLEGFKRIFGPDGLVQFLKTFIKLVAIGAVCWWVLKPHARELENL 177

Query: 177 ISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQS 236
            + +P  IL  A      +++  L+F++     D  W   ++  +++M+K+E+K++ KQS
Sbjct: 178 AAMSPAMILPFARDLALALMLSALVFLSLTAGADYLWQRMRFAKRMRMTKEELKEDFKQS 237

Query: 237 YGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEND-APVLVAKG 295
            G+P +K + + I   R R +MM+A   AT+IITNPTHY++ALRY   + D APV VAKG
Sbjct: 238 DGDPHVKAKLRQIRMQRGRQRMMQAVPDATVIITNPTHYSVALRYEPDKGDGAPVCVAKG 297

Query: 296 QNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            + +A ++R++A EH +PI E   LAR+L+  V ++  IP   ++A A++I  +  ++
Sbjct: 298 VDALALRIREVAREHKVPIVENVPLARALYAAVEVDGVIPREHFEAAAKVIGFVMQQR 355


>gi|283955188|ref|ZP_06372690.1| flagellar biosynthetic protein [Campylobacter jejuni subsp. jejuni
           414]
 gi|283793401|gb|EFC32168.1| flagellar biosynthetic protein [Campylobacter jejuni subsp. jejuni
           414]
          Length = 362

 Score =  177 bits (448), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 119/373 (31%), Positives = 202/373 (54%), Gaps = 48/373 (12%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREAS-------------LFSSILACLIYL 47
           M+  D    KTE P+SKKIEDA  EGN P S++A+             L    +   I  
Sbjct: 1   MASED--QEKTEEPTSKKIEDARKEGNVPKSQDAAAIVILIIGVTVTLLMMGFMGERIVN 58

Query: 48  LFFFSPGIYSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLL-FMMFG 106
           L+ +      V  DL ++ A      ++ I  ++ +L  + LS   +++ G+L   M FG
Sbjct: 59  LYRYYQSFIGVEFDLRIIQAIM----IKSIFEVLIILAPIVLS---IMVAGVLGNIMQFG 111

Query: 107 IGSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIIL-VGTIITIS 165
              ++    P++      P+  +++  +G+K ++S+  LV      VKIIL VG + TI+
Sbjct: 112 ---FIFTTKPIM------PNLGKINPLKGLKNLFSLKKLV----ESVKIILKVGIVFTIA 158

Query: 166 LTENYFTMLDFISANPHSILYH-----AFFTVRKVLIMILLFIATL--TVLDIGWSYHQW 218
               +  +L F+   P   LY       +   R +++  ++ +A L   VLD+     Q+
Sbjct: 159 ----FIVLLKFMQELPRVELYTMVAQLTWLRDRAIVLAAIVMVAFLIIAVLDVFLVRFQY 214

Query: 219 YSKLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALA 278
           +  L+MSKQEIKDE KQ  G+P +K R + +     R +M++  + A ++ITNPTHYA+A
Sbjct: 215 FKGLRMSKQEIKDEYKQMEGDPQVKGRIRRLQMEAARRRMVQDVAGADVVITNPTHYAVA 274

Query: 279 LRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVF 338
           +RY  ++  AP +VAKG + +A +++++AYE+N+ ++E P LAR L+K   +N  IP   
Sbjct: 275 IRYDTSKEQAPRVVAKGVDFLALRIKQVAYENNVVVYENPPLARELYKACDVNDLIPREM 334

Query: 339 YKAVAQLIYKIYH 351
           +KAVA+++  +Y+
Sbjct: 335 FKAVAEVLGFVYN 347


>gi|91976176|ref|YP_568835.1| flagellar biosynthesis protein FlhB [Rhodopseudomonas palustris
           BisB5]
 gi|91682632|gb|ABE38934.1| flagellar biosynthetic protein FlhB [Rhodopseudomonas palustris
           BisB5]
          Length = 357

 Score =  176 bits (447), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 113/344 (32%), Positives = 187/344 (54%), Gaps = 4/344 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYS-VTSDL 62
           +D  + K + P+ K+++DAL  G+   S+E + +  ++A    LL  FS  I + VT  +
Sbjct: 3   DDNDEEKQQEPTQKRLDDALKRGDVAKSQEVNTWF-VIAGATLLLSSFSGSIGTGVTGPM 61

Query: 63  HVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNH 122
             L+  +   K++    +    + L +  S L +P L L M+  IGS LIQ   V +   
Sbjct: 62  RALIEKSWMLKVDGAGLLALTKSLLLMLVSVLGVP-LFLLMLVAIGSNLIQHRLVFSTEG 120

Query: 123 VKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPH 182
           + P   ++S  EG KR++    L NF+K   K+I +G ++   L      +   +  +  
Sbjct: 121 LTPKLSKLSPLEGAKRLFGKQALANFLKGLFKVIALGVVMVAVLYPERDRLDALLQMDVV 180

Query: 183 SILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPII 242
           S+L        K++  +   +A +   D  + Y  W+ + KMS QE+KDE KQS G+P I
Sbjct: 181 SLLGVTVGLTLKLMGSVAAVLAFVAAGDYFFQYRTWHERQKMSLQEVKDEYKQSEGDPHI 240

Query: 243 KNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKK 302
           K R + I   R++ +MM A   A+++ITNPTH+++AL+Y +    AP+ VAKG + IA K
Sbjct: 241 KGRIRQIRYQRMKKRMMAAVPSASVVITNPTHFSVALKY-ERGMQAPICVAKGADAIAFK 299

Query: 303 MRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           +R++A  +N+PI E   LAR+L+  V ++  IP   Y AVA++I
Sbjct: 300 IREVAKANNVPIVENVPLARALYATVEVDGEIPIEHYHAVAEVI 343


>gi|90423033|ref|YP_531403.1| flagellar biosynthesis protein FlhB [Rhodopseudomonas palustris
           BisB18]
 gi|90105047|gb|ABD87084.1| flagellar biosynthetic protein FlhB [Rhodopseudomonas palustris
           BisB18]
          Length = 358

 Score =  176 bits (447), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 109/346 (31%), Positives = 189/346 (54%), Gaps = 3/346 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS++D+ + KT+ P+ K+++DAL  G+   S+E + +  I    + L  F       + +
Sbjct: 1   MSDDDSSE-KTQDPTQKRLDDALERGDVAKSQEVNTWFMIAGATLVLSSFSGSVGSGLQN 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  L+ ++   + +    +    + L  + + + +P L+L +    G+ L  R+ V + 
Sbjct: 60  PLRNLIENSWMIRTDGAGLMALTQSLLYAAIAAMGVPFLMLIIAALAGNMLQHRL-VFSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +KP F ++S   G KR++      NF+K   K+I +G ++   L    + +   I  +
Sbjct: 119 EGLKPKFSKISPLAGAKRLFGKQAAANFLKGLFKVIALGAVMVAILWPERYRLDAMIRLD 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             +I+        K++  ++  +A + + D  + Y  WY K KMS QE+K+E KQS G+P
Sbjct: 179 IGAIMGLTIALTLKLMAAVVAMLAAVAIADFFFQYRTWYEKQKMSLQEVKEEHKQSEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R + I   R+R +MM A  +A+++ITNPTHY++AL Y +    AP+ VAKG + IA
Sbjct: 239 HIKGRIRQIRHQRMRKRMMAAVPQASVVITNPTHYSVALSY-ENGMSAPICVAKGVDSIA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
            K+R++A  H++PI E   LAR+L+  V I+  IP   Y AVA++I
Sbjct: 298 FKIREVAKAHDVPIIENVPLARALYATVKIDEEIPVEHYHAVAEII 343


>gi|283785619|ref|YP_003365484.1| flagellar biosynthesis protein FlhB [Citrobacter rodentium ICC168]
 gi|282949073|emb|CBG88678.1| flagellar biosynthesis protein FlhB [Citrobacter rodentium ICC168]
          Length = 382

 Score =  176 bits (447), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 113/367 (30%), Positives = 194/367 (52%), Gaps = 31/367 (8%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREAS--LFSSILACLIY---------LLF 49
           MSE +  D+KTEAP+  ++E A  EG  P SRE +  L   +  C+I+         L  
Sbjct: 1   MSEEN--DDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVCIIWIGGESLARRLSA 58

Query: 50  FFSPGI---YSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFG 106
             S G+   +S+ +D  ++L        E +  ++ L+T + L A  L+ P LL  ++F 
Sbjct: 59  MLSAGLRFDHSMVNDPSLILGQIILLIKEAMIALLPLITGVVLVA--LISPVLLGGLIFS 116

Query: 107 IGSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISL 166
             S             ++P F +++   GIKR++S  +    +K+ +K  LVG +  + L
Sbjct: 117 GKS-------------LQPKFSKLNPLPGIKRMFSAQSGAELLKAVLKSTLVGGVTALYL 163

Query: 167 TENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSK 226
              +  M+  ++ +P + +  A   V    ++++L +  +   D+ +       KL+MS+
Sbjct: 164 WHKWPQMMRLMAESPITAMGDALDLVGLCALLVVLGVIPMVGFDVIFQIFSHLKKLRMSR 223

Query: 227 QEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEN 286
           Q+I+DE KQS G+P +K R + + R+  R +MM     A +I+TNPTHY++AL+Y + + 
Sbjct: 224 QDIRDEFKQSEGDPHVKGRIRQMQRAAARQRMMSDVPNADVIVTNPTHYSVALQYDENKM 283

Query: 287 DAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
            AP +VAKG  L+A ++R+I  E+ IP  E P LAR+L++   I   IP   Y AVA+++
Sbjct: 284 SAPKVVAKGAGLVALRIREIGAENKIPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVL 343

Query: 347 YKIYHKK 353
             +   K
Sbjct: 344 AWVLQLK 350


>gi|153952141|ref|YP_001398614.1| flagellar biosynthesis protein FlhB [Campylobacter jejuni subsp.
           doylei 269.97]
 gi|152939587|gb|ABS44328.1| flagellar biosynthetic protein FlhB [Campylobacter jejuni subsp.
           doylei 269.97]
          Length = 362

 Score =  176 bits (447), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 115/364 (31%), Positives = 199/364 (54%), Gaps = 44/364 (12%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFS-------------PGI 55
            KTE P+SKKIEDA  EGN P S++A+   +++  +   LF  S                
Sbjct: 7   EKTEEPTSKKIEDARKEGNVPKSQDAAAIVTLIIGVTITLFMMSFMGERIVNLYRYYQSF 66

Query: 56  YSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLL-FMMFGIGSYLIQR 114
             V  DL ++ A   +   E    ++ +L  + LS   ++I G+L   M FG   ++   
Sbjct: 67  IGVEFDLRIIQAIIIKSIFE----VLIILAPIVLS---IMIAGVLGNIMQFG---FIFTT 116

Query: 115 IPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTML 174
            P++      P+  +++  +G+K ++S+  +V  +K  +K   VG + TI+    +  +L
Sbjct: 117 KPIM------PNLGKINPLKGLKNLFSLKKIVESIKIILK---VGIVFTIA----FIVLL 163

Query: 175 DFISANPHSILYH-----AFFTVRKVLIMILLFIATL--TVLDIGWSYHQWYSKLKMSKQ 227
            F+   P   LY      A+   R +++  ++ +A L   VLD+     Q++  L+MSKQ
Sbjct: 164 KFMQELPRVELYTMVAQLAWLRDRSIVLAAIVIVAFLIIAVLDVFLVRFQYFKGLRMSKQ 223

Query: 228 EIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEND 287
           EIKDE KQ  G+P +K R + +     R +M++  + A ++ITNPTHYA+A+RY  ++  
Sbjct: 224 EIKDEYKQMEGDPQVKGRIRRLQMEAARRRMVQDVADADVVITNPTHYAVAIRYDTSKEQ 283

Query: 288 APVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIY 347
           AP +VAKG + +A +++++AYE+N+ ++E P LAR L+K   +N  IP   +KAVA+++ 
Sbjct: 284 APRVVAKGVDFLALRIKQVAYENNVVVYENPPLARELYKACDVNDLIPREMFKAVAEVLG 343

Query: 348 KIYH 351
            +Y+
Sbjct: 344 FVYN 347


>gi|62180491|ref|YP_216908.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|224583582|ref|YP_002637380.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|62128124|gb|AAX65827.1| putative part of export apparatus for flagellar proteins
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|224468109|gb|ACN45939.1| flagellar biosynthesis protein [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|322714967|gb|EFZ06538.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
          Length = 383

 Score =  176 bits (447), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 102/353 (28%), Positives = 194/353 (54%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            ++ D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G  S+   L 
Sbjct: 3   EESDDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVCIIWFGG-ESLARQLA 58

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++      R + D + I+  +  L  +A   ++P +   ++  + S ++    + + 
Sbjct: 59  GMLSAGLHFDHRMVNDPNLILGQIILLIKAAMMALLPLIAGVVLVALISPVMLGGLIFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K  LVG +    L  ++  M+  ++ +
Sbjct: 119 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAVLKSTLVGCVTGFYLWHHWPQMMRLMAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE K+S G+P
Sbjct: 179 PIVAMGNALDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + + R+  + +MME   +A +I+TNPTHY++AL+Y + +  AP +VAKG  LIA
Sbjct: 239 HVKGKIRQMQRAAAQRRMMEDVPKADVIVTNPTHYSVALQYDENKMSAPKVVAKGAGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++  EH +P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 299 LRIRELGAEHRVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 351


>gi|296135634|ref|YP_003642876.1| flagellar biosynthetic protein FlhB [Thiomonas intermedia K12]
 gi|295795756|gb|ADG30546.1| flagellar biosynthetic protein FlhB [Thiomonas intermedia K12]
          Length = 373

 Score =  176 bits (446), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 114/369 (30%), Positives = 194/369 (52%), Gaps = 38/369 (10%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSIL----ACLIYLL--FFFSPG 54
           M+E+ A + +  A S K+ + A  +G   ++R   L SS+L    A ++Y    +F+  G
Sbjct: 1   MAEDSAQEKELPA-SQKRKQQAREKGQ--VARSRDLTSSLLLLGMAAVVYTAGGWFYDMG 57

Query: 55  IYSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGL--------LLFMMFG 106
              + + L V  ASA+Q    D + ++        +A R+++ GL        L F+   
Sbjct: 58  RELLQTGLTVS-ASASQ----DPAAML-------QAAGRVLVLGLIVLAPVLALTFLASA 105

Query: 107 IGSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISL 166
            G   +    V +   + P F R+   +GI R++SI  L    K+ +K I++  I  I +
Sbjct: 106 AGGVAMGGW-VFSTEALAPDFSRLDPVKGIGRMFSITGLGELGKALLKAIVIAVIAGIVI 164

Query: 167 TENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVL----DIGWSYHQWYSKL 222
                 +L  +   P      A   + ++     L++A+ T+L    D+ W   Q   KL
Sbjct: 165 WNERGALLGLLQVEPQ----LAQMQLGQITARAFLWMASGTLLVAAVDVPWQLFQMNKKL 220

Query: 223 KMSKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYI 282
           KMS+Q+++DE+++S GNP IK + + + R R R +MM A  +A +++TNPTHYA+AL Y 
Sbjct: 221 KMSRQDLQDEMRESEGNPQIKQKMRELQRERARKRMMAAVPKADVVVTNPTHYAVALAYK 280

Query: 283 QTENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAV 342
           + +N APV++A G + +A ++R++A EHN+P+ E P LAR+LF    +   IP   Y AV
Sbjct: 281 EGKNRAPVVLALGADRVAARIREVAAEHNVPVIEAPPLARALFHHAELEQEIPVALYNAV 340

Query: 343 AQLIYKIYH 351
           A L+  ++ 
Sbjct: 341 ALLLAYVFQ 349


>gi|283832722|ref|ZP_06352463.1| flagellar biosynthetic protein FlhB [Citrobacter youngae ATCC
           29220]
 gi|291072402|gb|EFE10511.1| flagellar biosynthetic protein FlhB [Citrobacter youngae ATCC
           29220]
          Length = 383

 Score =  176 bits (446), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 107/366 (29%), Positives = 198/366 (54%), Gaps = 31/366 (8%)

Query: 2   SENDAPDNKTEAPSSKKIEDALNEGNAPISREAS--LFSSILACLIY---------LLFF 50
            E+D  D+KTEAP+  ++E A  EG  P S+E +  L   +  C+I+         L   
Sbjct: 3   EESD--DDKTEAPTPHRLEKAREEGQIPRSKELTSLLILLVGVCIIWIGGESLARRLAGM 60

Query: 51  FSPGI---YSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGI 107
            S G+   +S+ +D +++L+       + +  ++ L+T + L A  L+ P +L  ++F  
Sbjct: 61  LSAGLRFDHSMVNDPNLILSQIILLIKDAMIALLPLITGVVLVA--LISPVMLGGLIFSG 118

Query: 108 GSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLT 167
            S             ++P F +++   GIKR++S       +K+ +K  LVG++    L 
Sbjct: 119 KS-------------LQPKFSKLNPLPGIKRMFSAQTGAELLKAILKSTLVGSVAGFYLW 165

Query: 168 ENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQ 227
            N+  M+  ++ +P + + +A   V    ++++L +  +   D+ +  +    KL+MS+Q
Sbjct: 166 HNWPEMMRLVAESPITAMGNALDLVGMCALLVVLGVIPMVGFDVFFQIYSHLKKLRMSRQ 225

Query: 228 EIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEND 287
           +I+DE KQS G+P +K + + + R+  + +MM    +A +I+TNPTHY++AL+Y + +  
Sbjct: 226 DIRDEFKQSEGDPHVKGKIRQMQRAAAQRRMMADVPKADVIVTNPTHYSVALQYDENKMS 285

Query: 288 APVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIY 347
           AP +VAKG   +A ++R+I  EH +P  E P LAR+L++   I   IP   Y AVA+++ 
Sbjct: 286 APKVVAKGAGPVALRIREIGAEHRVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLA 345

Query: 348 KIYHKK 353
            ++  K
Sbjct: 346 WVWQLK 351


>gi|167552446|ref|ZP_02346199.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|168241547|ref|ZP_02666479.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|168259807|ref|ZP_02681780.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|194451224|ref|YP_002045968.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|200389783|ref|ZP_03216394.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|207856565|ref|YP_002243216.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|194409528|gb|ACF69747.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|199602228|gb|EDZ00774.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|205322918|gb|EDZ10757.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205339229|gb|EDZ25993.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205350661|gb|EDZ37292.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|206708368|emb|CAR32672.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
          Length = 383

 Score =  176 bits (446), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 103/353 (29%), Positives = 194/353 (54%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            ++ D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G  S+   L 
Sbjct: 3   EESDDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVCIIWFGG-ESLARQLA 58

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++      R + D + I+  +  L  +A   ++P +   ++  + S ++    + + 
Sbjct: 59  GMLSAGLHFDHRMVNDPNLILGQIILLIKAAMMALLPLIAGVVLVALISPVMLGGLIFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K  LVG +    L  ++  M+  ++ +
Sbjct: 119 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAVLKSTLVGCVTGFYLWYHWPQMMRLMAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE K+S G+P
Sbjct: 179 PIVAMGNALDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + + R+  + +MME   +A +I+TNPTHY++AL+Y + +  AP +VAKG  LIA
Sbjct: 239 HVKGKIRQMQRAAAQRRMMEDVPKADVIVTNPTHYSVALQYDENKMSAPKVVAKGAGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  EH +P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 299 LRIREIGAEHRVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 351


>gi|317133470|ref|YP_004092784.1| flagellar biosynthetic protein FlhB [Ethanoligenens harbinense
           YUAN-3]
 gi|315471449|gb|ADU28053.1| flagellar biosynthetic protein FlhB [Ethanoligenens harbinense
           YUAN-3]
          Length = 356

 Score =  176 bits (446), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 111/357 (31%), Positives = 197/357 (55%), Gaps = 16/357 (4%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M E  A D KTE  + K+ ED   +G+   S + +   ++L     L       I S++ 
Sbjct: 1   MPEASAGD-KTEKATPKRREDERKKGHVVQSPDVTSAVAMLGTFAVLRVMGPSMIKSLSD 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLV---IPGLLLFMMFGIGSYLIQRIPV 117
            +  +LA+ T      +S    +   ++ + S L+   +P +L+     + + L Q   +
Sbjct: 60  GMRGMLANLTS----AVSGYEDMRARMTAALSVLIGVAVPVMLVAFAATVATTLAQTRLL 115

Query: 118 LNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFI 177
           ++L+ +KP   R++  EGIKR++S+ +LV   KS +K++LVG ++   +     T+L   
Sbjct: 116 VSLDQLKPDLSRLNPLEGIKRLFSVRSLVELGKSILKVVLVGAVVYFEIQPQMHTILLLY 175

Query: 178 SANPHSILYHAFFTVRKVLIMILLFIAT----LTVLDIGWSYHQWYSKLKMSKQEIKDEI 233
           + +    L  +F  V  +L  I + +A     L  +D  + + Q+   ++M+K+EIK+E 
Sbjct: 176 NMS----LAQSFSWVAGILADIGIKVAGVMLLLGAIDYFYQWFQYEKDIRMTKEEIKEEY 231

Query: 234 KQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVA 293
           KQ  GNP IK + K++ R   R +MM+   +A +++ NPTH+A+AL+Y   +  APV VA
Sbjct: 232 KQMEGNPEIKGKIKNLQRQMARRRMMQDVPKADVVLRNPTHFAVALKYEHGKQRAPVCVA 291

Query: 294 KGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           KG+N +A ++ +IA E+++ I E+P L R+L++ V +   IP  FYKAVA+++  IY
Sbjct: 292 KGRNAVALRIVEIAEENHVYIREDPPLTRALYQAVEVGGQIPAEFYKAVAEVLAYIY 348


>gi|86151337|ref|ZP_01069552.1| flagellar biosynthetic protein FlhB [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|315123900|ref|YP_004065904.1| flagellar biosynthetic protein FlhB [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
 gi|85841684|gb|EAQ58931.1| flagellar biosynthetic protein FlhB [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|315017622|gb|ADT65715.1| flagellar biosynthetic protein FlhB [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
          Length = 362

 Score =  176 bits (446), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 114/364 (31%), Positives = 198/364 (54%), Gaps = 44/364 (12%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFS-------------PGI 55
            KTE P+SKKIEDA  EGN P S++A+    ++  +   LF  S                
Sbjct: 7   EKTEEPTSKKIEDARKEGNVPKSQDAAAIVILIIGVTITLFMMSFMGERIVNLYRYYQSF 66

Query: 56  YSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLL-FMMFGIGSYLIQR 114
             V  DL ++ A      ++ I  ++ +L  + LS   ++I G+L   M FG   ++   
Sbjct: 67  IGVEFDLRIIQAIM----IKSIFEVLIILAPIVLS---IMIAGVLGNIMQFG---FIFTT 116

Query: 115 IPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTML 174
            P++      P+  +++  +G+K ++S+  +V  +K  +K   VG + TI+    +  +L
Sbjct: 117 KPIM------PNLGKINPLKGLKNLFSLKKIVESIKIILK---VGIVFTIA----FIVLL 163

Query: 175 DFISANPHSILYH-----AFFTVRKVLIMILLFIATL--TVLDIGWSYHQWYSKLKMSKQ 227
            F+   P   LY       +   R +++  ++ +A L   VLD+     Q++  L+MSKQ
Sbjct: 164 KFMQELPRVELYTMVAQLTWLRDRAIVLAAIVIVAFLIIAVLDVFLVRFQYFKGLRMSKQ 223

Query: 228 EIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEND 287
           EIKDE KQ  G+P +K R + +     R +M++  + A ++ITNPTHYA+A+RY  ++  
Sbjct: 224 EIKDEYKQMEGDPQVKGRIRRLQMEAARRRMVQDVAGADVVITNPTHYAVAIRYDTSKEQ 283

Query: 288 APVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIY 347
           AP +VAKG + +A +++++AYE+N+ ++E P LAR L+K   +N  IP   +KAVA+++ 
Sbjct: 284 APRVVAKGVDFLALRIKQVAYENNVVVYENPPLARELYKACDVNDLIPREMFKAVAEVLG 343

Query: 348 KIYH 351
            +Y+
Sbjct: 344 FVYN 347


>gi|302343745|ref|YP_003808274.1| flagellar biosynthetic protein FlhB [Desulfarculus baarsii DSM
           2075]
 gi|301640358|gb|ADK85680.1| flagellar biosynthetic protein FlhB [Desulfarculus baarsii DSM
           2075]
          Length = 364

 Score =  176 bits (445), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 115/359 (32%), Positives = 199/359 (55%), Gaps = 13/359 (3%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIY--SV 58
           M++N A + KTE P+ ++   A  +G    S+E      + A L+  L+ F   +Y  S 
Sbjct: 1   MADNTAQE-KTEKPTPRRRSKAREKGQVAKSQELGSIGVLFAGLM-CLYAFGGFVYDQSA 58

Query: 59  TSDLHVL-LASATQRKLEDISHI-VFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIP 116
           T   H+L  A+ T   L  + ++ + L+ H      R + P +L  ++ G+   + Q   
Sbjct: 59  TMMTHILSRAAETPVSLAQVHNLSIDLMGHFL----RTLAPFMLAVVLAGVAVNVAQTGF 114

Query: 117 VLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENY--FTML 174
           +L  + ++P  K+++  EG+K+  S+  LV  +K+  KI +VG +  + L +    F  +
Sbjct: 115 MLATSRLRPDLKKINPLEGLKKFVSMRMLVEAIKNTGKICVVGLVAYLVLADELPNFPNI 174

Query: 175 DFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIK 234
             +      ++Y A   +R + +  L  +  L +LD  +  +Q+   LKMSKQEIKDE K
Sbjct: 175 GKLGGLTAMLIYIADVCLR-IFLWSLAAMFILAILDYAYQKYQFEKGLKMSKQEIKDEFK 233

Query: 235 QSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAK 294
           Q+ G+P +K+R + + R R   +MM A  +A ++ITNPTH A+A+ Y   + DAP +VAK
Sbjct: 234 QTEGDPHVKSRIRQLQRERAMKRMMAAVPQADVVITNPTHLAVAIFYQAGQMDAPEVVAK 293

Query: 295 GQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           GQN IA++++ +A E+N+PI E+  LA++L+K V +   IP   + AVA ++  +Y +K
Sbjct: 294 GQNKIAERIKALAQENNVPIIEDKPLAQALYKSVEVGQRIPFELFGAVAAILAHVYREK 352


>gi|301158434|emb|CBW17943.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|323130198|gb|ADX17628.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
          Length = 383

 Score =  176 bits (445), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 103/353 (29%), Positives = 194/353 (54%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            ++ D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G  S+   L 
Sbjct: 3   EESDDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVCIIWFGG-ESLARQLA 58

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++      R + D + I+  +  L  +A   ++P +   ++  + S ++    + + 
Sbjct: 59  GMLSAGLHFDHRMVIDPNLILGQIILLIKAAMMALLPLIAGVVLVALISPVMLGGLIFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K  LVG +    L  ++  M+  ++ +
Sbjct: 119 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAVLKSTLVGCVTGFYLWHHWPQMMRLMAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE K+S G+P
Sbjct: 179 PIVAMGNALDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + + R+  + +MME   +A +I+TNPTHY++AL+Y + +  AP +VAKG  LIA
Sbjct: 239 HVKGKIRQMQRAAAQRRMMEDVPKADVIVTNPTHYSVALQYDENKMSAPKVVAKGAGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  EH +P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 299 LRIREIGAEHRVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 351


>gi|90415339|ref|ZP_01223273.1| flagellar biosynthetic protein FlhB [marine gamma proteobacterium
           HTCC2207]
 gi|90332662|gb|EAS47832.1| flagellar biosynthetic protein FlhB [marine gamma proteobacterium
           HTCC2207]
          Length = 382

 Score =  176 bits (445), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 104/356 (29%), Positives = 192/356 (53%), Gaps = 11/356 (3%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS+ D+ + + E P++K++E    +G    S+E  + + ++    +L  F   G Y + +
Sbjct: 1   MSDKDSSEEREEEPTAKRLEKGREDGQVARSQELGVAAMMIGVAFFLYLF---GSY-IIA 56

Query: 61  DLHVLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPV 117
           DL  + AS     ++ + D S +V      ++++  +V+P  +L ++  I S  I    +
Sbjct: 57  DLTKVFASGFTFDRKAVFDTSLLVPAFGIQAVNSFIVVVPIFVLAVIIAIASAGIMGGYI 116

Query: 118 LNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENY--FTMLD 175
            +L  + P   +++   G+KR++ +  +V+  K+  K  L+  ++ + ++ N+   T L 
Sbjct: 117 FSLKSLAPKASKINPMAGLKRMFGMKAVVDLSKALSKFALIALVLYLVVSANFPMLTKLG 176

Query: 176 FISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQ 235
           F+   P             VL+ + L +A    +DI +  H +  ++KM+KQE+K+E+K 
Sbjct: 177 FMDLEPAMAEAGRIIAFGTVLVTLTLIVAA--AIDIPYQLHTFNKQMKMTKQEVKEEMKD 234

Query: 236 SYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKG 295
           + G P +K + +   R      MM A + A ++I NP H+A+AL Y  ++N AP++VAKG
Sbjct: 235 TEGRPEVKAQIRRKQREIATGMMMSAIADADVVIVNPEHFAVALSYDPSKNGAPIMVAKG 294

Query: 296 QNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            +L+AK +R+ A E  IP+F  P LARS+F    IN ++P   Y AVAQ+I  I++
Sbjct: 295 ADLLAKAIRERAKEEGIPLFSSPVLARSIFYTTEINQSVPESLYYAVAQVIAYIFN 350


>gi|271500057|ref|YP_003333082.1| flagellar biosynthetic protein FlhB [Dickeya dadantii Ech586]
 gi|270343612|gb|ACZ76377.1| flagellar biosynthetic protein FlhB [Dickeya dadantii Ech586]
          Length = 383

 Score =  176 bits (445), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 108/359 (30%), Positives = 187/359 (52%), Gaps = 19/359 (5%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D+   KTEAP+ ++ E A  EG  P S+E +    ++A L  L  + S    S+   L 
Sbjct: 3   DDSDLEKTEAPTPQRTEKAREEGQIPRSKELTSVFMLIAGLAILWGYGS----SMAGRLS 58

Query: 64  VLLASA---------TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQR 114
            ++A            +R +  ISH+  LL    L+    ++P L   ++  +G+ ++  
Sbjct: 59  DMMAKGLIFDHGFINDERLI--ISHVGTLLEQAVLA----LVPILFGLVLVALGAPILLG 112

Query: 115 IPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTML 174
             + +   +   F +++   G+KR++S   L    K+ +K ++VG I    L  N+ +ML
Sbjct: 113 GLIFSTKAISFDFGKMNPLSGLKRMFSTQVLAELFKAILKAVIVGLITFWFLRHNWNSML 172

Query: 175 DFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIK 234
             +S      +  A          ++L +  +   D+ W       +L+MSKQEI+DE K
Sbjct: 173 HLVSEPMGMAIKDALNIAFLCCFWVILGLFPMVGFDVAWQIWSHIKRLRMSKQEIRDEYK 232

Query: 235 QSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAK 294
           +  G+P IKNR +   R+  + +MM    +A +I+TNPTHYA+AL+Y + +  AP ++AK
Sbjct: 233 EHEGDPHIKNRIRQQQRAMAQRRMMSDVPKADVIVTNPTHYAVALKYDEKKMSAPRVLAK 292

Query: 295 GQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           G + IA+++R++  E+ IPI E P LAR+L++   I   IP   Y AVA+++  +Y  K
Sbjct: 293 GADRIAQRIRELGTENRIPILEAPPLARALYRHTEIGQQIPTGLYAAVAEVLSWVYQLK 351


>gi|125973005|ref|YP_001036915.1| flagellar biosynthetic protein FlhB [Clostridium thermocellum ATCC
           27405]
 gi|256004802|ref|ZP_05429777.1| flagellar biosynthetic protein FlhB [Clostridium thermocellum DSM
           2360]
 gi|281417216|ref|ZP_06248236.1| flagellar biosynthetic protein FlhB [Clostridium thermocellum JW20]
 gi|125713230|gb|ABN51722.1| flagellar biosynthetic protein FlhB [Clostridium thermocellum ATCC
           27405]
 gi|255991252|gb|EEU01359.1| flagellar biosynthetic protein FlhB [Clostridium thermocellum DSM
           2360]
 gi|281408618|gb|EFB38876.1| flagellar biosynthetic protein FlhB [Clostridium thermocellum JW20]
 gi|316940759|gb|ADU74793.1| flagellar biosynthetic protein FlhB [Clostridium thermocellum DSM
           1313]
          Length = 392

 Score =  175 bits (444), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 120/356 (33%), Positives = 187/356 (52%), Gaps = 17/356 (4%)

Query: 8   DN--KTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           DN  KTE  + +K   A  EG    SRE +    +L+  + L  F   G Y     L  L
Sbjct: 39  DNGEKTEKATPRKRSKAREEGQVLQSRELNSAIVLLSAFVTLRIF---GQYMYEEILKCL 95

Query: 66  LASATQRKLED----ISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLN 121
             + T   L D    I  +  L     ++  ++  P L++ ++ GIGS   Q   +    
Sbjct: 96  KVAITVYPLNDGLFTIDGLFELYGETVITFLKIATPVLMVVLIAGIGSAYAQVGFLFTTK 155

Query: 122 HVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTI----ITISLTENYFTMLDFI 177
            +     R++  +G KRI+S+ +LV  +KS +KI LVG I    I   +T N   M+D  
Sbjct: 156 TLGIKLSRINPLKGFKRIFSLKSLVELLKSIIKIALVGYIGYGYIKGEMT-NVLGMMDVD 214

Query: 178 SANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSY 237
             +  S L     T+    I + +    + V D G+ + ++   L+MSKQEIK+E K+  
Sbjct: 215 VVSSASFLGS---TILNAAIRMCIAFVVIGVADYGYQWWEYEKSLRMSKQEIKEENKEVE 271

Query: 238 GNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQN 297
           GNP IK+R +   R     +M++   +A ++ITNPTHYA+A++Y   E DAPV+VAKGQ+
Sbjct: 272 GNPEIKSRIRQKQRQMSMRRMLQDIPKADVVITNPTHYAVAIKYDPKEADAPVVVAKGQD 331

Query: 298 LIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            +A ++++IA EH + I E   LA++L+K V I   IPP  Y+AVA+++  +Y  K
Sbjct: 332 YMALRIKEIAKEHKVEIVENKPLAQTLYKTVEIGGKIPPELYQAVAEVLAFVYSLK 387


>gi|291288733|ref|YP_003505549.1| flagellar biosynthetic protein FlhB [Denitrovibrio acetiphilus DSM
           12809]
 gi|290885893|gb|ADD69593.1| flagellar biosynthetic protein FlhB [Denitrovibrio acetiphilus DSM
           12809]
          Length = 352

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 104/339 (30%), Positives = 189/339 (55%), Gaps = 4/339 (1%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE P+ KK+ DA NEGN   SRE     ++L  + +  +++ P +    + L   +  
Sbjct: 6   EKTEDPTGKKLTDAKNEGNVAKSRELPAAVTLL-LVTFFFYYYGPYLMHGLARLIREIFM 64

Query: 69  ATQRKLEDIS-HIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
            T  ++   S H + L +   + +++L+ P + L ++ G+ S ++Q   +     +    
Sbjct: 65  MTNYEINTQSAHKIMLFS--IIESAKLLAPFMALVLVVGVASNVLQTGFMFTPKALSAKL 122

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
           +R+   +G  R +S  +LV  MKS  K+ +V  +  + + ++  T++     + + I   
Sbjct: 123 ERIDPIKGFGRFFSKKSLVELMKSLFKVFVVTYVAYLIVKKHIVTIISMADMDFYDIFSV 182

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
               V +++  + L    + + D  +  +Q+   LKMSK E+K+E KQ+ G+P +K R +
Sbjct: 183 FGKIVYEIMWKVSLLALFMALADFIFQKYQFKQDLKMSKHEVKEERKQAEGDPHVKGRIR 242

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
           SI R   R +MM+   ++ +++TNPTH+A+AL+Y   E+ APV++AKGQ L+A ++++IA
Sbjct: 243 SIQREMARKRMMDDVPKSDVVVTNPTHFAVALKYSPGEDRAPVVMAKGQRLMALRIKEIA 302

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
            +  I + E+P +ARSLFK V I   IP   YKAVA+++
Sbjct: 303 KQSGILVHEDPPIARSLFKTVDIGDEIPENLYKAVAEIL 341


>gi|266618907|ref|ZP_06111845.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum Bf]
 gi|263528671|gb|EEZ28380.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum Bf]
          Length = 413

 Score =  174 bits (442), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 111/355 (31%), Positives = 192/355 (54%), Gaps = 16/355 (4%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A + KTE  + +K  DA  +G    S+E +L  ++LAC + L+     G   +   +   
Sbjct: 65  ASEEKTEEATPRKKMDARKKGQVAKSKELALAFTLLACTLVLVALGEYGANELKETMAGF 124

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           L +    +L + +++  L     L   ++V+P  L  M FGI +  +Q   +     +KP
Sbjct: 125 LNNYLNMEL-NYNNLNSLAILTVLRVGKIVLPVALPIMCFGIAANYLQTGFLFTKEPLKP 183

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPH--- 182
            FK+++   G KR++S+  ++  +K    I +VG +    L +NY  +L+  +  P    
Sbjct: 184 DFKKLNPINGFKRMFSLRTVMELLKDLTIITVVGIVGYKFLQDNYLKILNLGTLRPWYMI 243

Query: 183 ----SILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYG 238
               S+    FF +     +I+LFIA   V D  +  +Q+   LKM+KQE+K+E KQ  G
Sbjct: 244 TGLLSLAISIFFRIT----LIMLFIA---VADYVYQKYQYNKDLKMTKQEVKEEYKQDEG 296

Query: 239 NPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL 298
           +P IK++ K   R     +MM+   +AT+++TNPTH A+ALRY +  + AP +VAKG + 
Sbjct: 297 DPQIKSKIKQKQREMAMQRMMQEVPKATVVVTNPTHIAVALRY-EKGDTAPKVVAKGADY 355

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +A K++ IA  + +P+ E   LAR ++++V I+S +P   Y+AVA+++  +Y  K
Sbjct: 356 VAIKIKDIAKNNEVPVIENKPLARLIYEKVEIDSEVPQDMYEAVAEILAIVYTLK 410


>gi|299534768|ref|ZP_07048098.1| flagellar biosynthesis protein FlhB [Lysinibacillus fusiformis ZC1]
 gi|298729856|gb|EFI70401.1| flagellar biosynthesis protein FlhB [Lysinibacillus fusiformis ZC1]
          Length = 362

 Score =  174 bits (441), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 109/353 (30%), Positives = 191/353 (54%), Gaps = 16/353 (4%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE  + KK +DA  +G    S++ S  S+I+  ++++  FF  G  S+  +L      
Sbjct: 15  EKTEKATPKKRQDARKKGQVVKSQDIS--SAIVMLMVFIFLFFFAG--SLRDELLAFFRQ 70

Query: 69  ATQRKLE----DISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVK 124
                +      I  ++ L T   +  + +++P + +  +  +    +Q   +  L  +K
Sbjct: 71  TFIHNIRIESLTIDSVMHLFTETLIQMAFIIVPIMAIAFVGALAGNFMQFGFLFTLEPMK 130

Query: 125 PSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSI 184
              K++   +G+K+I+S+  +V  +KS +KI  +G++ TI +  N   +L     +P   
Sbjct: 131 FDLKKMDPIKGLKKIFSVKAIVELIKSVLKIGFIGSVTTIIIWSNLPEVLALSFKSP--- 187

Query: 185 LYHAFFTVRKVL----IMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            +    TV K++    I   L +  ++VLD  +  H++   LKMSKQ+IKDE K S G+P
Sbjct: 188 -WMTLITVGKLVGIMGIAASLVLLCVSVLDWMYQKHEYEKNLKMSKQDIKDEYKNSEGDP 246

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           +IK++ K   R     +MM     A ++ITNPTHYA+AL+Y +   DAP ++AKG + IA
Sbjct: 247 LIKSKIKQRQREMAMRRMMSEVPSADVVITNPTHYAIALKYNEDSMDAPRVIAKGTDFIA 306

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +K++ IA EH++ + E   LAR+++ QV I   +P  F+KAVA+++  +Y  K
Sbjct: 307 QKIKLIAKEHDVIMVENRPLARAMYDQVEIGDQVPEEFFKAVAEILAYVYRIK 359


>gi|33592472|ref|NP_880116.1| flagellar biosynthesis protein FlhB [Bordetella pertussis Tohama I]
 gi|33572118|emb|CAE41658.1| flagellar biosynthetic protein FlhB [Bordetella pertussis Tohama I]
 gi|332381889|gb|AEE66736.1| flagellar biosynthesis protein FlhB [Bordetella pertussis CS]
          Length = 384

 Score =  174 bits (441), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 105/350 (30%), Positives = 176/350 (50%), Gaps = 15/350 (4%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            K+EA S +++E A  EG    SRE   F  + A +         G++   S L+  L  
Sbjct: 8   EKSEAASPRRLEKAREEGQIARSRELGTFMMLAAGVA--------GVWLSGSMLYQGLTG 59

Query: 69  ATQRKL-------EDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLN 121
             +R L       +D   +V    H +  A   V+P   +  +  + S ++    V +  
Sbjct: 60  VLRRGLGFEPRVAQDPGVMVEQAVHGAGRALLTVLPMFGMLAVVAVLSAVLLGGFVFSTK 119

Query: 122 HVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANP 181
            ++P+F ++SL  GIKR++S   +V  +K+  K  LVG +    +   +  ML  +   P
Sbjct: 120 PLEPNFSKLSLWSGIKRMFSAQTVVELVKALAKAALVGGVAVWVIWHYHDDMLGLMHVAP 179

Query: 182 HSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPI 241
            + L  A   V     +I+  +  + +LD+ W       KL+M+K++++ E K+  G+P 
Sbjct: 180 SAALTSAMSLVALCSALIVGSLLFVVLLDVPWQIWNHLKKLRMTKEDVRQEHKEGEGDPH 239

Query: 242 IKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAK 301
           +K R +   R+  R +MM     A +++TNPTHYA+AL+Y      AP +VAKG  LIA 
Sbjct: 240 VKGRIRQQQRAMARRRMMSEVPGADVVVTNPTHYAVALKYADGAAGAPRVVAKGTGLIAA 299

Query: 302 KMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           ++R++A EH IP  E P LAR+L + V +   IP   Y AVA+++  ++ 
Sbjct: 300 RIRELAAEHRIPTLEAPPLARALHQHVELGQEIPTALYTAVAEVLAWVFQ 349


>gi|294339803|emb|CAZ88166.1| Flagellar biosynthetic protein FlhB [Thiomonas sp. 3As]
          Length = 373

 Score =  174 bits (441), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 113/369 (30%), Positives = 194/369 (52%), Gaps = 38/369 (10%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSIL----ACLIYLL--FFFSPG 54
           M+E+ A + +  A S K+ + A  +G   ++R   L SS+L    A ++Y    +F+  G
Sbjct: 1   MAEDSAQEKELPA-SQKRKQQAREKGQ--VARSRDLTSSLLLLGMAAVVYTAGGWFYDMG 57

Query: 55  IYSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGL--------LLFMMFG 106
              + + L V  ASA+Q    D + ++        +A R+++ GL        L F+   
Sbjct: 58  RELLQTGLTVS-ASASQ----DPAAML-------QAAGRVLVLGLIVLAPVLALTFVASA 105

Query: 107 IGSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISL 166
            G   +    V +   + P F R+   +GI R++SI  L    K+ +K I++  I  I +
Sbjct: 106 AGGVAMGGW-VFSTEALAPDFSRLDPVKGIGRMFSITGLGELGKALLKAIVIAVIAGIVI 164

Query: 167 TENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVL----DIGWSYHQWYSKL 222
                 +L  +   P      A   + ++     L++A+ T+L    D+ W   Q   KL
Sbjct: 165 WNERGELLGLLQVEPQ----LAQMQLGQITARAFLWMASGTLLVAAVDVPWQLFQMNKKL 220

Query: 223 KMSKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYI 282
           KMS+Q+++DE+++S GNP IK + + + R R R +MM A  +A +++TNPTHYA+AL Y 
Sbjct: 221 KMSRQDLQDEMRESEGNPQIKQKMRELQRERARKRMMAAVPKADVVVTNPTHYAVALAYK 280

Query: 283 QTENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAV 342
           + +N APV++A G + +A ++R++A EHN+P+ E P LAR+L+    +   IP   Y AV
Sbjct: 281 EGKNRAPVVLALGADRVAARIREVAAEHNVPVIEAPPLARALYHHAELEQEIPVALYNAV 340

Query: 343 AQLIYKIYH 351
           A L+  ++ 
Sbjct: 341 ALLLAYVFQ 349


>gi|242238960|ref|YP_002987141.1| flagellar biosynthesis protein FlhB [Dickeya dadantii Ech703]
 gi|242131017|gb|ACS85319.1| flagellar biosynthetic protein FlhB [Dickeya dadantii Ech703]
          Length = 383

 Score =  173 bits (438), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 119/358 (33%), Positives = 189/358 (52%), Gaps = 17/358 (4%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D+   KTEAP+  + E A  EG  P SRE    +SI+  ++ L   +  G   V   L 
Sbjct: 3   DDSDLEKTEAPTPHRKEKAREEGQIPRSRE---LTSIMMLVVGLGILWMAGDI-VARRLA 58

Query: 64  VLLASATQRKLEDISHIVFLLTH----LSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLN 119
           +LL+       E IS    +L H    L L  S LV P +L  ++  I + ++    + +
Sbjct: 59  LLLSQGLFFTHEMISDDKQMLKHMLGLLKLGGSALV-PIILGTVVVAIAAPVMLGGLIFS 117

Query: 120 LNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISA 179
              ++ +  +++   GIKR+ S   L    K+ +K ++VG I ++ L  N+  +L  +S 
Sbjct: 118 TKQMEFNLNKLNPISGIKRLVSSQMLAELFKAILKAVVVGGITSLFLWHNWQDILRLVSE 177

Query: 180 NPHSI----LYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQ 235
              S     L+ A F    VLI ++  +      D+ W       KL+MSKQ+I+DE KQ
Sbjct: 178 PLFSAVTDSLHFAIFCGFFVLIGLIPMVG----FDVFWQIWSHLKKLRMSKQDIRDEFKQ 233

Query: 236 SYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKG 295
           + G+P +K R + + R+  + +MM    +A +I+TNPTHYA+AL+Y + +  AP ++AKG
Sbjct: 234 NEGDPHVKGRIRQLQRAMAQRRMMADVPKADVIVTNPTHYAVALQYNEQKMSAPKVLAKG 293

Query: 296 QNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
              IA K+R++  EH IPI E P LAR+L+K   I   IP   Y AVA+++  +Y  K
Sbjct: 294 AGEIALKIRELGNEHKIPILEAPPLARALYKHSEIGKNIPSTLYAAVAEVLVWVYQIK 351


>gi|85859183|ref|YP_461385.1| flagellar biosynthesis pathway component [Syntrophus aciditrophicus
           SB]
 gi|85722274|gb|ABC77217.1| flagellar biosynthesis pathway component [Syntrophus aciditrophicus
           SB]
          Length = 354

 Score =  173 bits (438), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 103/355 (29%), Positives = 194/355 (54%), Gaps = 5/355 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E++    +TE  + K+ E+A  +G    SR+ +  + + ACL+Y  F  +  ++ +  
Sbjct: 1   MAESNKDQERTEEATPKRREEAREQGQVAKSRDLASVAILSACLLYFYFGANSFLHQLMD 60

Query: 61  DLHVLLASATQRKL--EDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVL 118
            +    +S     +  E+I  ++F   + +++   L+ P LL+  +  + S ++Q    +
Sbjct: 61  LMKSSFSSLDSSLVTTENIQSLLFSAFYKTIT---LMTPFLLVVCIAALSSNILQVGFKI 117

Query: 119 NLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFIS 178
           +   + P   ++   +G  R++S+ +L+ F+KS  KI + G +  +++      +L    
Sbjct: 118 STKAIAPKLSKIDPAKGFARLFSLQSLIEFIKSIFKISIAGFVAYLTVKSELVDILPLAD 177

Query: 179 ANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYG 238
           ++   IL +   T  ++L+     +  L ++D  +   ++   LKMS+QEIKDE KQ+ G
Sbjct: 178 SSVWEILVYITGTSFRILLTTCWVLIILALMDYLYQRWEYERNLKMSRQEIKDENKQTEG 237

Query: 239 NPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL 298
           +PI+K R + + R   + +MM    +A +IITNPTH A+AL+Y Q    AP ++AKG   
Sbjct: 238 DPIVKARIRRLQREMAQRRMMANVPKADVIITNPTHLAVALQYDQDSMIAPKVIAKGAGY 297

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +A+K+++IA E  +P+ E   LA+ L+K V ++  IP   YKAVA+++  IY  K
Sbjct: 298 LAEKIKEIARESRVPLVENKPLAQVLYKMVEVSGTIPDSLYKAVAEILAYIYSIK 352


>gi|16125329|ref|NP_419893.1| flagellar biosynthesis protein FlhB [Caulobacter crescentus CB15]
 gi|221234068|ref|YP_002516504.1| flagellar biosynthesis protein FlhB [Caulobacter crescentus NA1000]
 gi|1147737|gb|AAA85127.1| third gene in fliQ operon; membrane protein homolog [Caulobacter
           vibrioides]
 gi|13422379|gb|AAK23061.1| flagellar biosynthesis protein FlhB [Caulobacter crescentus CB15]
 gi|220963240|gb|ACL94596.1| flagellar biosynthesis protein FlhB [Caulobacter crescentus NA1000]
          Length = 361

 Score =  173 bits (438), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 112/369 (30%), Positives = 201/369 (54%), Gaps = 33/369 (8%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGN----APISREASLFSSILACLIY-------LLF 49
           M+++  P++KTE PS+KK+ DA  +G+    A I + ASL  ++   L+        L+ 
Sbjct: 1   MADDTDPESKTEEPSAKKLSDARAKGDVIKSADIPQLASLAGAVSVILLAGGWLTRDLMA 60

Query: 50  FFSP-----GIYSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMM 104
             +P     G   ++S   +++             +V ++T  + +A+ +   G LL   
Sbjct: 61  ALTPFIAHAGTIDLSSGGAMIVLKQALLAALPALVLVMVVTAFAGAAAHIAQTGFLL--- 117

Query: 105 FGIGSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITI 164
                             +KP F+++ L +G+ RI+  + +V F+KS VK +L G I   
Sbjct: 118 --------------TPEKIKPDFQKLDLIKGLGRIFGPDGMVQFLKSAVKFLLTGVIAYF 163

Query: 165 SLTENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKM 224
            L  +   + + +  +P +++  A    + +LI ++L +   +  D  W   ++ ++++M
Sbjct: 164 VLKPHVGEVRNLVGMDPAAMIPEAMKLSKGLLIAVILLLVATSAFDYFWQRMRFMNRMRM 223

Query: 225 SKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQT 284
           + QE+K+E KQS G+P IK +++ I   R R +MM+A  +AT+++ NPTHYA+AL+Y Q 
Sbjct: 224 TLQEVKEEFKQSDGDPHIKGKRRQIQMQRSRQRMMQAVPKATVVVMNPTHYAVALKYEQG 283

Query: 285 ENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQ 344
           E  AP+ VAKG + +A K+R +A EH +P+ E+P LAR+L+  V I+  IP   ++AVA+
Sbjct: 284 ETPAPLCVAKGVDDLALKIRAVAEEHGVPVLEDPPLARALYASVEIDEEIPVEHFEAVAK 343

Query: 345 LIYKIYHKK 353
           +I  I + K
Sbjct: 344 VISFILNGK 352


>gi|114765217|ref|ZP_01444349.1| flagellar biosynthesis protein B [Pelagibaca bermudensis HTCC2601]
 gi|114542352|gb|EAU45380.1| flagellar biosynthesis protein B [Roseovarius sp. HTCC2601]
          Length = 375

 Score =  173 bits (438), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 103/353 (29%), Positives = 185/353 (52%), Gaps = 12/353 (3%)

Query: 2   SENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSD 61
            +++  DNKTE P+ +K+  A  +G+   S+EA    ++L+      F        +   
Sbjct: 3   DQDEDKDNKTEEPTERKLRKAREKGDVASSKEAGNVMAVLSLFAITAFVLPSVSAPLAGV 62

Query: 62  LHVLLASATQ-------RKLEDISHIVF-LLTHLSLSASRLVIPGLLLFMMFGIGSYLIQ 113
              +L SA Q         L D+  + + +L  + +    L+ P + L ++  +    +Q
Sbjct: 63  FRNVLESAGQVHVGTDLSGLRDLGAVSWKVLRGVGI----LLGPLMALMVIGALAGVALQ 118

Query: 114 RIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTM 173
              V+    +KP + ++S   G KR++S+   V F KS  K++LVG I    +      +
Sbjct: 119 GEVVVASERLKPKWSKISPISGFKRLFSLAAFVEFFKSVTKVLLVGVIAGWVVLNAVGQI 178

Query: 174 LDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEI 233
                  P  +         ++L++ L  ++ + V DI W       K +MS +EIKDE+
Sbjct: 179 WQTQGLVPEMVTDFIRAEAARMLLITLALVSVIAVADILWKRFDHRRKQRMSMKEIKDEV 238

Query: 234 KQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVA 293
           K++ G+P+I++++ +I R R R ++ +A  RAT+++TNPTH+A+AL+Y    + APV VA
Sbjct: 239 KETEGDPLIRSKRMNIRRERARQRLAQAVPRATVVLTNPTHFAVALKYENGVDMAPVCVA 298

Query: 294 KGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           KG +L+A ++R++A E+ IP+ E   LAR+L     ++  IP   ++AVA +I
Sbjct: 299 KGADLLAARIRELAKENEIPMVENRPLARALHDVAELDRPIPVEHWEAVAAII 351


>gi|119897394|ref|YP_932607.1| flagellar biosynthesis protein FlhB [Azoarcus sp. BH72]
 gi|119669807|emb|CAL93720.1| flagellar biosynthetic protein FlhB [Azoarcus sp. BH72]
          Length = 381

 Score =  173 bits (438), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 106/352 (30%), Positives = 188/352 (53%), Gaps = 9/352 (2%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+   KTE  S +++E A  EG  P SRE S F   +  ++ L      G +     L 
Sbjct: 3   EDSDLEKTEPASGRRLEQAREEGQVPQSRELSTFLVTMTGVVTLWLL---GEWMAQRLLG 59

Query: 64  VLLAS-ATQRKLEDISHIVFLLTHLSLSASRLV--IPGLLLFMMFGIGSYLIQRIPVLNL 120
           ++  S A +R++    H + L    SL    L+  +P  L  ++  + S +     V   
Sbjct: 60  MIRRSFAFEREMA-FDHTLILAELQSLLGGALLTLMPLFLALLVAAVASPIALGGLVFAP 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P+F R++  +G+ R++S++ L   +K+ +K +LVG +    L      + D +   
Sbjct: 119 KALGPNFGRMNPIQGLGRMFSVHGLAEMVKAILKALLVGGVGAAVLWYYKDHLFDLM-VE 177

Query: 181 PHSILYHAFF-TVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
           P  +    F  TV    ++I   +  L +LD+ +   Q++ +L+M+K+E+K E K+  G+
Sbjct: 178 PLEVGMPDFAETVVFTALLITASLGLLALLDVPFQLWQYHKRLRMTKEEVKREAKEQDGD 237

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLI 299
           P +K R +++ R   R +MM A  +A +++TNPTH+++AL+Y      APV+VAKG+  +
Sbjct: 238 PQLKGRIRAMQREMARGRMMAAVPKADVVVTNPTHFSVALKYDAERMGAPVVVAKGRGEL 297

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           A K+R+IA E+++P+ E P LAR+L+    +  AIP   Y AVA+++  +Y 
Sbjct: 298 AMKIREIARENDVPLLEAPPLARALYAHCELEQAIPAALYTAVAEVMAYVYQ 349


>gi|260757056|ref|ZP_05869404.1| flagellar biosynthetic protein FlhB [Brucella abortus bv. 6 str.
           870]
 gi|260677164|gb|EEX63985.1| flagellar biosynthetic protein FlhB [Brucella abortus bv. 6 str.
           870]
          Length = 165

 Score =  173 bits (438), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 78/160 (48%), Positives = 118/160 (73%)

Query: 194 KVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSR 253
           ++L+  +L IA +   D+ WS   W  +L+M++QE+KDE+KQS G+P++K+R +S+ R R
Sbjct: 3   RLLVANVLAIAAIAGFDLAWSRIHWRQELRMTRQEVKDELKQSEGDPLVKSRLRSLGRDR 62

Query: 254 IRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIP 313
            R +M+ A   AT+I+ NPTH+++ALRY   E+ APV+VAKGQ+LIA K+R+IA  H+IP
Sbjct: 63  ARRRMINAVPTATLIVANPTHFSVALRYKPNEDAAPVVVAKGQDLIALKIREIAASHSIP 122

Query: 314 IFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +FE+  LAR+L+KQV ++  I P FYKAVA+LI  I  ++
Sbjct: 123 VFEDVQLARALYKQVNVDQMIAPEFYKAVAELIRIINTRR 162


>gi|326796452|ref|YP_004314272.1| flagellar biosynthetic protein FlhB [Marinomonas mediterranea
           MMB-1]
 gi|326547216|gb|ADZ92436.1| flagellar biosynthetic protein FlhB [Marinomonas mediterranea
           MMB-1]
          Length = 378

 Score =  172 bits (437), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 108/356 (30%), Positives = 195/356 (54%), Gaps = 7/356 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+    KTE  SSKK++DA  +GN  ++R   L S+ L  +  +  +F+  I ++  
Sbjct: 1   MAENEDGTEKTEDASSKKLDDARKKGN--VARSKDLSSAALLIVAAMSIYFTGRILAI-- 56

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPV-LN 119
           DL  L       + +D+     ++ HL  SA  ++   +LL  +  +   +       LN
Sbjct: 57  DLGNLFHFNFVIERQDLFDKARMIFHLYESAVGVIDSMILLMGVLAVAGIVGSIGIGGLN 116

Query: 120 LNH--VKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFI 177
            +   + P   +++   G+KRI S+ +LV  +KS  K++LVG+I T+ +      +L   
Sbjct: 117 FSWEPLTPKLSKLNPISGLKRIASVQSLVELLKSIAKVLLVGSIATVVIMLYLPELLGLP 176

Query: 178 SANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSY 237
             +  + + H+   +    I + L +  +  +DI +   +  + LKM+KQE+KDE KQ+ 
Sbjct: 177 FESVGNAVQHSTEVLIWAFIFVSLALVFIAAIDIPFQIWKHSNDLKMTKQEVKDEHKQAE 236

Query: 238 GNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQN 297
           G+P +K R + + +    ++MM    +A +IITNPTH+++AL+Y  T +DAPV++AKG +
Sbjct: 237 GDPQVKGRIRQMQQQMAMNRMMSDVPKADVIITNPTHFSVALKYDTTSSDAPVVLAKGPD 296

Query: 298 LIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            IA K+R++A  + IP+ + P L R+++K   +   +P   +K VAQL+  ++  K
Sbjct: 297 FIAMKIREVANFYEIPVIQSPDLTRAIYKHTEVGEQVPEGLFKVVAQLLAYVFQLK 352


>gi|170761528|ref|YP_001787967.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           botulinum A3 str. Loch Maree]
 gi|169408517|gb|ACA56928.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum A3
           str. Loch Maree]
          Length = 609

 Score =  172 bits (437), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 112/355 (31%), Positives = 192/355 (54%), Gaps = 16/355 (4%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A + KTE  + +K  DA  +G    S+E +L  ++LAC + L+     G   +   +   
Sbjct: 261 ASEEKTEEATPRKKMDARKKGQVAKSKELALAFTLLACTLVLVALGEYGANELKETMAGF 320

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           L +    +L + +++  L     L   ++V+P  L  M FGI +  +Q   +     +KP
Sbjct: 321 LNNYLNMEL-NYNNLNSLAILTVLRVGKIVLPVALPIMCFGIAANYLQTGFLFTKEPLKP 379

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPH--- 182
            FK+++   G KR++S+  ++  +K    I +VG +    L +NY  +L+  +  P    
Sbjct: 380 DFKKLNPINGFKRMFSLRTVMELLKDLTIITVVGIVGYKFLQDNYLKILNLGTLRPWYMI 439

Query: 183 ----SILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYG 238
               S+    FF +     +I+LFIA   V D  +  +Q+   LKM+KQE+K+E KQ  G
Sbjct: 440 TGLLSLAISIFFRIT----LIMLFIA---VADYVYQKYQYNKDLKMTKQEVKEEYKQDEG 492

Query: 239 NPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL 298
           +P IK++ K   R     +MM+   +AT+++TNPTH A+ALRY +  + AP +VAKG + 
Sbjct: 493 DPQIKSKIKQKQREMAMQRMMQEVPKATVVVTNPTHIAVALRY-EKGDTAPKVVAKGADY 551

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +A K++ IA  + IP+ E   LAR ++++V I+S +P   Y+AVA+++  +Y  K
Sbjct: 552 VAIKIKDIAKNNEIPVIENKPLARLIYEKVEIDSEVPQDMYEAVAEILAIVYTLK 606


>gi|187778764|ref|ZP_02995237.1| hypothetical protein CLOSPO_02359 [Clostridium sporogenes ATCC
           15579]
 gi|187772389|gb|EDU36191.1| hypothetical protein CLOSPO_02359 [Clostridium sporogenes ATCC
           15579]
          Length = 587

 Score =  172 bits (437), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 105/348 (30%), Positives = 188/348 (54%), Gaps = 2/348 (0%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A + KTE  + +K  DA  +G    S+E +L  ++LAC + L+     G   +   +   
Sbjct: 239 ASEEKTEEATPRKKMDARKKGQVAKSKELALAFTLLACTLVLVALGEYGANELKETMAGF 298

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           L +    +L + +++  L     L   ++V+P  L  M FGI +  +Q   +     +KP
Sbjct: 299 LNNYLNMEL-NYNNLNSLAILTVLRVGKIVLPVALPIMCFGIAANYLQTGFLFTKEPLKP 357

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
            FK+++   G KR++S+  ++  +K    I +VG +    L +NY  +L+  +  P  ++
Sbjct: 358 DFKKLNPINGFKRMFSLRTVMELLKDLTIITVVGIVGYKFLKDNYLKILNLGTLRPWYMI 417

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
                    +   I L +  ++V D  +  +Q+   LKM+KQE+K+E KQ  G+P IK++
Sbjct: 418 TGLLSLAISIFFKITLIMLFISVADYVYQKYQYNKDLKMTKQEVKEEYKQDEGDPQIKSK 477

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
            K   R     +MM+   +AT+++TNPTH A+ALRY +  + AP +VAKG + +A K++ 
Sbjct: 478 IKQKQREMAMQRMMQEVPKATVVVTNPTHIAVALRY-EKGDSAPKVVAKGADYVAIKIKD 536

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           IA  + +P+ E   LAR ++++V I+S +P   Y+AVA+++  +Y  K
Sbjct: 537 IAKNNEVPVIENKPLARLIYEKVEIDSEVPQDMYEAVAEILAIVYTLK 584


>gi|269836606|ref|YP_003318834.1| flagellar biosynthetic protein FlhB [Sphaerobacter thermophilus DSM
           20745]
 gi|269785869|gb|ACZ38012.1| flagellar biosynthetic protein FlhB [Sphaerobacter thermophilus DSM
           20745]
          Length = 361

 Score =  172 bits (436), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 102/344 (29%), Positives = 183/344 (53%), Gaps = 1/344 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
           + +TE  + K+ +DA  +G+ P S E S  + +L  L +L ++      ++T        
Sbjct: 3   EERTERATPKRRQDARRQGDVPRSAELSAAAGLLGALAFLQWYGGQAAGALTGYFRGTFG 62

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
             +   L  ++ I  L     +  +R+V P + + ++ GI + + Q  PV  L  +KP F
Sbjct: 63  GLSPSDLTPLA-IQNLAWESGMVFARVVGPLVAVVLVVGIAAGVAQTGPVFALAALKPDF 121

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
           KR++   G+KRI+S        K+ VK++++  +    L            A+P SI   
Sbjct: 122 KRINPAAGLKRIFSRRGAFETFKALVKLVIIAALTYPVLRAEVAHFASLTGAHPVSIAEA 181

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
              T+ KV +        L + D  +   ++  +L+M++QE+++E++Q  GNP +K+R +
Sbjct: 182 VGRTLVKVGLRAAGAFFILALADYAFQRWEYERRLRMTRQELREELRQIEGNPELKSRIR 241

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
            + R   R +MM A  +AT+++TNPTH A+A+RY      APV+VAKG  L A+++++IA
Sbjct: 242 QLQRQLARGRMMHAVPKATVVVTNPTHLAVAIRYEMRTMPAPVVVAKGSGLTAERIKQIA 301

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            EH +P+ E   LA++L++   + + IP   Y+AVA +I  +Y 
Sbjct: 302 REHAVPVVENKPLAQALYRMADVGAEIPVALYEAVADVIAYVYR 345


>gi|322806976|emb|CBZ04546.1| flagellar biosynthesis protein FlhB [Clostridium botulinum H04402
           065]
          Length = 609

 Score =  172 bits (436), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 111/355 (31%), Positives = 192/355 (54%), Gaps = 16/355 (4%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A + KTE  + +K  DA  +G    S+E +L  ++LAC + L+     G   +   +   
Sbjct: 261 ASEEKTEEATPRKKMDARKKGQVAKSKELALAFTLLACTLVLVALGEYGTNELKETMAGF 320

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           L +    +L + +++  L     L   ++V+P  L  M FGI +  +Q   +     +KP
Sbjct: 321 LNNYLNMEL-NYNNLNSLAILTVLRVGKIVLPVALPIMCFGIAANYLQTGFLFTKEPLKP 379

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPH--- 182
            FK+++   G KR++S+  ++  +K    I +VG +    L +NY  +L+  +  P    
Sbjct: 380 DFKKLNPINGFKRMFSLRTVMELLKDLTIITVVGIVGYKFLQDNYLKILNLGTLRPWYMI 439

Query: 183 ----SILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYG 238
               S+    FF +     +I+LFIA   V D  +  +Q+   LKM+KQE+K+E KQ  G
Sbjct: 440 TGLLSLAISIFFRIT----LIMLFIA---VADYVYQKYQYNKDLKMTKQEVKEEYKQDEG 492

Query: 239 NPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL 298
           +P IK++ K   R     +MM+   +AT+++TNPTH A+ALRY +  + AP +VAKG + 
Sbjct: 493 DPQIKSKIKQKQREMAMQRMMQEVPKATVVVTNPTHIAVALRY-EKGDTAPKVVAKGADY 551

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +A K++ IA  + +P+ E   LAR ++++V I+S +P   Y+AVA+++  +Y  K
Sbjct: 552 VAIKIKDIAKNNEVPVIENKPLARLIYEKVEIDSEVPQDMYEAVAEILAIVYTLK 606


>gi|237796086|ref|YP_002863638.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum Ba4
           str. 657]
 gi|229263066|gb|ACQ54099.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum Ba4
           str. 657]
          Length = 609

 Score =  172 bits (436), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 111/355 (31%), Positives = 192/355 (54%), Gaps = 16/355 (4%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A + KTE  + +K  DA  +G    S+E +L  ++LAC + L+     G   +   +   
Sbjct: 261 ASEEKTEEATPRKKMDARKKGQVAKSKELALAFTLLACTLVLVALGEYGANELKETMAGF 320

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           L +    +L + +++  L     L   ++V+P  L  M FGI +  +Q   +     +KP
Sbjct: 321 LNNYLNMEL-NYNNLNSLAILTVLRVGKIVLPVALPIMCFGIAANYLQTGFLFTKEPLKP 379

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPH--- 182
            FK+++   G KR++S+  ++  +K    I +VG +    L +NY  +L+  +  P    
Sbjct: 380 DFKKLNPINGFKRMFSLRTVMELLKDLTIITVVGIVGYKFLQDNYLKILNLGTLRPWYMI 439

Query: 183 ----SILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYG 238
               S+    FF +     +I+LFIA   V D  +  +Q+   LKM+KQE+K+E KQ  G
Sbjct: 440 TGLLSLAISIFFRIT----LIMLFIA---VADYVYQKYQYNKDLKMTKQEVKEEYKQDEG 492

Query: 239 NPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL 298
           +P IK++ K   R     +MM+   +AT+++TNPTH A+ALRY +  + AP +VAKG + 
Sbjct: 493 DPQIKSKIKQKQREMAMQRMMQEVPKATVVVTNPTHIAVALRY-EKGDTAPKVVAKGADY 551

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +A K++ IA  + +P+ E   LAR ++++V I+S +P   Y+AVA+++  +Y  K
Sbjct: 552 VAIKIKDIAKNNEVPVIENKPLARLIYEKVEIDSEVPQDMYEAVAEILAIVYTLK 606


>gi|170757192|ref|YP_001782263.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           botulinum B1 str. Okra]
 gi|169122404|gb|ACA46240.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum B1
           str. Okra]
          Length = 609

 Score =  172 bits (436), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 111/355 (31%), Positives = 192/355 (54%), Gaps = 16/355 (4%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A + KTE  + +K  DA  +G    S+E +L  ++LAC + L+     G   +   +   
Sbjct: 261 ASEEKTEEATPRKKMDARKKGQVAKSKELALAFTLLACTLVLVALGEYGANELKETMAGF 320

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           L +    +L + +++  L     L   ++V+P  L  M FGI +  +Q   +     +KP
Sbjct: 321 LNNYLNMEL-NYNNLNSLAILTVLRVGKIVLPVALPIMCFGIAANYLQTGFLFTKEPLKP 379

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPH--- 182
            FK+++   G KR++S+  ++  +K    I +VG +    L +NY  +L+  +  P    
Sbjct: 380 DFKKLNPINGFKRMFSLRTVMELLKDLTIITVVGIVGYKFLQDNYLKILNLGTLRPWYMI 439

Query: 183 ----SILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYG 238
               S+    FF +     +I+LFIA   V D  +  +Q+   LKM+KQE+K+E KQ  G
Sbjct: 440 TGLLSLAISIFFRIT----LIMLFIA---VADYVYQKYQYNKDLKMTKQEVKEEYKQDEG 492

Query: 239 NPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL 298
           +P IK++ K   R     +MM+   +AT+++TNPTH A+ALRY +  + AP +VAKG + 
Sbjct: 493 DPQIKSKIKQKQREMAMQRMMQEVPKATVVVTNPTHIAVALRY-EKGDTAPKVVAKGADY 551

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +A K++ IA  + +P+ E   LAR ++++V I+S +P   Y+AVA+++  +Y  K
Sbjct: 552 VAIKIKDIAKNNEVPVIENKPLARLIYEKVEIDSEVPQDMYEAVAEILAIVYTLK 606


>gi|51596001|ref|YP_070192.1| flagellar biosynthesis protein FlhB [Yersinia pseudotuberculosis IP
           32953]
 gi|51589283|emb|CAH20904.1| flagellar biosynthetic/export protein FlhB [Yersinia
           pseudotuberculosis IP 32953]
          Length = 386

 Score =  172 bits (436), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 113/362 (31%), Positives = 189/362 (52%), Gaps = 25/362 (6%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+   K+E P++ K+E A  +G  P SRE    +S+L     L   +  G  S+   L 
Sbjct: 3   EDSDQEKSEEPTASKLEKAREKGQIPRSRE---LTSMLMLGAGLTILWMSG-ESMARQLS 58

Query: 64  VLLA----------SATQRKLEDISHIV--FLLTHLSLSASRLVIPGLLLFMMFGIGSYL 111
            ++A          S  ++ L  I  ++   LL  L + A  LVI  L + M+ G G   
Sbjct: 59  AMVAQGLHFDHSMVSNDKQMLRQIGMLLRQTLLAMLPIFAG-LVIVALAVPMLLG-GV-- 114

Query: 112 IQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYF 171
                + +   +K   KR+S   G+KR++S   L   +K+ +K  LVG +  + L  N+ 
Sbjct: 115 -----LFSGESIKFDLKRMSPVAGLKRMFSSQALAELLKAILKATLVGWVTGLFLWHNWP 169

Query: 172 TMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKD 231
            M+  I+A P + L  A   +    ++++L ++ +   D+ +       KL+M+KQ+I+D
Sbjct: 170 DMMRLIAAPPVAALGDALHLIIFCGLVVVLGLSPMVGFDVFYQITSHIKKLRMTKQDIRD 229

Query: 232 EIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVL 291
           E K   G+P +K R +   R+  R +MM    +A II+TNPTHYA+AL+Y +++  AP +
Sbjct: 230 EFKNQEGDPHVKGRIRQQQRAMARRRMMVDVPKADIIVTNPTHYAVALQYNESKMSAPKV 289

Query: 292 VAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           +AKG   +A ++R++  EH IP+ E P LAR+LF+   +   IP   Y AVA+++  +Y 
Sbjct: 290 LAKGAGAVALRIRELGAEHRIPLLEAPPLARALFRHSEVGQHIPATLYAAVAEVLAWVYQ 349

Query: 352 KK 353
            K
Sbjct: 350 LK 351


>gi|148380604|ref|YP_001255145.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum A
           str. ATCC 3502]
 gi|153931538|ref|YP_001384891.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           botulinum A str. ATCC 19397]
 gi|153937825|ref|YP_001388360.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           botulinum A str. Hall]
 gi|148290088|emb|CAL84207.1| flagellar biosynthetic protein [Clostridium botulinum A str. ATCC
           3502]
 gi|152927582|gb|ABS33082.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum A
           str. ATCC 19397]
 gi|152933739|gb|ABS39238.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum A
           str. Hall]
          Length = 609

 Score =  172 bits (436), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 111/355 (31%), Positives = 192/355 (54%), Gaps = 16/355 (4%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A + KTE  + +K  DA  +G    S+E +L  ++LAC + L+     G   +   +   
Sbjct: 261 ASEEKTEEATPRKKMDARKKGQVAKSKELALAFTLLACTLVLVALGEYGANELKETMAGF 320

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           L +    +L + +++  L     L   ++V+P  L  M FGI +  +Q   +     +KP
Sbjct: 321 LNNYLNMEL-NYNNLNSLAILTVLRVGKIVLPVALPIMCFGIAANYLQTGFLFTKEPLKP 379

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPH--- 182
            FK+++   G KR++S+  ++  +K    I +VG +    L +NY  +L+  +  P    
Sbjct: 380 DFKKLNPINGFKRMFSLRTVMELLKDLTIITVVGIVGYKFLQDNYLKILNLGTLRPWYMI 439

Query: 183 ----SILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYG 238
               S+    FF +     +I+LFIA   V D  +  +Q+   LKM+KQE+K+E KQ  G
Sbjct: 440 TGLLSLAISIFFRIT----LIMLFIA---VADYVYQKYQYNKDLKMTKQEVKEEYKQDEG 492

Query: 239 NPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL 298
           +P IK++ K   R     +MM+   +AT+++TNPTH A+ALRY +  + AP +VAKG + 
Sbjct: 493 DPQIKSKIKQKQREMAMQRMMQEVPKATVVVTNPTHIAVALRY-EKGDTAPKVVAKGADY 551

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +A K++ IA  + +P+ E   LAR ++++V I+S +P   Y+AVA+++  +Y  K
Sbjct: 552 VAIKIKDIAKNNEVPVIENKPLARLIYEKVEIDSEVPQDMYEAVAEILAIVYTLK 606


>gi|91776296|ref|YP_546052.1| flagellar biosynthetic protein FlhB [Methylobacillus flagellatus
           KT]
 gi|91710283|gb|ABE50211.1| flagellar biosynthetic protein FlhB [Methylobacillus flagellatus
           KT]
          Length = 381

 Score =  172 bits (436), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 116/357 (32%), Positives = 192/357 (53%), Gaps = 19/357 (5%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+   KTE P+ ++IE A  +G+ P SRE S    ++A  + L+   S    ++ S++ 
Sbjct: 3   QDSDLEKTEQPTPRRIEKAREDGDVPRSREFSTCVVLMAGGLGLMMLGSRLNQAMLSNM- 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVI---PGLLLFMMFGIGSYLIQRIPVLNL 120
               S+ +   E       LL+ ++     L+I   P +LL ++  +G+ ++  +   N 
Sbjct: 62  ---ISSLRISREAAFDFSLLLSKIASGVLDLLIAFAPLILLLLVVIVGAPVL--VGGWNF 116

Query: 121 NHVK--PSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFIS 178
           ++    P F +++   GIK ++S N+LV  +K+ +K  LVGT+  + +  ++ T+L    
Sbjct: 117 SNKAFLPKFSKLNPLNGIKNLFSKNSLVELIKAILKAALVGTVSYMVMAHDFDTLLSL-- 174

Query: 179 ANPHSILYHAFFTVRKVLIMILLFIATLTVL----DIGWSYHQWYSKLKMSKQEIKDEIK 234
             P   L      V  +LI   LFI +  VL    D+ +    + +KLKM+K+E+K E K
Sbjct: 175 --PTQPLETGIAQVDDILIKGFLFIVSALVLVALIDVPYQRWSYTNKLKMTKEEVKQEAK 232

Query: 235 QSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAK 294
           +S GNP IK R +   R   R +MM    +A ++ITNPTHYA+A++Y      AP ++AK
Sbjct: 233 ESDGNPQIKGRIRQQQREMARRRMMAEIPKADVVITNPTHYAVAIKYDDQSMAAPRVIAK 292

Query: 295 GQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           G + IA K+R+IA EHN+ I E P LAR+LF    +   IP   Y AVA+++  ++ 
Sbjct: 293 GADDIALKIREIAGEHNVAILESPKLARALFAHTELGDEIPQALYAAVAEILAYVFQ 349


>gi|226950059|ref|YP_002805150.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum A2
           str. Kyoto]
 gi|226843732|gb|ACO86398.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum A2
           str. Kyoto]
          Length = 609

 Score =  172 bits (435), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 111/355 (31%), Positives = 192/355 (54%), Gaps = 16/355 (4%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A + KTE  + +K  DA  +G    S+E +L  ++LAC + L+     G   +   +   
Sbjct: 261 ASEEKTEEATPRKKMDARKKGQVAKSKELALAFTLLACTLVLVALGEYGANELKETMAGF 320

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           L +    +L + +++  L     L   ++V+P  L  M FGI +  +Q   +     +KP
Sbjct: 321 LNNYLNMEL-NYNNLNSLAILTVLRVGKIVLPVALPIMCFGIAANYLQTGFLFTKEPLKP 379

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPH--- 182
            FK+++   G KR++S+  ++  +K    I +VG +    L +NY  +L+  +  P    
Sbjct: 380 DFKKLNPINGFKRMFSLRTVMELLKDLTIITVVGIVGYKFLQDNYLKILNLGTLRPWYMI 439

Query: 183 ----SILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYG 238
               S+    FF +     +I+LFIA   V D  +  +Q+   LKM+KQE+K+E KQ  G
Sbjct: 440 TGLLSLAISIFFRIT----LIMLFIA---VADYVYQKYQYNKDLKMTKQEVKEEYKQDEG 492

Query: 239 NPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL 298
           +P IK++ K   R     +MM+   +AT+++TNPTH A+ALRY +  + AP +VAKG + 
Sbjct: 493 DPQIKSKIKQKQREMAMQRMMQEVPKATVVVTNPTHIAVALRY-EKGDTAPKVVAKGADY 551

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +A K++ IA  + +P+ E   LAR ++++V I+S +P   Y+AVA+++  +Y  K
Sbjct: 552 VAIKIKDIAKNNEVPVIENKPLARLIYEKVEIDSEVPQDMYEAVAEILAIVYTLK 606


>gi|168180929|ref|ZP_02615593.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum
           NCTC 2916]
 gi|182668325|gb|EDT80304.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum
           NCTC 2916]
          Length = 609

 Score =  172 bits (435), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 111/355 (31%), Positives = 192/355 (54%), Gaps = 16/355 (4%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A + KTE  + +K  DA  +G    S+E +L  ++LAC + L+     G   +   +   
Sbjct: 261 ASEEKTEEATPRKKMDARKKGQVAKSKELALAFTLLACTLVLVALGEYGANELKETMAGF 320

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           L +    +L + +++  L     L   ++V+P  L  M FGI +  +Q   +     +KP
Sbjct: 321 LNNYLNMEL-NYNNLNSLAILTVLRVGKIVLPVALPIMCFGIAANYLQTGFLFTKEPLKP 379

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPH--- 182
            FK+++   G KR++S+  ++  +K    I +VG +    L +NY  +L+  +  P    
Sbjct: 380 DFKKLNPINGFKRMFSLRTVMELLKDLTIITVVGIVGYKFLQDNYLKILNLGTLRPWYMI 439

Query: 183 ----SILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYG 238
               S+    FF +     +I+LFIA   V D  +  +Q+   LKM+KQE+K+E KQ  G
Sbjct: 440 TGLLSLAISIFFRIT----LIMLFIA---VADYVYQKYQYNKDLKMTKQEVKEEYKQDEG 492

Query: 239 NPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL 298
           +P IK++ K   R     +MM+   +AT+++TNPTH A+ALRY +  + AP +VAKG + 
Sbjct: 493 DPQIKSKIKQKQREMAMQRMMQEVPKATVVVTNPTHIAIALRY-EKGDTAPKVVAKGADY 551

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +A K++ IA  + +P+ E   LAR ++++V I+S +P   Y+AVA+++  +Y  K
Sbjct: 552 VAIKIKDIAKNNEVPVIENKPLARLIYEKVEIDSEVPQDMYEAVAEILAIVYTLK 606


>gi|293395574|ref|ZP_06639857.1| flagellar biosynthetic protein FlhB [Serratia odorifera DSM 4582]
 gi|291421893|gb|EFE95139.1| flagellar biosynthetic protein FlhB [Serratia odorifera DSM 4582]
          Length = 391

 Score =  172 bits (435), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 111/358 (31%), Positives = 186/358 (51%), Gaps = 21/358 (5%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPG-------IY 56
            D+   K+EAP+  ++E A  EG  P SRE    +SIL  +  L   +  G         
Sbjct: 11  EDSDLEKSEAPTPHRVEKAREEGQIPRSRE---LTSILMLIAGLAILWVGGSNLARQLAQ 67

Query: 57  SVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIP 116
            +T  LH         +   + H + +L   ++ A   V+ GL+L  +      L+  I 
Sbjct: 68  MLTDGLHFDHGMVNNDR--QMLHQLGMLLRQAVWALLPVMAGLVLVAL--TAPMLLGGI- 122

Query: 117 VLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDF 176
           + +   +K   KR++   G+KRI+S   L   +K  +K +LVG +  + L  N+  ML  
Sbjct: 123 LFSGKSLKFDLKRLNPLSGLKRIFSSQVLAELLKGVLKALLVGWVTGLFLWHNWAAMLHL 182

Query: 177 ISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYS---KLKMSKQEIKDEI 233
           ++  P   L +A   V    ++++L +  +   D+   ++Q +S   KLKM+KQ+I+DE 
Sbjct: 183 VTQQPLDALANALQMVVFCGLLVVLGLVPMVAFDV---FYQLWSHIKKLKMTKQDIRDEF 239

Query: 234 KQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVA 293
           K+  G+P +K R +   ++  R +MM    +A +I+TNPTHYA+AL+Y   +  AP ++A
Sbjct: 240 KEQEGDPHVKGRIRQQQQAIARRRMMSDVPKADVIVTNPTHYAVALQYNDKQMSAPRVLA 299

Query: 294 KGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           KG   IA ++R++A +H IP  E P LAR+L++   I   IP   Y AVA+++  +Y 
Sbjct: 300 KGAGEIALRIRELAAQHRIPTLEAPPLARALYRHSEIGQHIPTTLYAAVAEVLAWVYQ 357


>gi|167470753|ref|ZP_02335457.1| flagellar biosynthesis protein FlhB [Yersinia pestis FV-1]
          Length = 386

 Score =  172 bits (435), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 112/362 (30%), Positives = 189/362 (52%), Gaps = 25/362 (6%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+   K+E P++ K+E A  +G  P SRE    +S+L     L   +  G  S+   L 
Sbjct: 3   EDSDQEKSEEPTASKLEKAREKGQIPRSRE---LTSMLMLGAGLTILWMSG-ESMARQLS 58

Query: 64  VLLA----------SATQRKLEDISHIV--FLLTHLSLSASRLVIPGLLLFMMFGIGSYL 111
            ++A          S  ++ L  I  ++   LL  L + A  LVI  L + M+ G G   
Sbjct: 59  AMVAQGLHFGHSMVSNDKQMLRQIGMLLRQTLLAMLPIFAG-LVIVALAVPMLLG-GV-- 114

Query: 112 IQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYF 171
                + +   +K   KR+S   G+KR++S   L   +K+ +K  LVG +  + L  N+ 
Sbjct: 115 -----LFSGESIKFDLKRMSPVAGLKRMFSSQALAELLKAILKATLVGWVTGLFLWHNWP 169

Query: 172 TMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKD 231
            M+  I+A P + L  A   +    ++++L ++ +   D+ +       KL+M+KQ+I+D
Sbjct: 170 DMMRLIAAPPVAALGDALHLIIFCGLVVVLGLSPMVGFDVFYQITSHIKKLRMTKQDIRD 229

Query: 232 EIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVL 291
           E K   G+P +K R +   R+  R +MM    +A +I+TNPTHYA+AL+Y +++  AP +
Sbjct: 230 EFKNQEGDPHVKGRIRQQQRAMARRRMMVDVPKADVIVTNPTHYAVALQYNESKMSAPKV 289

Query: 292 VAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           +AKG   +A ++R++  EH IP+ E P LAR+LF+   +   IP   Y AVA+++  +Y 
Sbjct: 290 LAKGAGAVALRIRELGAEHRIPLLEAPPLARALFRHSEVGQHIPATLYAAVAEVLAWVYQ 349

Query: 352 KK 353
            K
Sbjct: 350 LK 351


>gi|251789159|ref|YP_003003880.1| flagellar biosynthesis protein FlhB [Dickeya zeae Ech1591]
 gi|247537780|gb|ACT06401.1| flagellar biosynthetic protein FlhB [Dickeya zeae Ech1591]
          Length = 383

 Score =  172 bits (435), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 103/357 (28%), Positives = 186/357 (52%), Gaps = 15/357 (4%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D+   KTEAP+ ++ E A  EG  P S+E +    ++A L  L  + S    S+   L 
Sbjct: 3   DDSDLEKTEAPTPQRTEKAREEGQIPRSKELTSVFMLIAGLAILWGYGS----SMAGKLT 58

Query: 64  VLLASA---TQRKLED----ISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIP 116
            ++A         + D    ISH+  LL    L+    ++P L   ++  + + ++    
Sbjct: 59  DMMAKGLIFDHNLISDERLFISHVGALLKQAMLA----IVPILFGLVLVALAAPVLLGGL 114

Query: 117 VLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDF 176
           + +   +   F +++   G+KR++S + L    K+ +K ++VG I    L  N+ +ML  
Sbjct: 115 IFSTKAISFDFGKLNPLSGLKRMFSTHVLAELFKAILKAVIVGCITYWFLLHNWNSMLHL 174

Query: 177 ISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQS 236
           +S      +  A          +++ +  +   D+ W       +L+MSKQEI+DE K+ 
Sbjct: 175 VSEPMGIAIKDALNIAFLCCFWVIMGLFPMVAFDVAWQIWSHIKRLRMSKQEIRDEYKEH 234

Query: 237 YGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQ 296
            G+P IK R +   R+  + +MM    +A +I+TNPTHYA+AL+Y + + +AP ++AKG 
Sbjct: 235 EGDPHIKGRIRQQQRAMAQRRMMADVPKADVIVTNPTHYAVALKYDEKKMNAPKVLAKGA 294

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           + +A+++R++  E+ +PI E P LAR+L++   I   IP   Y AVA+++  +Y  K
Sbjct: 295 DRVAQRIRELGAENRVPILEAPPLARALYRHTEIGQQIPAGLYAAVAEVLSWVYQLK 351


>gi|167420299|ref|ZP_02312052.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|166961994|gb|EDR58015.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar
           Orientalis str. MG05-1020]
          Length = 390

 Score =  172 bits (435), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 112/362 (30%), Positives = 189/362 (52%), Gaps = 25/362 (6%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+   K+E P++ K+E A  +G  P SRE    +S+L     L   +  G  S+   L 
Sbjct: 3   EDSDQEKSEEPTASKLEKAREKGQIPRSRE---LTSMLMLGAGLTILWMSG-ESMARQLS 58

Query: 64  VLLA----------SATQRKLEDISHIV--FLLTHLSLSASRLVIPGLLLFMMFGIGSYL 111
            ++A          S  ++ L  I  ++   LL  L + A  LVI  L + M+ G G   
Sbjct: 59  AMVAQGLHFDHSMVSNDKQMLRQIGMLLRQTLLAMLPIFAG-LVIVALAVPMLLG-GV-- 114

Query: 112 IQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYF 171
                + +   +K   KR+S   G+KR++S   L   +K+ +K  LVG +  + L  N+ 
Sbjct: 115 -----LFSGESIKFDLKRMSPVAGLKRMFSSQALAELLKAILKATLVGWVTGLFLWHNWP 169

Query: 172 TMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKD 231
            M+  I+A P + L  A   +    ++++L ++ +   D+ +       KL+M+KQ+I+D
Sbjct: 170 DMMRLIAAPPVAALGDALHLIIFCGLVVVLGLSPMVGFDVFYQITSHIKKLRMTKQDIRD 229

Query: 232 EIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVL 291
           E K   G+P +K R +   R+  R +MM    +A +I+TNPTHYA+AL+Y +++  AP +
Sbjct: 230 EFKNQEGDPHVKGRIRQQQRAMARRRMMVDVPKADVIVTNPTHYAVALQYNESKMSAPKV 289

Query: 292 VAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           +AKG   +A ++R++  EH IP+ E P LAR+LF+   +   IP   Y AVA+++  +Y 
Sbjct: 290 LAKGAGAVALRIRELGAEHRIPLLEAPPLARALFRHSEVGQHIPATLYAAVAEVLAWVYQ 349

Query: 352 KK 353
            K
Sbjct: 350 LK 351


>gi|153939695|ref|YP_001391947.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           botulinum F str. Langeland]
 gi|152935591|gb|ABS41089.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum F
           str. Langeland]
 gi|295319965|gb|ADG00343.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum F
           str. 230613]
          Length = 609

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 111/355 (31%), Positives = 192/355 (54%), Gaps = 16/355 (4%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A + KTE  + +K  DA  +G    S+E +L  ++LAC + L+     G   +   +   
Sbjct: 261 ASEEKTEDATPRKKMDARKKGQVAKSKELALAFTLLACTLVLVALGEYGANELKETMAGF 320

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           L +    +L + +++  L     L   ++V+P  L  M FGI +  +Q   +     +KP
Sbjct: 321 LNNYLNMEL-NYNNLNSLAILTVLRVGKIVLPVALPIMCFGIAANYLQTGFLFTKEPLKP 379

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPH--- 182
            FK+++   G KR++S+  ++  +K    I +VG +    L +NY  +L+  +  P    
Sbjct: 380 DFKKLNPINGFKRMFSLRTVMELLKDLTIITVVGIVGYKFLQDNYLKILNLGTLRPWYMI 439

Query: 183 ----SILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYG 238
               S+    FF +     +I+LFIA   V D  +  +Q+   LKM+KQE+K+E KQ  G
Sbjct: 440 TGLLSLAISIFFRIT----LIMLFIA---VADYVYQKYQYNKDLKMTKQEVKEEYKQDEG 492

Query: 239 NPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL 298
           +P IK++ K   R     +MM+   +AT+++TNPTH A+ALRY +  + AP +VAKG + 
Sbjct: 493 DPQIKSKIKQKQREMAMQRMMQEVPKATVVVTNPTHIAVALRY-EKGDTAPKVVAKGADY 551

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +A K++ IA  + +P+ E   LAR ++++V I+S +P   Y+AVA+++  +Y  K
Sbjct: 552 VAIKIKDIAKNNEVPVIENKPLARLIYEKVEIDSEVPQDMYEAVAEILAIVYTLK 606


>gi|308187224|ref|YP_003931355.1| Flagellar biosynthetic protein flhB [Pantoea vagans C9-1]
 gi|308057734|gb|ADO09906.1| Flagellar biosynthetic protein flhB [Pantoea vagans C9-1]
          Length = 383

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 112/357 (31%), Positives = 189/357 (52%), Gaps = 15/357 (4%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+ ++KTE+P++ ++E A  EG  P SRE +    +LA ++ L      G   +   L 
Sbjct: 3   EDSDEDKTESPTAHRLEKAREEGQIPRSRELTSLLMLLAGIMILWM----GGNMMAHRLA 58

Query: 64  VLLASA---TQRKLED----ISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIP 116
            ++A+        + D    +SHI  L+T  +L A   ++ GL+L     I + ++    
Sbjct: 59  AMVATGLRFDHGMVRDDKIIVSHIGSLITQ-ALMALLPLMGGLVLV---AIAAPMLLGGL 114

Query: 117 VLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDF 176
           V +   +K   K++S   G KR+++        K  +K ILVG +    +  ++  ML  
Sbjct: 115 VFSGKSIKFDLKKMSPMAGFKRMFAAQAWTELFKGILKTILVGAVGWWYIWSHWPEMLRL 174

Query: 177 ISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQS 236
           IS  P + L H    +     +++L +  +   D+ W  +  + KLKMS QEI+DE KQ 
Sbjct: 175 ISEAPVTALIHGMEMIAVCCSLVMLGLIPMVGYDVFWQLYSHFKKLKMSMQEIRDEHKQQ 234

Query: 237 YGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQ 296
            G+P +K R +   R+  R +MM    +A +I+TNPTHY++AL+Y + +  AP +VAKG 
Sbjct: 235 EGDPHVKGRIRQQMRAAARRRMMADVPKADVIVTNPTHYSVALQYNEKKMSAPKVVAKGA 294

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
             IA ++R++A EH IP+ E P LAR+L++   I   IP   Y AVA+++  ++  +
Sbjct: 295 GEIALRIRELAAEHRIPVLEAPPLARALYRHTEIGQHIPGALYAAVAEVLAWVWQSR 351


>gi|22126401|ref|NP_669824.1| flagellar biosynthesis protein FlhB [Yersinia pestis KIM 10]
 gi|45441419|ref|NP_992958.1| flagellar biosynthesis protein FlhB [Yersinia pestis biovar
           Microtus str. 91001]
 gi|108807160|ref|YP_651076.1| flagellar biosynthesis protein FlhB [Yersinia pestis Antiqua]
 gi|108812495|ref|YP_648262.1| flagellar biosynthesis protein FlhB [Yersinia pestis Nepal516]
 gi|145598622|ref|YP_001162698.1| flagellar biosynthesis protein FlhB [Yersinia pestis Pestoides F]
 gi|149366261|ref|ZP_01888296.1| flagellar biosynthetic protein FlhB [Yersinia pestis CA88-4125]
 gi|165925946|ref|ZP_02221778.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165938738|ref|ZP_02227293.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166010865|ref|ZP_02231763.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166210428|ref|ZP_02236463.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|167401110|ref|ZP_02306613.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|167425790|ref|ZP_02317543.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|170024657|ref|YP_001721162.1| flagellar biosynthesis protein FlhB [Yersinia pseudotuberculosis
           YPIII]
 gi|186895104|ref|YP_001872216.1| flagellar biosynthesis protein FlhB [Yersinia pseudotuberculosis
           PB1/+]
 gi|218928912|ref|YP_002346787.1| flagellar biosynthesis protein FlhB [Yersinia pestis CO92]
 gi|229896231|ref|ZP_04511401.1| flagellar biosynthetic protein FlhB [Yersinia pestis Pestoides A]
 gi|229897166|ref|ZP_04512322.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229897892|ref|ZP_04513043.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229902876|ref|ZP_04517993.1| flagellar biosynthetic protein FlhB [Yersinia pestis Nepal516]
 gi|270486660|ref|ZP_06203734.1| flagellar biosynthetic protein FlhB [Yersinia pestis KIM D27]
 gi|294504041|ref|YP_003568103.1| flagellar biosynthesis protein [Yersinia pestis Z176003]
 gi|21959388|gb|AAM86075.1|AE013854_11 flagellar biosynthesis protein [Yersinia pestis KIM 10]
 gi|45436280|gb|AAS61835.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar
           Microtus str. 91001]
 gi|108776143|gb|ABG18662.1| flagellar biosynthetic protein FlhB [Yersinia pestis Nepal516]
 gi|108779073|gb|ABG13131.1| flagellar biosynthetic protein FlhB [Yersinia pestis Antiqua]
 gi|115347523|emb|CAL20431.1| flagellar biosynthetic protein FlhB [Yersinia pestis CO92]
 gi|145210318|gb|ABP39725.1| flagellar biosynthetic protein FlhB [Yersinia pestis Pestoides F]
 gi|149292674|gb|EDM42748.1| flagellar biosynthetic protein FlhB [Yersinia pestis CA88-4125]
 gi|165913352|gb|EDR31974.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165922150|gb|EDR39327.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165990209|gb|EDR42510.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166207608|gb|EDR52088.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|167049499|gb|EDR60907.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|167055189|gb|EDR64986.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|169751191|gb|ACA68709.1| flagellar biosynthetic protein FlhB [Yersinia pseudotuberculosis
           YPIII]
 gi|186698130|gb|ACC88759.1| flagellar biosynthetic protein FlhB [Yersinia pseudotuberculosis
           PB1/+]
 gi|229680323|gb|EEO76422.1| flagellar biosynthetic protein FlhB [Yersinia pestis Nepal516]
 gi|229688933|gb|EEO80998.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229693503|gb|EEO83552.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229701154|gb|EEO89183.1| flagellar biosynthetic protein FlhB [Yersinia pestis Pestoides A]
 gi|262361772|gb|ACY58493.1| flagellar biosynthesis protein [Yersinia pestis D106004]
 gi|262366091|gb|ACY62648.1| flagellar biosynthesis protein [Yersinia pestis D182038]
 gi|270335164|gb|EFA45941.1| flagellar biosynthetic protein FlhB [Yersinia pestis KIM D27]
 gi|294354500|gb|ADE64841.1| flagellar biosynthesis protein [Yersinia pestis Z176003]
          Length = 386

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 112/362 (30%), Positives = 189/362 (52%), Gaps = 25/362 (6%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+   K+E P++ K+E A  +G  P SRE    +S+L     L   +  G  S+   L 
Sbjct: 3   EDSDQEKSEEPTASKLEKAREKGQIPRSRE---LTSMLMLGAGLTILWMSG-ESMARQLS 58

Query: 64  VLLA----------SATQRKLEDISHIV--FLLTHLSLSASRLVIPGLLLFMMFGIGSYL 111
            ++A          S  ++ L  I  ++   LL  L + A  LVI  L + M+ G G   
Sbjct: 59  AMVAQGLHFDHSMVSNDKQMLRQIGMLLRQTLLAMLPIFAG-LVIVALAVPMLLG-GV-- 114

Query: 112 IQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYF 171
                + +   +K   KR+S   G+KR++S   L   +K+ +K  LVG +  + L  N+ 
Sbjct: 115 -----LFSGESIKFDLKRMSPVAGLKRMFSSQALAELLKAILKATLVGWVTGLFLWHNWP 169

Query: 172 TMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKD 231
            M+  I+A P + L  A   +    ++++L ++ +   D+ +       KL+M+KQ+I+D
Sbjct: 170 DMMRLIAAPPVAALGDALHLIIFCGLVVVLGLSPMVGFDVFYQITSHIKKLRMTKQDIRD 229

Query: 232 EIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVL 291
           E K   G+P +K R +   R+  R +MM    +A +I+TNPTHYA+AL+Y +++  AP +
Sbjct: 230 EFKNQEGDPHVKGRIRQQQRAMARRRMMVDVPKADVIVTNPTHYAVALQYNESKMSAPKV 289

Query: 292 VAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           +AKG   +A ++R++  EH IP+ E P LAR+LF+   +   IP   Y AVA+++  +Y 
Sbjct: 290 LAKGAGAVALRIRELGAEHRIPLLEAPPLARALFRHSEVGQHIPATLYAAVAEVLAWVYQ 349

Query: 352 KK 353
            K
Sbjct: 350 LK 351


>gi|170748648|ref|YP_001754908.1| flagellar biosynthetic protein FlhB [Methylobacterium radiotolerans
           JCM 2831]
 gi|170655170|gb|ACB24225.1| flagellar biosynthetic protein FlhB [Methylobacterium radiotolerans
           JCM 2831]
          Length = 355

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 108/336 (32%), Positives = 180/336 (53%), Gaps = 8/336 (2%)

Query: 14  PSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL---LASAT 70
           PS ++++ A+  G+   S E + F+ +L      L   +P I   T+ LH L   LA+A 
Sbjct: 14  PSQRRLDQAIERGDVATSTEINTFA-MLGAFTLALLVAAPTI--ATNLLHGLKAYLANAH 70

Query: 71  QRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKRV 130
               +  +    +   L L    + +P + L ++ G+ + L+Q   V +   + P F R+
Sbjct: 71  ALPDDAAAMKAAMTRGLWLWLQAVAVP-VGLAVVAGLAAGLLQHPLVFSAETLMPKFSRL 129

Query: 131 SLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAFF 190
           S   G+KR+  +  L  F K   KI  VG +  + L  +   +  F   +P + +     
Sbjct: 130 SPMAGVKRLLGVEALFQFGKGLAKIAAVGVVGAVMLWNDRDRLEVFARLDPAASMPAILS 189

Query: 191 TVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKSIA 250
              K+L  +L     +T+ D  ++  +W  + +MSK+E+K E+K+S GNP +K R K + 
Sbjct: 190 LSLKLLAGMLCMHLAITLGDALYARFRWRKRHRMSKEELKQEMKESEGNPEVKGRLKQLR 249

Query: 251 RSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEH 310
            +R++ +MM A   AT+++TNPTHYA+ALRY +T   APV VAKG + +A ++R +A EH
Sbjct: 250 MARVKKRMMAAVPTATVVVTNPTHYAVALRY-ETGMAAPVCVAKGVDALALRIRAVAAEH 308

Query: 311 NIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
            + + E P LAR+L   V I+  IP   Y+AVA++I
Sbjct: 309 GVAVIENPPLARALHATVEIDREIPAEHYRAVAEVI 344


>gi|220932506|ref|YP_002509414.1| flagellar biosynthetic protein FlhB [Halothermothrix orenii H 168]
 gi|219993816|gb|ACL70419.1| flagellar biosynthetic protein FlhB [Halothermothrix orenii H 168]
          Length = 356

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 104/341 (30%), Positives = 186/341 (54%), Gaps = 1/341 (0%)

Query: 10  KTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLASA 69
           KTE P+ +++  A  +G    S+E S   +++   + L F     IYS+T+ +   L+  
Sbjct: 9   KTEKPTPRRLRKARQQGQVAKSQELSSAFTLMGGFLVLFFIIKNIIYSLTNRMSYFLSLE 68

Query: 70  TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKR 129
              K+ D++ +  L+      A RL+ P LL   + G+    +Q  P+   + +KP  K+
Sbjct: 69  AYNKINDVNSLYILIDSFYFIA-RLISPVLLASAIIGLVVNFLQVGPLFVPDLIKPDLKK 127

Query: 130 VSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAF 189
           ++   G KR++S+ ++V  +KS  KI +V  +  + L  ++ T+++         + +  
Sbjct: 128 INPISGFKRLFSLKSVVELIKSLFKIAIVAILAYLQLKNSWQTLINLSRQGITEAVAYLG 187

Query: 190 FTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKSI 249
             + KV I I++ +  L + D  +   ++   LKM+KQE+K+E K+  G+P IK++++  
Sbjct: 188 HLIFKVAITIIICLVVLGIADYIYQKWEYIRNLKMTKQEVKEEHKEIEGDPRIKSKRREK 247

Query: 250 ARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYE 309
            R    ++M++A   A ++ITNPTH A+AL+Y     +APV+VAKG+  IAKK+++ A E
Sbjct: 248 QREMTLNRMIKAMEEADVVITNPTHIAVALKYDINSMEAPVVVAKGEGFIAKKIKEKARE 307

Query: 310 HNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
             I I E   LAR+L     I   IP   Y+AVA+++  +Y
Sbjct: 308 LKIEIVENKPLARALNATTEIGEEIPVDLYQAVAEVLAFLY 348


>gi|330720472|gb|EGG98776.1| Flagellar biosynthesis protein FlhB [gamma proteobacterium
           IMCC2047]
          Length = 378

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 110/359 (30%), Positives = 191/359 (53%), Gaps = 17/359 (4%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+D+   KTE  + K++EDA  +G+ P S+E +  + +L     LL F       +++
Sbjct: 1   MAESDSGQEKTEEATPKRLEDAKKKGDIPRSKELNTTAILLGGTGALLAFGG----GISA 56

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASR---LVIPGLLLFMMFGIGSYLIQRIPV 117
            L  ++++  +   +DI     +L HL  S +     +IP  ++ M+  I   +     V
Sbjct: 57  GLSNMMSANFRFSRDDIFDPQVMLIHLGQSMAESMMALIPFFIVVMLAAIIGPIALGGWV 116

Query: 118 LNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGT---IITISLTENYFTML 174
           ++   + P  +R+S   GIKR+++   L+  +K+  K +LV T   +I   +T +   + 
Sbjct: 117 MSGKSLAPKGERISPLAGIKRMFAKQALMELLKTIAKFLLVATLSLVILDFMTNDILAIA 176

Query: 175 --DFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDE 232
             D I A  H++    +  +     MIL+     +++D+ +       KLKM+ QE+KDE
Sbjct: 177 KEDTIPAMAHTLRIVGWSVLAMSCTMILI-----SIIDVPFQISSHAKKLKMTMQEVKDE 231

Query: 233 IKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLV 292
           +K + G P +K+R + +     + +MM A   A ++ITNP HYA+AL+Y      AP+LV
Sbjct: 232 MKNTEGKPEVKSRIRQLQYDMAQGRMMSAVPEADVVITNPEHYAVALKYNSDNMGAPLLV 291

Query: 293 AKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           AKG + IA K+R+IA  H+IP+ E P LAR++F    +   IP   Y AVAQ++  ++ 
Sbjct: 292 AKGADHIAFKIREIAKAHDIPVLEAPPLARAVFYSTELEQEIPAGLYVAVAQVLAYVFQ 350


>gi|57168473|ref|ZP_00367607.1| flagellar biosynthetic protein FlhB [Campylobacter coli RM2228]
 gi|305432892|ref|ZP_07402050.1| flagellar biosynthetic protein FlhB [Campylobacter coli JV20]
 gi|57020281|gb|EAL56955.1| flagellar biosynthetic protein FlhB [Campylobacter coli RM2228]
 gi|304444046|gb|EFM36701.1| flagellar biosynthetic protein FlhB [Campylobacter coli JV20]
          Length = 362

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 114/363 (31%), Positives = 198/363 (54%), Gaps = 44/363 (12%)

Query: 10  KTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFS-------------PGIY 56
           KTE P+SKKIEDA  EGN P S++A+   +++   +  LF                    
Sbjct: 8   KTEEPTSKKIEDARKEGNVPKSQDAAAIVTLIVGFVITLFMMGFIGERITNLYRYYQSFI 67

Query: 57  SVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLL-FMMFGIGSYLIQRI 115
            V  DL ++ A      ++ I  ++ LL  + LS   ++I G+L   M FG   ++    
Sbjct: 68  GVEFDLRIIQAIM----IKSIFEVLILLAPIVLS---IMIAGILGNVMQFG---FIFTTK 117

Query: 116 PVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLD 175
           P++      P+  +++  +G+K ++S+  LV  +K  +K   VG + T++    +  +L 
Sbjct: 118 PIM------PNLGKINPLKGLKNLFSLKKLVESVKIVLK---VGVVFTVA----FIVLLK 164

Query: 176 FISANP----HSILYHAFFTVRKVLIMILLFIA---TLTVLDIGWSYHQWYSKLKMSKQE 228
           F+   P    ++I+    +   + +I+  + I     + VLDI     Q++  L+MSKQE
Sbjct: 165 FMQELPLVERYNIIGQLIWLRDRAIILAAIVIIAFLVIAVLDIFLVRFQYFKGLRMSKQE 224

Query: 229 IKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDA 288
           IKDE KQ  G+P +K R + +     R +M++  + A ++ITNPTHYA+A+RY  T+  A
Sbjct: 225 IKDEYKQMEGDPQVKGRIRRLQMEAARRRMVQDVAGADVVITNPTHYAVAIRYDTTKEQA 284

Query: 289 PVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYK 348
           P +VAKG + +A +++++AY++N+ ++E P LAR L+K   IN  IP   +KAVA+++  
Sbjct: 285 PRVVAKGVDFLALRIKQVAYDNNVVVYENPPLARELYKACDINDLIPREMFKAVAEVLGF 344

Query: 349 IYH 351
           +Y+
Sbjct: 345 VYN 347


>gi|218778857|ref|YP_002430175.1| flagellar biosynthetic protein FlhB [Desulfatibacillum alkenivorans
           AK-01]
 gi|218760241|gb|ACL02707.1| Flagellar biosynthetic protein FlhB [Desulfatibacillum alkenivorans
           AK-01]
          Length = 358

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 107/354 (30%), Positives = 194/354 (54%), Gaps = 11/354 (3%)

Query: 5   DAP-DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGI-YSVTSDL 62
           D+P ++KTE P+ KK +DA  +G    SR+ S    ++A L  +++ F P + Y +TS +
Sbjct: 3   DSPNEDKTEQPTPKKRDDARKKGQVAKSRDLSSVVVLMAGL-GIMYMFGPYMHYHITSLM 61

Query: 63  -HVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLN 121
            ++     +   +E+I+ +   +    L    ++ P L    + G  S  +Q     +  
Sbjct: 62  ENIFTTDVSAWGVEEINTLGREMVREFLF---ILAPILAGVFVVGFASAAVQVGFYFSWE 118

Query: 122 HVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANP 181
              P F +++   G  R++S   LV   KS  K+ +VG I  +++      ++     + 
Sbjct: 119 AAAPKFSKINPISGFGRMFSKQALVELAKSLAKLFIVGFISYLTIEAEMDNLILLGQVDA 178

Query: 182 HSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWY--SKLKMSKQEIKDEIKQSYGN 239
            + L +    + K+ I + + +  + VLD  +++ +W+   +LKM+KQE+KDE KQ+ G+
Sbjct: 179 ANTLAYVLKIILKLFIRVGIIMVFVAVLD--FAFQKWHHEQQLKMTKQEVKDEYKQTDGD 236

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLI 299
           P++K R + I     R +MME   +A +++TNPTH ALA++Y      AP++VAKG   I
Sbjct: 237 PMVKARIRRIQMEAARRRMMEEVPKADVVVTNPTHLALAIKYNALTMGAPLIVAKGAGPI 296

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A+K++++A E+++PI E   LAR+L+K V I   +P   Y+AVA+++  +Y  K
Sbjct: 297 AQKIKEVARENDVPIVENKELARALYKVVDIGDEVPVALYEAVAEVLAYVYGLK 350


>gi|300717104|ref|YP_003741907.1| flagellar biosynthesis protein [Erwinia billingiae Eb661]
 gi|299062940|emb|CAX60060.1| Flagellar biosynthesis protein [Erwinia billingiae Eb661]
          Length = 381

 Score =  171 bits (433), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 102/351 (29%), Positives = 191/351 (54%), Gaps = 7/351 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+ + KTE+ +  +IE A  EG  P SRE    +S+L  +  L   +  G  ++   + 
Sbjct: 3   GDSEEEKTESATPHRIEKAREEGQIPRSRE---LTSVLMLVAGLSILWITGA-TMARKIG 58

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            LLA         + D S ++ LL +L       +IP +   ++  I + ++    V++ 
Sbjct: 59  ALLADGLKFNHSVVSDTSQMLHLLGNLVQQGIFTLIPMMAGLVLVAIAAPMLLGGVVISG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K    +++  +GI +++S       +KS +K ILVG +  + +  ++  ML  IS +
Sbjct: 119 KAIKFDVGKMNPIKGIGKLFSGQTAAELLKSVLKAILVGCVTWLYIRHHWPDMLRLISES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P++ L ++   +    ++++  ++ + + D+ W  + ++  L+M++Q+I+DE KQ  G+P
Sbjct: 179 PYNALANSLNMIAMCSVLVVFGLSPMVMFDVFWQLYSYFKGLRMTRQDIRDEYKQQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A +I+TNPTHY++AL+Y + +  AP +VAKG   IA
Sbjct: 239 HVKGRIRQQMRAAARRRMMADVPKADVIVTNPTHYSVALQYDERKMSAPKVVAKGAGEIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            ++R++  EH IPI E P LAR+L++   I   IP   Y AVA+++  ++ 
Sbjct: 299 LRIRELGKEHRIPILEAPPLARALYRHSEIGQHIPGTLYAAVAEVLAWVWQ 349


>gi|146312093|ref|YP_001177167.1| flagellar biosynthesis protein FlhB [Enterobacter sp. 638]
 gi|145318969|gb|ABP61116.1| flagellar biosynthetic protein FlhB [Enterobacter sp. 638]
          Length = 382

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 107/363 (29%), Positives = 196/363 (53%), Gaps = 29/363 (7%)

Query: 5   DAPDNKTEAPSSKKIEDALNEGNAPISRE-ASLFSSILA-CLIY---------LLFFFSP 53
           D  D+KTEAP+  +++ A  +G  P SRE  SL   I+  C+I+         L    S 
Sbjct: 3   DDSDDKTEAPTPHRLDKAREDGQVPRSRELTSLLILIVGVCIIWFGGGAFANRLAGMLSA 62

Query: 54  GI---YSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSY 110
           G+   +S+ +D +++L+         +  ++ L++ + L A  LV P +L  ++F   S 
Sbjct: 63  GLRFDHSIVNDQNLILSQIILLIKNAMIALLPLISGVVLVA--LVSPIMLGGLIFSGKS- 119

Query: 111 LIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENY 170
                       ++P F +++   GI +++S       +K+ +K  L+G+     L  ++
Sbjct: 120 ------------LQPKFSKLNPFPGIAKMFSAQTGAELLKAILKSTLMGSTAGFYLWHHW 167

Query: 171 FTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIK 230
             M+  +S +P + + +A   V    ++++L I  +   D+ +  +    KL+MS+Q+++
Sbjct: 168 PDMMRLLSESPLTAMRNAMDLVGFCAVLVVLSIIPMVGFDVFFQIYSHIKKLRMSRQDLR 227

Query: 231 DEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPV 290
           DE KQ  G+P +K R + + R+  R +MME   +A +I+TNPTHY++AL+Y + +  AP 
Sbjct: 228 DEYKQMEGDPHVKGRIRQMQRAAARRRMMEDVPKADVIVTNPTHYSVALKYDENKMSAPK 287

Query: 291 LVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           +VAKG  LIA ++R+I  E+ +P+ E P LAR+L++   I   IP   Y AVA+++  ++
Sbjct: 288 VVAKGAGLIALRIREIGSENRVPVLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVW 347

Query: 351 HKK 353
             K
Sbjct: 348 QLK 350


>gi|89094442|ref|ZP_01167382.1| flagellar biosynthesis protein [Oceanospirillum sp. MED92]
 gi|89081334|gb|EAR60566.1| flagellar biosynthesis protein [Oceanospirillum sp. MED92]
          Length = 379

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 103/361 (28%), Positives = 187/361 (51%), Gaps = 23/361 (6%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+   KTE P+ K+I +A  +G+ P S+E +    ++A +  ++ F S     +   + 
Sbjct: 3   EDSGQEKTEDPTPKRIREAREKGDVPRSKELATTLVLMAAVFSVIIFSS----QLAESML 58

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLN-- 121
            ++ S      + +     +L H  +SA   ++    +F +  + + L+  I +   N  
Sbjct: 59  GMMESNFVLDRQSVFDTNKMLAHFEVSAEEAIMGLAGIFAVLALAA-LVGPIALGGWNFS 117

Query: 122 --HVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGT---IITISLTENYFTMLDF 176
              + P   R+    GIKR++S+ +L+   K+  K  LVG    +I  ++ E+   +  +
Sbjct: 118 GQSIVPKGSRIDPLAGIKRMFSLKSLIELFKAIAKFSLVGGFAILILWTIREDILALASY 177

Query: 177 IS----ANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDE 232
            +         I+   F  +  VLI++        V+D+ +  + +  K++M+ QE+KDE
Sbjct: 178 EARVAIDEALDIIIWVFMALSAVLILV-------AVVDVPYQLYDYTQKMRMTMQEVKDE 230

Query: 233 IKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLV 292
           +K + G P +K R + + R   + +MM+A   A ++ITNPTHY++AL+Y      APVL+
Sbjct: 231 LKNTEGKPEVKGRIRQLQREIAQRQMMQAVPEADVVITNPTHYSVALKYDGENRGAPVLL 290

Query: 293 AKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
           AKG + +A K+R+IA EH+IPI   P LAR+++    I+  IP   Y AVAQ++  ++  
Sbjct: 291 AKGADFVALKIREIAKEHDIPILSAPPLARAIYNSTEIDDEIPSGLYMAVAQVLAYVFQL 350

Query: 353 K 353
           K
Sbjct: 351 K 351


>gi|153947600|ref|YP_001401303.1| flagellar biosynthesis protein FlhB [Yersinia pseudotuberculosis IP
           31758]
 gi|152959095|gb|ABS46556.1| flagellar biosynthetic protein FlhB [Yersinia pseudotuberculosis IP
           31758]
          Length = 386

 Score =  170 bits (431), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 112/362 (30%), Positives = 188/362 (51%), Gaps = 25/362 (6%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+   K+E P++ K+E A  +G  P SRE    +S+L     L   +  G  S+   L 
Sbjct: 3   EDSDQEKSEEPTASKLEKAREKGQIPRSRE---LTSMLMLGAGLTILWMSG-ESMARQLS 58

Query: 64  VLLA----------SATQRKLEDISHIV--FLLTHLSLSASRLVIPGLLLFMMFGIGSYL 111
            ++A          S  ++ L  I  ++   LL  L + A  LVI  L + M+ G G   
Sbjct: 59  AMVAQGLHFDHSMVSNDKQMLRQIGMLLRQTLLAMLPIFAG-LVIVALAVPMLLG-GV-- 114

Query: 112 IQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYF 171
                + +   +K   KR+S   G+KR++S   L   +K+ +K  LVG +  + L  N+ 
Sbjct: 115 -----LFSGESIKFDLKRMSPIAGLKRMFSSQALAELLKAILKATLVGWVTGLFLWHNWP 169

Query: 172 TMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKD 231
            M+  I+A P + L  A   +    ++++L +  +   D+ +       KL+M+KQ+I+D
Sbjct: 170 DMMRLIAAPPVAALGDALHLIIFCGLVVVLGLLPMVGFDVFYQITSHIKKLRMTKQDIRD 229

Query: 232 EIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVL 291
           E K   G+P +K R +   R+  R +MM    +A +I+TNPTHYA+AL+Y +++  AP +
Sbjct: 230 EFKNQEGDPHVKGRIRQQQRAMARRRMMVDVPKADVIVTNPTHYAVALQYNESKMSAPKV 289

Query: 292 VAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           +AKG   +A ++R++  EH IP+ E P LAR+LF+   +   IP   Y AVA+++  +Y 
Sbjct: 290 LAKGAGAVALRIRELGAEHRIPLLEAPPLARALFRHSEVGQHIPATLYAAVAEVLAWVYQ 349

Query: 352 KK 353
            K
Sbjct: 350 LK 351


>gi|332284010|ref|YP_004415921.1| flagellar biosynthesis protein FlhB [Pusillimonas sp. T7-7]
 gi|330427963|gb|AEC19297.1| flagellar biosynthesis protein FlhB [Pusillimonas sp. T7-7]
          Length = 386

 Score =  170 bits (431), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 107/366 (29%), Positives = 182/366 (49%), Gaps = 32/366 (8%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYS--- 57
           M+E D+   KTE  S +++E A  EG    SRE + F  +LA  +  L+    G+Y    
Sbjct: 1   MAE-DSDLEKTEPASPRRLEKAREEGQVARSRELNTFL-LLAAGVATLWLSGAGLYEGLT 58

Query: 58  ------------VTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMF 105
                       V  D  V++A A    LE I      LT L L     V+  + +    
Sbjct: 59  DILRAGLWFDLRVGRDTDVMVALAATSALEAI------LTLLPLFG---VLVAVAILASV 109

Query: 106 GIGSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITIS 165
            +G +L      L+   ++P F+R++  +G+ R++S   LV  +K+  K  ++G +  + 
Sbjct: 110 ALGGFL------LSGKALEPKFERLNPLKGMGRMFSAQTLVELIKTLAKASVIGIVAVMV 163

Query: 166 LTENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMS 225
           ++     M+  + A     L      V     +I+  +  + ++D  W  +  Y K++MS
Sbjct: 164 MSHYLDQMISLMHATVSEALTRGIGLVALCCALIVGGLILIVLIDAPWQIYSHYKKMRMS 223

Query: 226 KQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTE 285
           ++++K E K+S G+P +K R +   R+  R +MM     A +I+TNPTHYA+AL Y   +
Sbjct: 224 REDVKQEHKESDGDPHVKGRIRQQQRAMARRRMMSEVPNADVIVTNPTHYAVALSYKDGQ 283

Query: 286 NDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQL 345
             AP +VAKG  L+A ++R++A EH +P+   P LAR+L   V +   IP   Y AVA++
Sbjct: 284 AGAPRVVAKGSGLVAARIREVAQEHKVPMLSAPPLARALHHHVELGKEIPGDLYAAVAEV 343

Query: 346 IYKIYH 351
           +  ++ 
Sbjct: 344 LAWVFQ 349


>gi|315638787|ref|ZP_07893959.1| flagellar biosynthetic protein FlhB [Campylobacter upsaliensis
           JV21]
 gi|315481005|gb|EFU71637.1| flagellar biosynthetic protein FlhB [Campylobacter upsaliensis
           JV21]
          Length = 356

 Score =  170 bits (430), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 114/364 (31%), Positives = 192/364 (52%), Gaps = 44/364 (12%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYL-------------LFFFSPGI 55
            KTE P+SKKIEDA  EGN P S++A+   +++  +  L             L+ +    
Sbjct: 7   EKTEEPTSKKIEDARQEGNVPKSQDAAAVVTLIVAITLLLFLLGFMGERVANLYRYYQSF 66

Query: 56  YSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRI 115
             V  DL ++ A      ++ I  ++ +L  + LS            M+ GI   ++Q  
Sbjct: 67  IGVEFDLRIIQAIM----MKSIFEVLIILAPIVLS-----------IMVAGIIGNVMQFG 111

Query: 116 PVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIIL-VGTIITISLTENYFTML 174
            +     + P+  +++  +G+K ++S+  L+      VKIIL VG + TI+    +  +L
Sbjct: 112 FIFTTKPIMPNLSKINPLKGLKNLFSLKKLI----ESVKIILKVGVVFTIA----FIVLL 163

Query: 175 DFISANPHSILY----HAFFTVRKVLIMILLFIATLTV---LDIGWSYHQWYSKLKMSKQ 227
            F+   P   LY       +   K LI+  + I    +   LD+     Q++  LKMSKQ
Sbjct: 164 QFVKELPKVELYSLAAQMVWLRDKALILAAIVIIAFLIIAILDVFLVRFQYFQGLKMSKQ 223

Query: 228 EIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEND 287
           EIKDE KQ  G+P +K R + +     R +M++  + A ++ITNPTHYA+ALRY  T+ +
Sbjct: 224 EIKDEYKQMEGDPQVKGRIRRLQMEAARRRMVQDVAGADVVITNPTHYAVALRYDTTKEN 283

Query: 288 APVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIY 347
           AP +VAKG + +A +++++AY+HN+ ++E P LAR L+K   ++  IP   +KAV+++  
Sbjct: 284 APRVVAKGVDFLALRIKEMAYKHNVIVYENPPLARQLYKDCDLDQLIPRELFKAVSEVFK 343

Query: 348 KIYH 351
            +Y 
Sbjct: 344 FVYQ 347


>gi|251772429|gb|EES52996.1| flagellar biosynthetic protein FlhB [Leptospirillum
           ferrodiazotrophum]
          Length = 365

 Score =  170 bits (430), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 110/354 (31%), Positives = 191/354 (53%), Gaps = 8/354 (2%)

Query: 2   SENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSD 61
           +END    + E P+S+++E A  EG    SRE   F  + A LI +  + S  +  +  D
Sbjct: 4   NENDG-QLRQEEPTSRRLEKAREEGQVARSREVGYFFFLAASLILMASYGSRLVEGLRDD 62

Query: 62  LHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLN 121
           +   L  + +  L     I   +  L L       P L  F++FG+ +Y++Q   +++  
Sbjct: 63  MSYYLRHSGEISLTP-DGITPFVKGLVLHEMGRTFPLLGGFLVFGVAAYIVQGGILVSPK 121

Query: 122 HVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANP 181
                + RVS  +GIKR++S   L   ++  +K+++   I+  +L +++ T+   +    
Sbjct: 122 AAAIKWNRVSPSQGIKRLFSWRALEELLRYTIKVVVSLLILFYALKQDWMTLPALMETGA 181

Query: 182 HSI---LYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYG 238
           H +   LYH  F V   L+  L   A L + D  +        L+M++ EIK+E K++ G
Sbjct: 182 HRMVGALYHFTFVV---LVSFLPLYAALAIGDYLFQRFMMMRGLRMTRTEIKEETKETEG 238

Query: 239 NPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL 298
           +P ++ R +SI R+  R +MM     AT++ITNPTH+A+ L+Y      APV+VAKG + 
Sbjct: 239 DPHVRARIRSIQRAMARRRMMSKIKDATVVITNPTHFAVVLKYHPESMAAPVVVAKGADE 298

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
           +A ++R+IA E  +P+ E+P  AR LF++ P++  IP  FY+AVA+++  +Y +
Sbjct: 299 VAFRIREIAREVGVPVVEDPPTARGLFRECPLDREIPFTFYEAVARILSILYQR 352


>gi|307731376|ref|YP_003908600.1| flagellar biosynthetic protein FlhB [Burkholderia sp. CCGE1003]
 gi|307585911|gb|ADN59309.1| flagellar biosynthetic protein FlhB [Burkholderia sp. CCGE1003]
          Length = 401

 Score =  170 bits (430), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 106/366 (28%), Positives = 185/366 (50%), Gaps = 47/366 (12%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE+ + +++E A  EG    SRE S F+     L+   FF   G+++++  +      
Sbjct: 8   EKTESATPRRLEKAREEGQIARSRELSTFA-----LLAAGFF---GVWAMSGSIG----- 54

Query: 69  ATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSY----LIQRIPV------- 117
              + L+D+    F   H ++  +R         MM G G+     L   +P+       
Sbjct: 55  ---QHLQDMLRTAFTFDHATVFETRR--------MMTGAGTASREGLYALLPILALTGAA 103

Query: 118 ------------LNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITIS 165
                       L+   ++P F R++   G+ +I+SIN  V  + S  K ++VG I   +
Sbjct: 104 ALLAPMALGGWQLSTKGLEPKFDRLNPIAGLGKIFSINGPVQLVMSIAKTLVVGIIGGTA 163

Query: 166 LTENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMS 225
           +      +L   +   H  L +    +     M +  +  +  LD+ +   Q++ KL+MS
Sbjct: 164 IWNRREEILALSTQPLHLALANTVHLIAVCCAMTVAGMFVVAALDVPYQLWQFHKKLRMS 223

Query: 226 KQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTE 285
           K+E+K E ++S G+P +K R +   R+  R +MM    +A +++TNPTH+A+AL+Y   E
Sbjct: 224 KEEVKREHRESEGDPHVKGRIRQQQRAIARRRMMTQVPKADVVVTNPTHFAVALQYTDGE 283

Query: 286 NDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQL 345
             AP +VAKG NL+A ++R++A E+N+P+ E P LAR+L+  V +N  IP   Y AVA++
Sbjct: 284 MRAPKVVAKGVNLVAARIRELAAENNVPLLEAPPLARALYHNVELNREIPGQLYGAVAEV 343

Query: 346 IYKIYH 351
           +  +Y 
Sbjct: 344 LAWVYQ 349


>gi|317403765|gb|EFV84247.1| flagellar biosynthetic protein FlhB [Achromobacter xylosoxidans
           C54]
          Length = 384

 Score =  170 bits (430), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 112/345 (32%), Positives = 182/345 (52%), Gaps = 5/345 (1%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTEA S +++E A  EG    SRE   F  +LA  +  ++     IY   S +     +
Sbjct: 8   EKTEAASPRRLEKAREEGQIARSRELGTFM-MLAVGVGAIWAGGGTIYKGLSGVLRNGLA 66

Query: 69  ATQRKLEDISHIVFLLTHLSLSASRLVIP--GLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
             QR + D   +V    +    A  +++P  GLL  +   + S L+  I V++   + P+
Sbjct: 67  FDQRVVADPGVMVEQAVNGFGHALMVILPIFGLLAVIAV-LSSVLLGGI-VISGKPLSPN 124

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
           F ++SL  G+KR++S   +V  +K+  K +LVG +    L   +  ML  +   P + L 
Sbjct: 125 FSKLSLFAGLKRMFSAQTVVELIKALAKAMLVGGVAVWILWRYHDDMLGLMHVAPSAALT 184

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
            A   V      I+  +  + +LD+ W       KL+MSK++++ E K+S G+P  K R 
Sbjct: 185 KALSLVAMCCAFIVASLLVIVLLDVPWQIWSHLKKLRMSKEDVRQEHKESEGDPHTKARI 244

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           +   R   R +MM    +A +++TNPTHYA+AL+Y + +N AP ++AKG  LIA K+R++
Sbjct: 245 RQQQRQAARRRMMSEVPKADVVVTNPTHYAVALKYEEDKNGAPRVLAKGTGLIAAKIREL 304

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           A EH IP  E P LAR+L + V +   IP   Y AVA+++  ++ 
Sbjct: 305 AAEHRIPTLEAPPLARALHQHVELGQEIPAELYTAVAEVLAWVFQ 349


>gi|52842013|ref|YP_095812.1| flagellar biosynthesis protein FlhB [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52629124|gb|AAU27865.1| flagellar biosynthetic protein FlhB [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 383

 Score =  169 bits (429), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 103/358 (28%), Positives = 191/358 (53%), Gaps = 15/358 (4%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++ +    KTE PSSK+++++  +G    S++   F++ +     +L F   G +    
Sbjct: 2   MADEEQSQEKTEQPSSKRLKESRKKGQVARSKD---FNATV-----ILLFTGLGFFIFGK 53

Query: 61  DLHVLLASATQRKLEDISHIVFL-------LTHLSLSASRLVIPGLLLFMMFGIGSYLIQ 113
            L + +AS  Q+  +    I+         L  L+ S    V+P LL+  +  + + L+ 
Sbjct: 54  QLSLQIASIMQQAFDFDRDILVTGNNSLENLFQLTKSGLWSVVPLLLVIFILSLLAPLLM 113

Query: 114 RIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTM 173
              V +   ++P F R+++ +G+KR+ S+   V  +K+F+K +LV +   + L      +
Sbjct: 114 GGWVFSGQSIQPKFSRLNVLKGLKRMISLKGFVEMLKAFLKFVLVASASILVLRSQVPLL 173

Query: 174 LDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEI 233
           L+   A     +      + K  ++I   +  +  +D+ +  ++    +KM+KQE+KDE 
Sbjct: 174 LELGKAPLEIAITSGVMILLKSFVLISASLILIAAIDVPFQLYEHSKSIKMTKQELKDEY 233

Query: 234 KQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVA 293
           K++ G P +K+  +   +   R +MM    +A +I+TNPTHYA+AL Y +    APV++A
Sbjct: 234 KETEGKPEVKSAIRRAQQETARRRMMSEVPKADVILTNPTHYAVALSYQKKGKKAPVVIA 293

Query: 294 KGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           KG+NL+A ++ K+A EH IPI   P+LAR+++    +N+ IP   Y AVAQ++  I+ 
Sbjct: 294 KGKNLVAFQISKVAKEHKIPIISVPALARAIYFSTKLNAEIPRGLYVAVAQVLAYIFQ 351


>gi|148359330|ref|YP_001250537.1| hypothetical protein LPC_1227 [Legionella pneumophila str. Corby]
 gi|296107377|ref|YP_003619077.1| flagellar biosynthetic protein FlhB [Legionella pneumophila 2300/99
           Alcoy]
 gi|148281103|gb|ABQ55191.1| hypothetical protein LPC_1227 [Legionella pneumophila str. Corby]
 gi|295649278|gb|ADG25125.1| flagellar biosynthetic protein FlhB [Legionella pneumophila 2300/99
           Alcoy]
          Length = 382

 Score =  169 bits (429), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 103/358 (28%), Positives = 191/358 (53%), Gaps = 15/358 (4%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++ +    KTE PSSK+++++  +G    S++   F++ +     +L F   G +    
Sbjct: 1   MADEEQSQEKTEQPSSKRLKESRKKGQVARSKD---FNATV-----ILLFTGLGFFIFGK 52

Query: 61  DLHVLLASATQRKLEDISHIVFL-------LTHLSLSASRLVIPGLLLFMMFGIGSYLIQ 113
            L + +AS  Q+  +    I+         L  L+ S    V+P LL+  +  + + L+ 
Sbjct: 53  QLSLQIASIMQQAFDFDRDILVTGNNSLENLFQLTKSGLWSVVPLLLVIFILSLLAPLLM 112

Query: 114 RIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTM 173
              V +   ++P F R+++ +G+KR+ S+   V  +K+F+K +LV +   + L      +
Sbjct: 113 GGWVFSGQSIQPKFSRLNVLKGLKRMISLKGFVEMLKAFLKFVLVASASILVLRSQVPLL 172

Query: 174 LDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEI 233
           L+   A     +      + K  ++I   +  +  +D+ +  ++    +KM+KQE+KDE 
Sbjct: 173 LELGKAPLEIAITSGVMILLKSFVLISASLILIAAIDVPFQLYEHSKSIKMTKQELKDEY 232

Query: 234 KQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVA 293
           K++ G P +K+  +   +   R +MM    +A +I+TNPTHYA+AL Y +    APV++A
Sbjct: 233 KETEGKPEVKSAIRRAQQETARRRMMSEVPKADVILTNPTHYAVALSYQKKGKKAPVVIA 292

Query: 294 KGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           KG+NL+A ++ K+A EH IPI   P+LAR+++    +N+ IP   Y AVAQ++  I+ 
Sbjct: 293 KGKNLVAFQISKVAKEHKIPIISVPALARAIYFSTKLNAEIPRGLYVAVAQVLAYIFQ 350


>gi|311068160|ref|YP_003973083.1| flagellar biosynthesis protein FlhB [Bacillus atrophaeus 1942]
 gi|310868677|gb|ADP32152.1| flagellar biosynthesis protein FlhB [Bacillus atrophaeus 1942]
          Length = 360

 Score =  169 bits (429), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 116/351 (33%), Positives = 196/351 (55%), Gaps = 13/351 (3%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIY---SVTSDLHVL 65
            KTE  + KK +D   +G   +++ A + +++ + L+  L F + G Y    + S L   
Sbjct: 13  EKTEKATPKKRQDTRKKGQ--VAKSADVNTAV-SLLVVFLSFIAIGPYMRDRLLSFLETF 69

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
              +   KL  +S++  L   L      ++ P +L+ ++ G+ S  +Q   + +   +KP
Sbjct: 70  YTESLTMKLS-MSNVHTLFIDLLKDTGIILAPIMLVALIAGVISNYMQVGILFSAEVIKP 128

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
             K++S  +G KRIYS+  +V  +KS +KI +VG    + L  +Y  +L      P  +L
Sbjct: 129 DLKKLSPLKGFKRIYSMRAIVELLKSILKIAVVGFAAFLVLWTHYGEILRLPLLTPEEVL 188

Query: 186 YHAFFTVRKVLIMILLFIATLTVL-DIGWSYHQW-YSK-LKMSKQEIKDEIKQSYGNPII 242
               F  +  L M L     L VL  + + Y ++ Y K ++MSKQ+IKDE K+S G+PII
Sbjct: 189 S---FVSKLTLWMGLSGAGALMVLAGLDYLYQKFDYEKNIRMSKQDIKDEYKKSEGDPII 245

Query: 243 KNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKK 302
           K++ K   R     +MM+   +A +IITNPTHYA+AL+Y + + DAP ++AKG + +A K
Sbjct: 246 KSKIKQRQREMAMRRMMQEVPKADVIITNPTHYAIALKYDEHKMDAPYIIAKGVDHLALK 305

Query: 303 MRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +++IA EH++   E   LAR+L+ QV I+ A+P  F+K +A+++  +Y  K
Sbjct: 306 IKQIAKEHDVMTVENRPLARALYDQVEIDQAVPEEFFKVIAEILAYVYKTK 356


>gi|329897646|ref|ZP_08272170.1| Flagellar biosynthesis protein FlhB [gamma proteobacterium
           IMCC3088]
 gi|328921095|gb|EGG28504.1| Flagellar biosynthesis protein FlhB [gamma proteobacterium
           IMCC3088]
          Length = 383

 Score =  169 bits (429), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 111/366 (30%), Positives = 190/366 (51%), Gaps = 31/366 (8%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+END+   KTE P++K+I+ + ++G    S+E S+ ++++    ++  F    I  ++ 
Sbjct: 1   MAENDSTQEKTEEPTNKRIQKSRDDGQVARSQELSIAATVITVAGFMYLFGGAMIIKISE 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
                        + D  H VF ++ L+    + ++  LL+    G  ++++  +    L
Sbjct: 61  QFAAAF-------VFDPKH-VFDVSGLTSRVGKGLMDALLVVAPLGAAAFVVSFLVSGVL 112

Query: 121 NHVKPSFKRVSLR-------EGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTM 173
                S+K ++ +        G+KR++ +  + +F K+  K +LVG + T  L +NY   
Sbjct: 113 GGYNFSWKAIAPKASKLNPLSGLKRMFGMKVVFDFFKTIGKFLLVGGL-TYLLVDNYVGQ 171

Query: 174 LDFIS--------ANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMS 225
           L F S        A   SI+  +F      LI+I +       +D  +   ++  KLKM+
Sbjct: 172 LMFTSLMNFEGGLALGGSIIVFSFLVATLALIIIAM-------IDAPYQLQEYNKKLKMT 224

Query: 226 KQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTE 285
           KQE+K+E K + G P +K R +   R     +M+EA + A ++ITNP H+A+AL Y  T 
Sbjct: 225 KQEVKEEAKDTDGRPEVKQRIRQKQRELASMRMLEAIADADVVITNPEHFAVALAYDPTG 284

Query: 286 NDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQL 345
           +  P LVAKG + IA+K+R+ A E  +P+F  P LARSLF    +N  IP   Y+AVAQ+
Sbjct: 285 DLPPKLVAKGSDFIAEKIRERAKEEGVPLFTSPILARSLFFTTDLNGYIPEPLYEAVAQV 344

Query: 346 IYKIYH 351
           I  I++
Sbjct: 345 IAFIFN 350


>gi|302874605|ref|YP_003843238.1| flagellar biosynthetic protein FlhB [Clostridium cellulovorans
           743B]
 gi|307690784|ref|ZP_07633230.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           cellulovorans 743B]
 gi|302577462|gb|ADL51474.1| flagellar biosynthetic protein FlhB [Clostridium cellulovorans
           743B]
          Length = 607

 Score =  169 bits (429), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 103/346 (29%), Positives = 194/346 (56%), Gaps = 2/346 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
           D K+E  +SKK+ DA  +G    S++  L  + LA    L    +  I  +++ +    +
Sbjct: 262 DEKSEEATSKKLADAKKKGQIARSKDLGLGITFLATAFGLAALGNMFIDRMSNIIMKFFS 321

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
                  ED   ++ +L    +  + L++P   + M+ G+ + L Q   +     +KP  
Sbjct: 322 VTNGNLTED--GLIEILKIAMIDGAILILPIAFIVMVTGVAASLAQTGFMNTSEPLKPDL 379

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
           K+++  +G KRI+S+ ++V+ +K+   II+VG +    ++++   ++  I+    +ILY 
Sbjct: 380 KKINPVDGFKRIFSMRSVVDLLKNVTIIIIVGYVGYKLVSDDIVDIMLLINLKEGAILYE 439

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
               V  +L+ I L ++ + + D  +   ++  +++M+KQE+K+E KQ  G+P IK ++K
Sbjct: 440 LKKIVTSILLKIALILSVIGIADYMYQKKKFLKEMRMTKQEVKEEYKQMEGDPEIKAKRK 499

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              +   R +MM A   AT+++TNPTH+A+AL+Y +    AP++VAKG + IA K+++IA
Sbjct: 500 QKMKELSRARMMAAVPNATVVVTNPTHFAVALKYEEGSAGAPMVVAKGTDNIAFKIKEIA 559

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            E+ +PI E   LAR ++K+V I+  IP   Y+AVA+++  +   K
Sbjct: 560 KENKVPIIENKPLARLIYKEVDIDEEIPIDMYQAVAEILAMVLKMK 605


>gi|83647843|ref|YP_436278.1| flagellar biosynthesis protein FlhB [Hahella chejuensis KCTC 2396]
 gi|83635886|gb|ABC31853.1| Flagellar biosynthesis pathway, component FlhB [Hahella chejuensis
           KCTC 2396]
          Length = 378

 Score =  169 bits (429), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 107/359 (29%), Positives = 189/359 (52%), Gaps = 17/359 (4%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+END    KTE P+ +KIE A  EG  P SRE +  + +LA  + LL F +    ++  
Sbjct: 1   MAENDTSQEKTEEPTPRKIEKAREEGQIPRSRELNTTAVLLAGAVGLLVFGT----TIGK 56

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIP---- 116
            L  +  ++     E++      + HL ++A  + I  L+ FM+  + + L+  I     
Sbjct: 57  ALEGVFRASFTLTREEVFDAHQPMIHLGMAALDMAI-SLVPFMLVLLVASLLGPIALGGW 115

Query: 117 VLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDF 176
           +++     P F R++  EG+KR++S+ +L+   K   K ++VG +  I L  +   +L  
Sbjct: 116 MMSAKAAAPKFSRINPLEGLKRMFSLKSLMELFKGVAKTLVVGGVALIILNYSIPDLLAM 175

Query: 177 ISANPHSILYHAFFTVRKVLIMILLFIAT----LTVLDIGWSYHQWYSKLKMSKQEIKDE 232
            S +    + HA      +L    LF+A+    + ++D+ +  +     L+M+ QEIKDE
Sbjct: 176 GSEDTMVSMAHAC----SLLAWSFLFLASSMILIALVDVPFQIYDNQKNLRMTMQEIKDE 231

Query: 233 IKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLV 292
            K + G P +K R + +     R +M++   +A ++ITNPTHY++AL+Y   +  AP+++
Sbjct: 232 YKDTEGKPEVKRRVREVQYEMSRRRMLQDVPKADVVITNPTHYSVALKYDAKKMAAPIVL 291

Query: 293 AKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           AKG + +A K+R+IA  H I +   P L RS++    +   IP   Y AVAQ++  ++ 
Sbjct: 292 AKGADHMAMKIREIANAHKIELVSAPPLTRSIYHHTEVGEEIPSGLYLAVAQVLAYVFQ 350


>gi|317492437|ref|ZP_07950866.1| flagellar biosynthetic protein FlhB [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316919776|gb|EFV41106.1| flagellar biosynthetic protein FlhB [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 383

 Score =  169 bits (429), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 113/358 (31%), Positives = 186/358 (51%), Gaps = 12/358 (3%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE D+   KTE P+S K+E A  +G  P SRE +    + A +  LL     G   +  
Sbjct: 1   MSE-DSDLEKTEDPTSHKLEKAREKGQVPRSRELTSMLMLAAGISILLI----GGEHLAR 55

Query: 61  DLHVLLASATQRK---LEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPV 117
            L  +++   Q     + +   ++  L +L   A   ++P LL  M+ G  + ++     
Sbjct: 56  QLAAMISQGLQFDQLLISNDKQMLRQLGNLLQQAVAALMPVLLGLMLVGWAAPMLIGGFF 115

Query: 118 LNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFI 177
            N   +K    ++SL  G+KR++S   L   +K  +K+ILV  +    L   +  ML  I
Sbjct: 116 FNPGSIKFDLSKMSLLSGLKRLFSSQALAELLKGVLKVILVSWVAGWFLWHYWGQMLALI 175

Query: 178 SANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQW--YSKLKMSKQEIKDEIKQ 235
           + +P   +  A   +    ++I+L +  +   D+   Y  W   +KLKM+KQEIKDE K+
Sbjct: 176 AESPLDAMGDALHLIGMCGLLIVLGLVPMVAFDV--FYQIWSNLNKLKMTKQEIKDEFKE 233

Query: 236 SYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKG 295
             G+P +K R +   R+  R +MM    +A +I+TNPTHYA+AL+Y + +  AP ++AKG
Sbjct: 234 QEGDPHVKGRIRQQQRAAARRRMMSDVPKADVIVTNPTHYAVALQYQENKMSAPKVLAKG 293

Query: 296 QNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
              IA +++++  +H IP  E P LAR+L++   I   IP   Y AVA+++  +Y  K
Sbjct: 294 AGEIALRIKELGNQHRIPQLEAPPLARALYRHSEIGHHIPATLYAAVAEVLAWVYQLK 351


>gi|258514018|ref|YP_003190240.1| flagellar biosynthetic protein FlhB [Desulfotomaculum acetoxidans
           DSM 771]
 gi|257777723|gb|ACV61617.1| flagellar biosynthetic protein FlhB [Desulfotomaculum acetoxidans
           DSM 771]
          Length = 354

 Score =  169 bits (429), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 108/359 (30%), Positives = 204/359 (56%), Gaps = 21/359 (5%)

Query: 5   DAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFF--SPGIYSVTSDL 62
                KTE  + +K+  A  +G   +++ + L +++L   + LLF+      + S+    
Sbjct: 3   QGGQEKTEKATPRKLLQARRKGQ--VAKSSDLNAAVLMLAVVLLFYSIKQQQLSSMYKYF 60

Query: 63  HVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNH 122
              LA+ TQ +   +S ++ L+   S+   +L+ P L++ ++  +    +Q   V +   
Sbjct: 61  SWYLANFTQYRESQVS-LMQLMVSFSIYYIKLMAPVLIVVVIVALLINFMQVGLVFSSES 119

Query: 123 VKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPH 182
           +KP  KR +  EG KRI+++ +LV   K+  K++++G I    ++  +  +L    A P 
Sbjct: 120 IKPQLKRANPIEGFKRIFTVRSLVELAKNIFKLLVIGGITYNLISGRFNELLLIFYATPA 179

Query: 183 SILYHAFFTVRKVLIMILLFIA----TLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYG 238
            I    F TV   ++ IL +       + +LD  +  +++   ++MSKQ+IKDE KQ+ G
Sbjct: 180 MI----FQTVSGFILRILGWGGIVYFAMALLDYLYQRYEFQKSMRMSKQDIKDEYKQTEG 235

Query: 239 NPIIKNR----QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAK 294
           +P++K++    Q+ ++ SRIR +M     RAT+++TNPTH+A+ALRY + + D P++ AK
Sbjct: 236 DPLLKSKLREMQRKMSLSRIREEM----PRATVVVTNPTHFAVALRYSEGDADVPLVTAK 291

Query: 295 GQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           G + +A +MR++A E+N+P+ E+  LAR L+ +V + + IP   Y++VA+++  +Y KK
Sbjct: 292 GADYLALRMREMAKEYNVPVIEQRELARLLYDRVEVGTEIPYELYQSVAEILAMVYKKK 350


>gi|54297699|ref|YP_124068.1| flagellar biosynthesis protein FlhB [Legionella pneumophila str.
           Paris]
 gi|53751484|emb|CAH12902.1| Flagellar biosynthetic protein FlhB [Legionella pneumophila str.
           Paris]
          Length = 382

 Score =  169 bits (428), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 103/358 (28%), Positives = 190/358 (53%), Gaps = 15/358 (4%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++ +    KTE PSSK+++++  +G    S++   F++ +     +L F   G +    
Sbjct: 1   MADEEQSQEKTEQPSSKRLKESRKKGQVARSKD---FNATV-----ILLFTGLGFFIFGK 52

Query: 61  DLHVLLASATQRKLEDISHIVFL-------LTHLSLSASRLVIPGLLLFMMFGIGSYLIQ 113
            L + +AS  Q+  +    I+         L  L+ S    V+P LL+  +  + + L+ 
Sbjct: 53  QLSLQIASIMQQAFDFDRDILVTGNNSLENLFQLTKSGLWSVVPLLLVIFILSLLAPLLM 112

Query: 114 RIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTM 173
              V +   ++P F R+++ +G KR+ S+   V  +K+F+K +LV +   + L      +
Sbjct: 113 GGWVFSGQSIQPKFSRLNVLKGFKRMISLKGFVEMLKAFLKFVLVASASILVLRSQVPLL 172

Query: 174 LDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEI 233
           L+   A     +      + K  ++I   +  +  +D+ +  ++    +KM+KQE+KDE 
Sbjct: 173 LELGKAPLEIAITSGVMILLKSFVLISASLILIAAIDVPFQLYEHSKSIKMTKQELKDEY 232

Query: 234 KQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVA 293
           K++ G P +K+  +   +   R +MM    +A +I+TNPTHYA+AL Y +    APV++A
Sbjct: 233 KETEGKPEVKSAIRRAQQETARRRMMSEVPKADVILTNPTHYAVALSYQKKGKKAPVVIA 292

Query: 294 KGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           KG+NL+A ++ K+A EH IPI   P+LAR+++    +N+ IP   Y AVAQ++  I+ 
Sbjct: 293 KGKNLVAFQISKVAKEHKIPIISVPALARAIYFSTKLNAEIPRGLYVAVAQVLAYIFQ 350


>gi|169827139|ref|YP_001697297.1| flagellar biosynthesis protein FlhB [Lysinibacillus sphaericus
           C3-41]
 gi|168991627|gb|ACA39167.1| Flagellar biosynthetic protein [Lysinibacillus sphaericus C3-41]
          Length = 362

 Score =  169 bits (428), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 111/354 (31%), Positives = 193/354 (54%), Gaps = 18/354 (5%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE  + KK +DA  +G    S++ +  S+I+  ++++  FF  G  S+  +L      
Sbjct: 15  EKTEKATPKKRQDARKKGQVVKSQDVT--SAIVMLMVFIFLFFFAG--SLRDELLAFFRQ 70

Query: 69  ATQRKLE----DISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVK 124
                +      I  ++ L     +  + +++P + + ++  +    +Q   +  L  +K
Sbjct: 71  TFIHNIRIETLTIDSVMHLFIDTLIQMAFIIVPIMAIAVVGALAGNFLQFGFLFTLEPMK 130

Query: 125 PSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSI 184
              K++   +G+KRI+S+  +V  +KS +KI  +G++ TI +  N   +L     +P   
Sbjct: 131 FDLKKMDPIKGLKRIFSVKAIVELLKSVLKIGFIGSVTTIIIWTNLPEVLALSFKSP--- 187

Query: 185 LYHAFFTVRKVLIMILLFIATLTVLDIG---WSYHQW-YSK-LKMSKQEIKDEIKQSYGN 239
            +    TV K L+ I+   A+L +L +    W Y ++ Y K LKMSKQ+IKDE K S G+
Sbjct: 188 -WITLITVGK-LVGIMGIAASLVLLCVSILDWLYQKFDYEKNLKMSKQDIKDEYKNSEGD 245

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLI 299
           P+IK++ K   R     +MM     A ++ITNPTHYA+AL+Y +   DAP ++AKG + I
Sbjct: 246 PLIKSKIKQRQREMAMRRMMSEIPSADVVITNPTHYAIALKYDEESMDAPRVIAKGTDFI 305

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A+K++ IA EH++ + E   LAR+++ QV I   +P  F+KAVA+++  +Y  K
Sbjct: 306 AQKIKLIAKEHDVIMVENRPLARAMYDQVEIGDPVPEEFFKAVAEILAYVYRIK 359


>gi|54294673|ref|YP_127088.1| flagellar biosynthesis protein FlhB [Legionella pneumophila str.
           Lens]
 gi|53754505|emb|CAH15989.1| Flagellar biosynthetic protein FlhB [Legionella pneumophila str.
           Lens]
          Length = 382

 Score =  169 bits (428), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 103/358 (28%), Positives = 190/358 (53%), Gaps = 15/358 (4%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++ +    KTE PSSK+++++  +G    S++   F++ +     +L F   G +    
Sbjct: 1   MADEEQSQEKTEQPSSKRLKESRKKGQVARSKD---FNATV-----ILLFTGLGFFIFGK 52

Query: 61  DLHVLLASATQRKLEDISHIVFL-------LTHLSLSASRLVIPGLLLFMMFGIGSYLIQ 113
            L + +AS  Q+  +    I+         L  L+ S    V+P LL+  +  + + L+ 
Sbjct: 53  QLSLQIASIMQQAFDFDRDILVTGNNSLENLFQLTKSGLWSVVPLLLVIFILSLLAPLLM 112

Query: 114 RIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTM 173
              V +   ++P F R+++ +G KR+ S+   V  +K+F+K +LV +   + L      +
Sbjct: 113 GGWVFSGQSIQPKFSRLNVLKGFKRMISLKGFVEMLKAFLKFVLVASASILVLRSQVPLL 172

Query: 174 LDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEI 233
           L+   A     +      + K  ++I   +  +  +D+ +  ++    +KM+KQE+KDE 
Sbjct: 173 LELGKAPLEIAITSGVMILLKSFVLISASLILIAAIDVPFQLYEHSKSIKMTKQELKDEY 232

Query: 234 KQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVA 293
           K++ G P +K+  +   +   R +MM    +A +I+TNPTHYA+AL Y +    APV++A
Sbjct: 233 KETEGKPEVKSAIRRAQQEAARRRMMSEVPKADVILTNPTHYAVALSYQKKGKKAPVVIA 292

Query: 294 KGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           KG+NL+A ++ K+A EH IPI   P+LAR+++    +N+ IP   Y AVAQ++  I+ 
Sbjct: 293 KGKNLVAFQISKVAKEHKIPIISVPALARAIYFSTKLNAEIPRGLYVAVAQVLAYIFQ 350


>gi|329904716|ref|ZP_08273917.1| Flagellar biosynthesis protein FlhB [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327547860|gb|EGF32618.1| Flagellar biosynthesis protein FlhB [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 379

 Score =  169 bits (428), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 109/361 (30%), Positives = 182/361 (50%), Gaps = 33/361 (9%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIY----SVTSDLHV 64
            KTE  S ++I+ A   G+ P SRE      +  CL+  L     G+Y    ++   L  
Sbjct: 8   EKTEPASQQRIDKARENGDVPRSRE------LATCLV--LLAAGGGLYISGANMLRQLKA 59

Query: 65  LLASATQRKLEDISHIVFLLTHLSLSASRLVIP-----GLLLFMMFG----IGSYLIQRI 115
            LAS              LL+ L      L++      G+L+ +       IG +L    
Sbjct: 60  ALASGLTFDRGQAFDFSLLLSRLGSHLGDLLLAFAPLAGILILVALASPLLIGGWL---- 115

Query: 116 PVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLD 175
              +   + P+F R++L  G+ +I S+N LV   K+  K ++VG+I  + +      +L 
Sbjct: 116 --FSAQALAPNFGRMNLFSGLLKIVSLNALVELGKAVAKAVIVGSIAYLVMRSEIDEVLG 173

Query: 176 FISANPHSILYHA---FFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDE 232
            +     +   H     F+   +++M L+ IA +      WSY +   K+ M++QE++ E
Sbjct: 174 LMVEPAEAGSMHMAKLLFSTYMLIVMGLVLIAAVDAPYQMWSYAK---KMMMTRQEVRQE 230

Query: 233 IKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLV 292
            K+S GNP IK + ++  R   R +MM     A +++TNPTHYA+AL+Y   +  AP +V
Sbjct: 231 AKESEGNPEIKAKIRAQQREMARRRMMSEVPTADVVVTNPTHYAVALKYTDGKMGAPQVV 290

Query: 293 AKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
           AKG + +A ++R++A  +N+P+ E P LAR+LFK V +  AIP   Y AVA+++  ++  
Sbjct: 291 AKGADAVAARIRELAAANNVPLLEAPPLARALFKHVELGDAIPETLYTAVAEVLAYVFQL 350

Query: 353 K 353
           K
Sbjct: 351 K 351


>gi|157371217|ref|YP_001479206.1| flagellar biosynthesis protein FlhB [Serratia proteamaculans 568]
 gi|157322981|gb|ABV42078.1| flagellar biosynthetic protein FlhB [Serratia proteamaculans 568]
          Length = 398

 Score =  169 bits (427), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 103/351 (29%), Positives = 183/351 (52%), Gaps = 7/351 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+   K+EAP+  ++E A  +G  P SRE    +S+L  +  L   +  G  +++  L 
Sbjct: 18  EDSDLEKSEAPTPHRVEKAREDGQIPRSRE---LTSVLMLVAGLSIIWVAG-SNMSQQLA 73

Query: 64  VLLASATQRKLEDISHIVFLLTHLSL---SASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           ++L          +S+   +L  L +    A   ++P +    +  I + ++    +L+ 
Sbjct: 74  MMLTQGLNFDHSMVSNDKQMLRQLGMLLRQAVWALLPVMAGLTLVAITAPMLLGGLLLSG 133

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K   KR++   G+KRI+S   L   +K  +K  LVG +  + L  N+  ML  ++  
Sbjct: 134 KSLKFDLKRMNPLTGLKRIFSSQVLAELLKGILKATLVGWVTGLYLWHNWAAMLHLVTQQ 193

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   L +A   +    ++++L +  +   D+ +     + KLKM+KQ+I+DE K   G+P
Sbjct: 194 PLDALANALQMIIFCGLLVVLALTPMVAFDVFYQLWSHFKKLKMTKQDIRDEFKDQEGDP 253

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A +I+TNPTHYA+AL+Y   +  AP ++AKG   IA
Sbjct: 254 HVKGRIRQQQRAIARRRMMADVPKADVIVTNPTHYAVALQYNDKKMSAPKVLAKGAGEIA 313

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            ++R++  +H IP+ E P LAR+L++   I   IP   Y AVA+++  +Y 
Sbjct: 314 LRIRELGMQHRIPMLEAPPLARALYRHSEIGQHIPATLYAAVAEVLAWVYQ 364


>gi|320354335|ref|YP_004195674.1| flagellar biosynthetic protein FlhB [Desulfobulbus propionicus DSM
           2032]
 gi|320122837|gb|ADW18383.1| flagellar biosynthetic protein FlhB [Desulfobulbus propionicus DSM
           2032]
          Length = 355

 Score =  169 bits (427), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 110/355 (30%), Positives = 197/355 (55%), Gaps = 5/355 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  A   +TE+PS+K+  D   +G    SRE    +     L++ +FF +P  +  T 
Sbjct: 1   MAEEPASGERTESPSAKRRADFRKKGQVAQSREVQTAALFTLLLLFWVFF-APIFWDGTK 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           ++  +L   +       S ++ L   L +S + ++ P  L+ ++ G  +  +Q   +   
Sbjct: 60  EMVAVLWRNSGDYAITTSSLMQLGYFLGVSLAMILAPLFLVALLVGFLATFLQIGWLFTT 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTII--TISLTENYFTMLDFIS 178
             + P   ++   +G+ R +S  +LV  +KS +K+ L+G I   T++   +   +L  + 
Sbjct: 120 EPLIPDLTKLDPIKGMGRFFSKRSLVEVIKSLLKVGLIGWIAYKTVAGEMDQALLLTEMP 179

Query: 179 ANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYG 238
            +  +ILY A  T   V+  +   +  L +LD  +   +   K+KM+KQE K+E+K++ G
Sbjct: 180 LD-DTILYLAK-TSALVMAKVAAIMIVLAILDYAFVRWEMEEKMKMTKQEQKEEMKETEG 237

Query: 239 NPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL 298
           +P IK++ +SI +   R +MM A   A ++ITNPTH A+A++Y     DAP+++AKGQ L
Sbjct: 238 DPHIKSKIRSIQQQMARRRMMAAVPTADVVITNPTHIAVAIKYEAGTMDAPLVLAKGQEL 297

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +A+K+R+IA E++IP+ E P +AR L  +V +  AIP   +KAVA+++  +Y  K
Sbjct: 298 VAEKIREIARENDIPLVENPPVARLLHSKVEVGQAIPEELFKAVAEILAYVYSLK 352


>gi|73539437|ref|YP_299804.1| flagellar biosynthesis protein FlhB [Ralstonia eutropha JMP134]
 gi|72122774|gb|AAZ64960.1| Flagellar biosynthetic protein FlhB [Ralstonia eutropha JMP134]
          Length = 380

 Score =  168 bits (426), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 101/358 (28%), Positives = 190/358 (53%), Gaps = 16/358 (4%)

Query: 4   NDAPD-NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDL 62
           +D  D  KTE  S +++E A  EG    SRE + F  ++  +I        G++++   +
Sbjct: 2   SDESDLEKTEPASPRRLEKAREEGQVVRSRELATFIMLMTGVI--------GLWTLGGTI 53

Query: 63  HVLLASATQRKLE-------DISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRI 115
              L +  ++ L        D S ++    ++   +    +P LLLF +  + + L+   
Sbjct: 54  GRSLDTVMRQSLRFEPATAFDTSRMLSRFANVIWESLLAFMPLLLLFGVAAVAAPLLMGG 113

Query: 116 PVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLD 175
              +   + P+F R+S   G+ R++S++++   +K+  K +LVG++    +       + 
Sbjct: 114 WTFSTKALMPNFGRMSPMSGLGRMFSVHSVAELVKAIAKSLLVGSVGAWVVWHRLPDAIA 173

Query: 176 FISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQ 235
            ++A     L H    V +  + ++L +  +  +D+ W + + + KL+MSK+E+K E K+
Sbjct: 174 LMNAPVQEALLHMLDMVLRCCVPVVLSLLLVAAIDVPWQFWEHFKKLRMSKEEVKQEFKE 233

Query: 236 SYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKG 295
           S G+P IK R +   R+  R +MM+   +A +++TNPTH+A+ALRY +    AP ++AKG
Sbjct: 234 SEGDPHIKGRIRQQQRAMARRRMMQEVPKADVVVTNPTHFAVALRYEEGRMSAPRVIAKG 293

Query: 296 QNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            + +A ++R++A EH IP+   P LAR+L + V +   IP   Y AVA+++  +Y  K
Sbjct: 294 TDEVAARIRELAAEHRIPLMSAPPLARALHRHVDLGQEIPAGLYTAVAEVLAWVYQLK 351


>gi|157692318|ref|YP_001486780.1| flagellar biosynthesis protein FlhB [Bacillus pumilus SAFR-032]
 gi|157681076|gb|ABV62220.1| flagellar biosynthesis protein FlhB [Bacillus pumilus SAFR-032]
          Length = 362

 Score =  168 bits (426), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 106/279 (37%), Positives = 163/279 (58%), Gaps = 6/279 (2%)

Query: 78  SHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKRVSLREGIK 137
           S+I  L   L      L++P L + M+ GI S  +Q   + +   +KP  +++   +G K
Sbjct: 83  SNIHQLFVELLQETGLLLMPILGVGMLAGIISNYLQVGFLFSTEVIKPKLEKLDPIKGFK 142

Query: 138 RIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAFFTVRKVLI 197
           RIYSI  LV  +KS +KI L+G    I+L  ++  +L          L+   F     LI
Sbjct: 143 RIYSIRALVELLKSILKIGLIGFATFIALWMHFDEILRLPLLTAEETLH---FVASMTLI 199

Query: 198 MILLFIATLTVL-DIGWSYHQW-YSK-LKMSKQEIKDEIKQSYGNPIIKNRQKSIARSRI 254
           M L     L VL  + + Y ++ Y K L+MSKQ+IKDE K+S G+P+IK++ K   R   
Sbjct: 200 MGLYAAGALMVLAGLDYMYQKFDYEKNLRMSKQDIKDEYKKSEGDPLIKSKIKQRQREMA 259

Query: 255 RHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIPI 314
             +MM+   +A +IITNPTHYA+AL+Y + + DAP +VAKG +++A K+R IA EH+I  
Sbjct: 260 MRRMMQEVPKADVIITNPTHYAIALKYDEEKMDAPFVVAKGTDILALKIRTIAKEHDIMT 319

Query: 315 FEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            E   LAR+L+ QV I+ A+P  ++KA+A+++  +Y  K
Sbjct: 320 VENRPLARALYDQVDIDQAVPEEYFKAIAEILAYVYKTK 358


>gi|78776868|ref|YP_393183.1| flagellar biosynthesis protein FlhB [Sulfurimonas denitrificans DSM
           1251]
 gi|78497408|gb|ABB43948.1| Flagellar biosynthetic protein FlhB [Sulfurimonas denitrificans DSM
           1251]
          Length = 350

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 122/365 (33%), Positives = 197/365 (53%), Gaps = 40/365 (10%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREAS----LFSSILACLIYLLFFFSPGIYSVT 59
           +DA   KTE P+SKKIEDA  EGN P S++AS    LF +ILA L+   +  S  I S+ 
Sbjct: 3   DDA--EKTEEPTSKKIEDARKEGNVPKSQDASGVMTLFVAILAFLMLFPYMLS-HILSIF 59

Query: 60  SDLHVLLASATQRKLE-DISHI----VFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQR 114
                L+     R L  DI+ +    +FL+  + LS +  +   +     FG        
Sbjct: 60  KYYFSLIGMTIDRALMLDIAIVTIKEIFLII-MPLSIAVAIAGVIAAISQFGF------- 111

Query: 115 IPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTML 174
             +     + P  K++   +G+K ++S+  L++ +K     I   +  T+ +   +F + 
Sbjct: 112 --LFTTKSITPDLKKLDPIKGMKNLFSMKKLIDGIK-----ITFKSFTTLGIGFVFFFL- 163

Query: 175 DFISANPHSILYHAFFTVRKVLI---------MILLFIATLTVLDIGWSYHQWYSKLKMS 225
            FI   P   L+   FT + + +         ++LL I    V+DI     Q++  LKMS
Sbjct: 164 -FIMELPTVALFG--FTDQMIWLRDKAIIIAFVMLLIIFIFAVIDIVIVRKQYFDGLKMS 220

Query: 226 KQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTE 285
           KQEIKDE+K   G+P+IK + + I     R +MM A   A ++ITNPTHYA+A++Y + +
Sbjct: 221 KQEIKDEMKNMDGDPLIKGKIRQIQMEASRKRMMSAVPEADVVITNPTHYAVAIKYDEQK 280

Query: 286 NDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQL 345
           + AP++VAKG + IA++++KIA E+ + I + P LARSL+ +V ++  IP   + AVA++
Sbjct: 281 SHAPIVVAKGMDNIAQQIKKIARENGVHIVQNPPLARSLYAEVELDKPIPSELFGAVAEV 340

Query: 346 IYKIY 350
           +  IY
Sbjct: 341 LAYIY 345


>gi|304396256|ref|ZP_07378138.1| flagellar biosynthetic protein FlhB [Pantoea sp. aB]
 gi|304356625|gb|EFM20990.1| flagellar biosynthetic protein FlhB [Pantoea sp. aB]
          Length = 382

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 111/357 (31%), Positives = 191/357 (53%), Gaps = 15/357 (4%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D+ ++KTE+P++ ++E A  EG  P SRE    +S+L  L  ++  +  G   +   L 
Sbjct: 2   SDSDEDKTESPTAHRLEKAREEGQIPRSRE---LTSVLMLLAGIMILWMGG-NMMAHRLA 57

Query: 64  VLLASA---TQRKLED----ISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIP 116
            ++A+        + D    +SHI  L+T  +L A   ++ GL+L     I + ++    
Sbjct: 58  AMVATGLRFDHGMVRDDKIIVSHIGSLITQ-ALMALLPLMGGLVLV---AIAAPMLLGGI 113

Query: 117 VLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDF 176
           V +   +K   K+++   G KR+++        K  +K ILVG +    +  ++  ML  
Sbjct: 114 VFSGKSIKFDPKKMNPIAGFKRMFAAQAWTELFKGILKTILVGAVGWWYIWSHWPEMLRL 173

Query: 177 ISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQS 236
           IS  P + L H    +     +++L +  +   D+ W  +  + KLKMS QEI+DE KQ 
Sbjct: 174 ISEAPVTALIHGMEMIAVCCSLVMLGLIPMVGYDVFWQLYSHFKKLKMSMQEIRDEHKQQ 233

Query: 237 YGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQ 296
            G+P +K R +   R+  R +MM    +A +I+TNPTHY++AL+Y + +  AP +VAKG 
Sbjct: 234 EGDPHVKGRIRQQMRAAARRRMMADVPKADVIVTNPTHYSVALQYNEKKMSAPKVVAKGA 293

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
             IA ++R++A EH IP+ E P LAR+L++   I   IP   Y AVA+++  ++  +
Sbjct: 294 GEIALRIRELAAEHRIPVLEAPPLARALYRHTEIGQHIPGALYAAVAEVLAWVWQSR 350


>gi|88813214|ref|ZP_01128454.1| flagellar biosynthesis protein [Nitrococcus mobilis Nb-231]
 gi|88789536|gb|EAR20663.1| flagellar biosynthesis protein [Nitrococcus mobilis Nb-231]
          Length = 385

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 108/366 (29%), Positives = 188/366 (51%), Gaps = 33/366 (9%)

Query: 2   SENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSD 61
            E+   + KTEAP++K+  +A  +G  P SRE +   ++L+    LL F   G Y   S 
Sbjct: 3   EEHSNGEEKTEAPTAKRRHEAKEQGQVPRSRELTTLLAMLSAAGGLLIF---GNYMTDS- 58

Query: 62  LHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIP----- 116
               LA A ++ L      +F        A   ++  ++   ++ +G   +  +      
Sbjct: 59  ----LADALRQGLHVGRDAIF-----DPQAPIRLLREMIAQGLWAVGPLALVLLLVALVA 109

Query: 117 -------VLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTEN 169
                    +   + P   ++   +G+KR++ ++ LV   KS  K++LVG + T +L ++
Sbjct: 110 PVALGGWTFSAKALAPKLSKLDPVKGLKRLFGVHGLVELGKSLAKVMLVGAVGTYALWQS 169

Query: 170 YFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVL----DIGWSYHQWYSKLKMS 225
               LD   A     L+ A     ++     L +AT  +L    D+ +       KL+M+
Sbjct: 170 ----LDDFQALAAEALFPALQHAARIFNTTFLMLATALILIALVDVPFQLWDHTRKLRMT 225

Query: 226 KQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTE 285
           KQE+KDE+KQ+ G P +K+R + + +   + +MME   +A +++TNPTH+A+ALRY    
Sbjct: 226 KQELKDELKQTEGKPEVKSRIRQLQQQAAQGRMMEQVPKADVVVTNPTHFAVALRYDPLH 285

Query: 286 NDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQL 345
             AP L+AKG +LIA+++R+IA ++ +P+FE P LAR+L     ++  +P   Y AVAQ+
Sbjct: 286 MRAPRLMAKGTDLIAQRIRRIAEDNGVPLFEAPPLARALHYTTELDQEVPAGLYLAVAQV 345

Query: 346 IYKIYH 351
           +  IY 
Sbjct: 346 LAYIYQ 351


>gi|94312630|ref|YP_585839.1| flagellar biosynthetic protein FlhB [Cupriavidus metallidurans
           CH34]
 gi|93356482|gb|ABF10570.1| flagellar biosynthetic protein FlhB [Cupriavidus metallidurans
           CH34]
          Length = 380

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 110/359 (30%), Positives = 179/359 (49%), Gaps = 29/359 (8%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSD--LHVLL 66
            KTE  +++++E A  EG    SRE   F+ ++  +I L  + + G+     D  +H  L
Sbjct: 8   EKTEPATARRLEKAREEGQVVRSRELGTFAMLMTGVIGL--WATGGVLGRKLDAVMHAGL 65

Query: 67  ASA------TQRKLEDISHIVF------LLTHLSLSASRLVIPGLLLFMMFGIGSYLIQR 114
           A        T R L   + IV+      L   L    + LV P  L   MF   S+    
Sbjct: 66  AFEPATAFDTNRMLSQFAAIVWDALLAFLPLLLMFGVAALVTPLALGGWMFSTKSF---- 121

Query: 115 IPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTML 174
                     P F R+S   G+ R++S ++LV   K+  K +LVG +    +       +
Sbjct: 122 ---------SPDFSRMSPISGLGRLFSAHSLVELAKAIAKSLLVGGVGAWMIWRKLPEAI 172

Query: 175 DFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIK 234
             + A     L H    V  V  ++   +  +  LD+ W  + ++ KL+M+K+EIK E+K
Sbjct: 173 ALMDAPIQEALLHMMELVLYVSGVVAGSLILVAALDVPWQLYTFHKKLRMTKEEIKQEMK 232

Query: 235 QSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAK 294
           ++ G+P IK R +   R+  R +MM    +A +++TNPTHYA+ALRY +    AP +VAK
Sbjct: 233 ETDGDPHIKARIRQQQRAIARRRMMAEVPKADVVVTNPTHYAVALRYEEGRMGAPRVVAK 292

Query: 295 GQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           G + +A ++R++A EH +P+   P LAR+L + V +   IP   Y AVA+++  +Y  K
Sbjct: 293 GADEVAARIRELAAEHRVPMLSAPPLARALHRHVELGHEIPAGLYTAVAEVLAWVYQLK 351


>gi|302389679|ref|YP_003825500.1| flagellar biosynthetic protein FlhB [Thermosediminibacter oceani
           DSM 16646]
 gi|302200307|gb|ADL07877.1| flagellar biosynthetic protein FlhB [Thermosediminibacter oceani
           DSM 16646]
          Length = 357

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 123/364 (33%), Positives = 193/364 (53%), Gaps = 36/364 (9%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIY---SVTSDLHV 64
             KTE  + ++ + A   G    SRE +    +LA  + L  F   GIY   +  S L  
Sbjct: 8   QEKTEKATPRRRQKARERGQVFSSRELNSALILLASFVLLKIF---GIYIFENTGSFLRQ 64

Query: 65  LLASATQRK---LEDI-----SHIVFLLTHLSLSASRLVIPGLLL-FMMFGIGSYLIQRI 115
                  R+   + DI     S IVF+L   +  A  +V+ GLL+ F+  G         
Sbjct: 65  FFIENLIRQDLSISDIYGIFYSSIVFVLKSTAPVAVGIVLVGLLVNFLQVGF-------- 116

Query: 116 PVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIIT---ISLTENYFT 172
            V +L  + P   R++  EG KRI+S  +L+  +K+ VKIIL+  I     + + +    
Sbjct: 117 -VFSLEPISPKLDRINPVEGAKRIFSKRSLIELVKALVKIILIIYIFYGGFVEIKDTVAL 175

Query: 173 MLDFISANPHSILYHAFFTVR---KVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEI 229
           MLD   +   S+ Y      R   KV I +L+    L+VLD G+ ++++   L MSK+++
Sbjct: 176 MLDM--SFTESLGYFTSMMFRLGLKVGIALLV----LSVLDYGYQWYEYEKSLMMSKEDV 229

Query: 230 KDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAP 289
           K+E+K+  GNP IK+R + + R   R +MM+   +A ++ITNPTH A+AL Y  + + AP
Sbjct: 230 KEELKEVEGNPQIKSRIRQVQRQMSRRRMMQEVKKADVVITNPTHIAIALGYDASVHAAP 289

Query: 290 VLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKI 349
           V++AKG   IA+K+++IA   +IPI E   LA++LFK V +   IP  FY AVA+++  +
Sbjct: 290 VVLAKGTGAIAEKIKEIAEREDIPIVENKPLAQTLFKSVEVGDIIPEEFYNAVAEILAFV 349

Query: 350 YHKK 353
           Y  K
Sbjct: 350 YSLK 353


>gi|114320141|ref|YP_741824.1| flagellar biosynthetic protein FlhB [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114226535|gb|ABI56334.1| flagellar biosynthetic protein FlhB [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 390

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 113/366 (30%), Positives = 186/366 (50%), Gaps = 33/366 (9%)

Query: 2   SENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSD 61
            E++    KTE P+ K+++DA  +G  P SRE +    +L   + +L F   G Y +   
Sbjct: 3   EESENGQEKTEQPTPKRLQDAKKKGQIPRSRELTTTLLMLFAALGMLMF---GGY-MGEG 58

Query: 62  LHVLLASATQRKLEDI--SHIVFLLTHLSLSASRLVIPGLLLFMMF-------GIGSYLI 112
           +  LL  + Q   E I          H +L    L++   +  MM         +G +  
Sbjct: 59  IVGLLEWSFQPGREQIFDPKEPIARVHEALGRGLLIVAPFVGLMMLVALIGPVALGGWTF 118

Query: 113 QRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITI--SLTENY 170
              P++      P  ++++  +GIKRI+    L+   K   KI++VG +  +   L ++ 
Sbjct: 119 SAQPMI------PKPEKMNPVKGIKRIFGPKALIELAKGIAKILVVGAVAGVFFYLFQDE 172

Query: 171 FTMLDFI---SANPHSI--LYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMS 225
              L      SA  H+I   + AFF +   LI+++        +D+ +       KL+M+
Sbjct: 173 LRSLALAPLQSAMAHAIELFFIAFFVLAASLIIVV-------AVDVPYQLWDHQKKLRMT 225

Query: 226 KQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTE 285
           +QE+KDE KQ+ G P +K + + + R   + +MME    A +++TNPTHYA+AL+Y Q  
Sbjct: 226 RQEVKDEFKQTEGKPEVKGKIRQLQREAAQRRMMEKVPEADVVVTNPTHYAVALQYDQLR 285

Query: 286 NDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQL 345
             AP +VA G++ +A ++R+IA EH IP+FE P LAR+L+    I+  IP   Y AVAQ+
Sbjct: 286 MRAPRVVALGKDQVALRIREIAGEHGIPLFEAPPLARALYHTTDIDQEIPAGLYMAVAQV 345

Query: 346 IYKIYH 351
           +  IY 
Sbjct: 346 LAYIYQ 351


>gi|304311113|ref|YP_003810711.1| Flagellar biosynthetic protein [gamma proteobacterium HdN1]
 gi|301796846|emb|CBL45058.1| Flagellar biosynthetic protein [gamma proteobacterium HdN1]
          Length = 375

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 110/362 (30%), Positives = 186/362 (51%), Gaps = 20/362 (5%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++ D    KTE  + +K+E A  +G  P SR+    S ++   I +L +    IY    
Sbjct: 1   MADEDG-QEKTEDATPRKLEQAYEKGQTPRSRDLVAVSMLIIGGIGMLLYVEQ-IYRAFV 58

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGI---------GSYL 111
               +  +  + K+ D S ++  L   + +A + ++P   LF    +         G   
Sbjct: 59  TAFEMGFTFDREKIFDDSAMMRALLQAAYAAGKSLLP---LFATLAVVAIAASVASGGLH 115

Query: 112 IQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYF 171
           +   P++        F++++   GIKR++S+ +LV  +KS +K+ LVG    + +   + 
Sbjct: 116 VSSHPLMF------KFEKLNPLSGIKRMFSLQSLVELIKSIMKVSLVGFTAWLVVKAQFA 169

Query: 172 TMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKD 231
             L  I       + H+   V    + + L +A +  +D+ +   Q+  +L+M+KQE+KD
Sbjct: 170 EYLGLIDEPIQQAMLHSISMVAWAFVWLSLSLALVAAIDVPYQNWQFRKQLRMTKQEVKD 229

Query: 232 EIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVL 291
           E K S G P IK +Q+  AR      MM    +A ++ITNPTH+A+ALRY  T+  AP L
Sbjct: 230 EYKDSEGKPEIKAKQRQRAREMAFAGMMAEVPKADVVITNPTHFAVALRYDPTKGGAPKL 289

Query: 292 VAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           VAKG +LIA++++++A  +N+ I   P LARS+F    +   IP   Y AVAQ++  +YH
Sbjct: 290 VAKGADLIAEQIKRVAIANNVVILAAPPLARSIFYHTKLFKEIPSGLYVAVAQVLAYVYH 349

Query: 352 KK 353
            K
Sbjct: 350 LK 351


>gi|213022149|ref|ZP_03336596.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Typhi str. 404ty]
          Length = 336

 Score =  168 bits (425), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 98/335 (29%), Positives = 184/335 (54%), Gaps = 7/335 (2%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            ++ D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G  S+   L 
Sbjct: 3   EESDDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVCIIWFGG-ESLARQLA 58

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++      R + D + I+  +  L  +A   ++P +   ++  + S ++    + + 
Sbjct: 59  GMLSAGLHFDHRMVNDPNLILGQIILLIKAAMMALLPLIAGVVLVALISPVMLGGLIFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K  LVG +    L  ++  M+  ++ +
Sbjct: 119 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAVLKSTLVGCVTGFYLWNHWPQMMRLMAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE K+S G+P
Sbjct: 179 PIVAMGNALDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + + R+  + +MME   +A +I+TNPTHY++AL+Y + +  AP +VAKG  LIA
Sbjct: 239 HVKGKIRQMQRAAAQRRMMEDVPKADVIVTNPTHYSVALQYDENKMSAPKVVAKGAGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIP 335
            ++R+I  EH +P  E P LAR+L++   I   IP
Sbjct: 299 LRIREIGAEHRVPTLEAPPLARALYRHAEIGQQIP 333


>gi|307610486|emb|CBX00058.1| flagellar biosynthetic protein FlhB [Legionella pneumophila 130b]
          Length = 425

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 102/358 (28%), Positives = 190/358 (53%), Gaps = 15/358 (4%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++ +    KTE PSSK+++++  +G    S++   F++ +     +L F   G +    
Sbjct: 1   MADEEQSQEKTEQPSSKRLKESRKKGQVARSKD---FNATV-----ILLFTGLGFFIFGK 52

Query: 61  DLHVLLASATQRKLEDISHIVFL-------LTHLSLSASRLVIPGLLLFMMFGIGSYLIQ 113
            L + +AS  Q+  +    I+         L  L+ S    V+P LL+  +  + + L+ 
Sbjct: 53  QLSLQIASIMQQAFDFDRDILVTGNNSLENLFQLTKSGLWSVVPLLLVIFILSLLAPLLM 112

Query: 114 RIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTM 173
              V +   ++P F R+++ +G KR+ S+   +  +K+F+K +LV +   + L      +
Sbjct: 113 GGWVFSGQSIQPKFSRLNVLKGFKRMISLKGFIEMLKAFLKFVLVASASILVLRSQVPLL 172

Query: 174 LDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEI 233
           L+   A     +      + K  ++I   +  +  +D+ +  ++    +KM+KQE+KDE 
Sbjct: 173 LELGKAPLEIAITSGVMILLKSFVLISASLILIAAIDVPFQLYEHSKSIKMTKQELKDEY 232

Query: 234 KQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVA 293
           K++ G P +K+  +   +   R +MM    +A +I+TNPTHYA+AL Y +    APV++A
Sbjct: 233 KETEGKPEVKSAIRRAQQEAARRRMMSEVPKADVILTNPTHYAVALSYQKKGKKAPVVIA 292

Query: 294 KGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           KG+NL+A ++ K+A EH IPI   P+LAR+++    +N+ IP   Y AVAQ++  I+ 
Sbjct: 293 KGKNLVAFQISKVAKEHKIPIISVPALARAIYFSTKLNAEIPRGLYVAVAQVLAYIFQ 350


>gi|126653730|ref|ZP_01725648.1| flagellar biosynthesis protein B [Bacillus sp. B14905]
 gi|126589694|gb|EAZ83830.1| flagellar biosynthesis protein B [Bacillus sp. B14905]
          Length = 365

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 109/350 (31%), Positives = 189/350 (54%), Gaps = 10/350 (2%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE  + KK +DA  +G    S++ +    +L   I+L+FF       + +        
Sbjct: 18  EKTEKATPKKRQDARKKGQVIKSQDVTSAIVMLMVFIFLIFFAGSLRDELLAFFRQTFIH 77

Query: 69  ATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFK 128
             + +   I  ++ L     +  + +++P + + ++  +    +Q   +  L  +K   K
Sbjct: 78  NIRIETLTIDSVMHLFIETLIQMAFIIVPIMAIAVVGALAGNFLQFGFLFTLEPMKFDLK 137

Query: 129 RVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHA 188
           ++   +G+KRI+S+  +V  +KS +KI  +G++ TI +  N   +L     +P    +  
Sbjct: 138 KMDPIKGLKRIFSVKAIVELLKSVLKIGFIGSVTTIIIWTNLPEVLALSFKSP----WMT 193

Query: 189 FFTVRKVLIMILLFIATLTVLDIG---WSYHQW-YSK-LKMSKQEIKDEIKQSYGNPIIK 243
             TV K L+ I+   A+L +L +    W Y ++ Y K LKMSKQ+IKDE K S G+P+IK
Sbjct: 194 LITVGK-LVGIMGIAASLVLLCVSILDWMYQKFDYEKNLKMSKQDIKDEYKNSEGDPLIK 252

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
           ++ K   R     +MM     A ++ITNPTHYA+AL+Y +   DAP ++AKG + IA+K+
Sbjct: 253 SKIKQRQREMAMRRMMSEIPSADVVITNPTHYAIALKYDEENMDAPRVIAKGTDFIAQKI 312

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           + IA EH++ + E   LAR+++ QV I   +P  F+KAVA+++  +Y  K
Sbjct: 313 KLIAKEHDVIMVENRPLARAMYDQVEIGDPVPEEFFKAVAEILAYVYRIK 362


>gi|222530120|ref|YP_002574002.1| flagellar biosynthetic protein FlhB [Caldicellulosiruptor bescii
           DSM 6725]
 gi|222456967|gb|ACM61229.1| flagellar biosynthetic protein FlhB [Caldicellulosiruptor bescii
           DSM 6725]
          Length = 366

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 106/350 (30%), Positives = 192/350 (54%), Gaps = 13/350 (3%)

Query: 10  KTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLASA 69
           KTE  + +K ++A   G    SRE +   ++L  +++L F +S  I  +         S 
Sbjct: 16  KTEKATPRKRQEARKRGMVAKSREVTSAFALLISVLFLKFGYSLIIVPLQQGSKYFF-SN 74

Query: 70  TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKR 129
               LEDIS    LL+ +  ++ ++V+P  +  M   +     Q   ++    +K SF++
Sbjct: 75  LNYSLEDISDASKLLSFIITTSLKIVLPFCVTIMFVAVIVEWAQSSFLITGQSLKMSFQK 134

Query: 130 VSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFT------MLDFISANPHS 183
           ++  EG KRI+SIN++V  +KS +K++++G       T  ++T      +L+    N  +
Sbjct: 135 INPIEGFKRIFSINSVVELIKSVLKVLIIG------YTGYFYTQTFAKKLLEMYEMNVFT 188

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
           I+  +F +   +++ + +    + V+D  +   Q+  KL M+K+E+K+E KQ+ GNP IK
Sbjct: 189 IVRFSFGSAINLILWMAVMFFGIAVIDFIFQRQQYEKKLMMTKEEVKEEFKQTEGNPQIK 248

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
           ++ +   R     +M +   +A ++ITNPTHYA+AL Y   + DAP ++AKG++ IA+K+
Sbjct: 249 SKIREKQRRISLQRMFQQLPKADVVITNPTHYAVALLYEPEKFDAPRVIAKGKDYIAQKI 308

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           ++ A +H I I E   LAR+L+    +   IPP  Y+AVA+++  +Y  K
Sbjct: 309 KQEAIKHRIEIVENRELARALYNMCEVGDFIPPELYQAVAEVLAYVYSLK 358


>gi|57506049|ref|ZP_00371972.1| flagellar biosynthetic protein FlhB [Campylobacter upsaliensis
           RM3195]
 gi|57015657|gb|EAL52448.1| flagellar biosynthetic protein FlhB [Campylobacter upsaliensis
           RM3195]
          Length = 356

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 110/363 (30%), Positives = 190/363 (52%), Gaps = 42/363 (11%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYL-------------LFFFSPGI 55
            KTE P+SKKIEDA  EGN P S++A+   +++  +  L             L+ +    
Sbjct: 7   EKTEEPTSKKIEDARQEGNVPKSQDAAAVVTLIVAITLLLFLLGFMGERVANLYRYYQNF 66

Query: 56  YSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRI 115
             V  DL ++ A      ++ I  ++ +L  + LS            M+ GI   ++Q  
Sbjct: 67  IGVEFDLRIIQAIM----MKSIFEVLIILAPIVLS-----------IMVAGIIGNVMQFG 111

Query: 116 PVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLD 175
            +     + P+  +++  +G+K ++S+  L+  +K  +K+ +V TI        +  +L 
Sbjct: 112 FIFTTKPIMPNLSKINPLKGLKNLFSLKKLIESVKIILKVSVVFTI-------AFIVLLQ 164

Query: 176 FISANPHSILY----HAFFTVRKVLIMILLFIATLTV---LDIGWSYHQWYSKLKMSKQE 228
           F+   P   LY       +   K LI+  + I    +   LD+     Q++  LKMSKQE
Sbjct: 165 FVKELPKVELYSLAAQMVWLRDKALILAAIVIIAFLIIAILDVFLVRFQYFQGLKMSKQE 224

Query: 229 IKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDA 288
           IKDE KQ  G+P +K R + +     R +M++  + A ++ITNPTHYA+ALRY  T+ +A
Sbjct: 225 IKDEYKQMEGDPQVKGRIRRLQMEAARRRMVQDVAGADVVITNPTHYAVALRYDTTKENA 284

Query: 289 PVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYK 348
           P +VAKG + +A +++++AY+HN+ ++E P LAR L+K   ++  IP   +KAV+++   
Sbjct: 285 PRVVAKGVDFLALRIKEMAYKHNVIVYENPPLARQLYKDCDLDQLIPRELFKAVSEVFKF 344

Query: 349 IYH 351
           +Y 
Sbjct: 345 VYQ 347


>gi|194014696|ref|ZP_03053313.1| flagellar biosynthetic protein FlhB [Bacillus pumilus ATCC 7061]
 gi|194013722|gb|EDW23287.1| flagellar biosynthetic protein FlhB [Bacillus pumilus ATCC 7061]
          Length = 362

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 105/279 (37%), Positives = 163/279 (58%), Gaps = 6/279 (2%)

Query: 78  SHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKRVSLREGIK 137
           S+I  L   L      L++P L + M+ GI S  +Q   + +   +KP  +++   +G K
Sbjct: 83  SNIHQLFVQLLQETGILLMPILGVGMLAGIISNYLQVGFLFSTEVIKPKLEKLDPIKGFK 142

Query: 138 RIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAFFTVRKVLI 197
           RIYSI  LV  +KS +KI L+G    I+L  ++  +L          L+   F     LI
Sbjct: 143 RIYSIRALVELLKSILKIGLIGFATFIALWMHFDEILRLPLLTAEETLH---FVANMTLI 199

Query: 198 MILLFIATLTVL-DIGWSYHQW-YSK-LKMSKQEIKDEIKQSYGNPIIKNRQKSIARSRI 254
           M L     L +L  + + Y ++ Y K L+MSKQ+IKDE K+S G+P+IK++ K   R   
Sbjct: 200 MGLYAAGALMILAGLDYMYQKFDYEKNLRMSKQDIKDEYKKSEGDPLIKSKIKQRQREMA 259

Query: 255 RHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIPI 314
             +MM+   +A +IITNPTHYA+AL+Y + + DAP +VAKG +++A K+R IA EH+I  
Sbjct: 260 MRRMMQEVPKADVIITNPTHYAIALKYDEEKMDAPFVVAKGTDILALKIRTIAKEHDIMT 319

Query: 315 FEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            E   LAR+L+ QV I+ A+P  ++KA+A+++  +Y  K
Sbjct: 320 VENRPLARALYDQVDIDQAVPEEYFKAIAEILAYVYKTK 358


>gi|114570480|ref|YP_757160.1| flagellar biosynthetic protein FlhB [Maricaulis maris MCS10]
 gi|114340942|gb|ABI66222.1| flagellar biosynthetic protein FlhB [Maricaulis maris MCS10]
          Length = 363

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 96/346 (27%), Positives = 182/346 (52%), Gaps = 1/346 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E +    KTE P+ ++++DA  +G+   S+E   +  + A L  L F F     ++  
Sbjct: 1   MAEGEDDSQKTEEPTQRRLDDARKKGDVAKSQEIPGWFVLAAGLALLSFIFPMMSRALAG 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           +L V         + +   ++ L+  ++     +V   + L  + G   + +Q+  +   
Sbjct: 61  NLEVFFEQPHDFAI-NPGAMMGLMQAVAWQVVAIVGLPIGLLAVAGFAGHYVQQGMLFTT 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P   +++  EG KR +    L NF+K   K+ LV     + +      +    + +
Sbjct: 120 EKIQPKLSKLNPIEGFKRNFGPQGLANFLKGVGKMALVAVAAFLVIYPKREILAGLPALD 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             S+L        ++L+  L   A +  LD  +    +  + +MS++EIKDE+KQS G+P
Sbjct: 180 IGSLLSLVRQGAIELLLAALTVYAVIAGLDYIFQRQSFMKRNRMSRREIKDEMKQSEGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           +++ + + + + R + +MM     AT+++TNPTHYA+AL Y+Q E  APV VAKG + +A
Sbjct: 240 LVRAKLRQLRQERSQRRMMTKVPDATVVVTNPTHYAIALHYVQGETPAPVCVAKGVDEVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
            ++R++A EH++PI E+P LAR+L     ++  IP   ++AVA+++
Sbjct: 300 LRIRELAEEHSVPIVEDPPLARALHATADLDEEIPTEHFQAVAKVV 345


>gi|270262410|ref|ZP_06190681.1| flagellar biosynthetic protein FlhB [Serratia odorifera 4Rx13]
 gi|270043094|gb|EFA16187.1| flagellar biosynthetic protein FlhB [Serratia odorifera 4Rx13]
          Length = 398

 Score =  167 bits (422), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 103/351 (29%), Positives = 182/351 (51%), Gaps = 7/351 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+   K+EAP++ ++E A  +G  P SRE    +S+L  +  L   +  G   +   L 
Sbjct: 18  EDSDLEKSEAPTAHRVEKAREDGQIPRSRE---LTSVLMLVAGLSIIWVAG-GGMAQQLA 73

Query: 64  VLLASATQRKLEDISHIVFLLTHLSL---SASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L          +S+   +L  L +    A   ++P +   ++  I + ++    +L+ 
Sbjct: 74  AMLTQGLNFDHTMVSNDKQMLRQLGMLLRQAVWALLPIMAGLVLVAITAPMLLGGLLLSG 133

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K   KR++   G+KR++S   L   +K  +K  LVG I  + L  ++  ML  ++  
Sbjct: 134 KSLKFDVKRMNPLSGLKRMFSSQVLAELLKGLLKATLVGWITGLYLWHHWAEMLHLVTQQ 193

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   L +A   +    ++++L +  +   D+ +     + KLKM+KQ+I+DE K   G+P
Sbjct: 194 PLDALGNALRMIIFCGLLVVLGLTPMVAFDVFYQLWSHFKKLKMTKQDIRDEFKDQEGDP 253

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A +I+TNPTHYA+AL+Y   +  AP ++AKG   IA
Sbjct: 254 HVKGRIRQQQRAIARRRMMADVPKADVIVTNPTHYAVALQYNDQKMSAPKVLAKGAGEIA 313

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            ++R++  EH IP+ E P LAR+L++   I   IP   Y AVA+++  +Y 
Sbjct: 314 LRIRELGTEHRIPMLEAPPLARALYRHSEIGQHIPATLYAAVAEVLAWVYQ 364


>gi|218288313|ref|ZP_03492612.1| flagellar biosynthetic protein FlhB [Alicyclobacillus
           acidocaldarius LAA1]
 gi|258511391|ref|YP_003184825.1| flagellar biosynthetic protein FlhB [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
 gi|218241672|gb|EED08845.1| flagellar biosynthetic protein FlhB [Alicyclobacillus
           acidocaldarius LAA1]
 gi|257478117|gb|ACV58436.1| flagellar biosynthetic protein FlhB [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
          Length = 361

 Score =  167 bits (422), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 98/352 (27%), Positives = 188/352 (53%), Gaps = 9/352 (2%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLF-FFSPGIYSVTSDLHV 64
           A   +TE  + ++ ++A  EG   ++R   L S++    + +      P ++    +L  
Sbjct: 10  AAGERTERATPRRRQEARKEGR--VARSPELTSAVAFAAVLVALRILGPAVWGEWENLIQ 67

Query: 65  LLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVK 124
                +  K   +  +  L+    ++A+R+++P   +  + G+ + ++Q  P+     + 
Sbjct: 68  RDLGGSALKSWTVEGVRALMATQVMAAARIMLPIAAVAAVIGLAAAVMQVRPLFVPQLLL 127

Query: 125 PSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS- 183
           P F+R+S   G +RI S+   +  +KS +K+  V  +   SL      M++  +A   + 
Sbjct: 128 PDFQRISPATGWRRIASLQGALEALKSLLKLAAVVGVAYTSLASLAHQMINLSAAELDAV 187

Query: 184 --ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPI 241
             IL  A F +    I +   +  +  +D  +  +     L+MSKQE+KDE+K++ GNP+
Sbjct: 188 PGILGRAVFNL---AIRVACAMVVIAAIDYVYQRYSLERSLRMSKQELKDELKETEGNPL 244

Query: 242 IKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAK 301
           +K+  +  AR     +MM+  ++A ++ITNPTHYA+AL Y     +AP +VAKG + +A+
Sbjct: 245 VKSAVRRRARQIASRRMMQNVAKADVVITNPTHYAVALAYQSDTMNAPQVVAKGADFVAQ 304

Query: 302 KMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           ++R+ A EH++P+ E P LA++L++ V I   IPP  Y+AVA+++  +Y  +
Sbjct: 305 EIRRRAEEHDVPLVENPPLAQALYRTVDIGQEIPPDLYQAVAEVLAYVYRMR 356


>gi|78044903|ref|YP_359855.1| flagellar biosynthetic protein FlhB [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|77997018|gb|ABB15917.1| flagellar biosynthetic protein FlhB [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 353

 Score =  167 bits (422), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 108/357 (30%), Positives = 187/357 (52%), Gaps = 16/357 (4%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISRE---ASLFSSILACLIYLLFFFSPGIY---- 56
           ++  D +TEAP+ +++ +A   G    S+E   A +F      L+ L  +F    Y    
Sbjct: 3   DEQRDQRTEAPTPRRLAEARRRGQVFKSQELNFAVMFLIFFLLLLVLGGYFYQQFYLLSR 62

Query: 57  SVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIP 116
           +V  ++ + L  +  R L        LL +   S  ++V+P LLL M+ GI   L+Q   
Sbjct: 63  NVFRNMFIELTPSAVRGL--------LLYYFGWS-FKIVLPFLLLGMLAGIALNLVQVGF 113

Query: 117 VLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDF 176
           +     +KPS++R++   G  RI+S  N V  +K+F+K   +  +I + +  N   +   
Sbjct: 114 IFTTEPLKPSWERINPLSGFSRIFSRRNWVELLKNFLKFGFLALVIYLRIKSNLPLIFQK 173

Query: 177 ISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQS 236
           I   P       F  ++K+ +  LL +     +D  +   ++Y  LKM+KQE+K+E +Q+
Sbjct: 174 IGQAPAEYFNGYFSLIKKIALDTLLVLFLFGAVDYWYQRREYYQSLKMTKQELKEEYRQT 233

Query: 237 YGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQ 296
            G+P+IK R +   R    +++     +AT+++TNP H A+AL+Y + +  AP +VAKG 
Sbjct: 234 EGDPLIKARLRERQRQIALNQIAREVPQATVVVTNPVHIAVALKYERGKMAAPKVVAKGA 293

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
             +A+K+++IA  HN+ I E   +AR L+K   +   IP   Y AVA++I  +Y KK
Sbjct: 294 GFLAEKIKEIARAHNVEIVENVEVARFLYKNCEVGEEIPEELYNAVAEIIAWVYRKK 350


>gi|58039957|ref|YP_191921.1| flagellar biosynthetic protein FlhB [Gluconobacter oxydans 621H]
 gi|58002371|gb|AAW61265.1| Flagellar biosynthetic protein FlhB [Gluconobacter oxydans 621H]
          Length = 358

 Score =  167 bits (422), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 106/349 (30%), Positives = 177/349 (50%), Gaps = 8/349 (2%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
           D+KTEAPSS++++ A  +G   +SREA  F ++L     +       +      + VL+A
Sbjct: 5   DDKTEAPSSQRLQKAREDGQIVMSREAMNFVALLGGFAGIFMVLPYLVMDFVHVMQVLMA 64

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
           +A    +     ++    H   +  +L +P      +  +G   +Q   +++   + P F
Sbjct: 65  NAGTVPMAQ-GGLLNSTDHAIEAGLKLAVPMAATVAVLCLGGGFLQTGFLIHPESLLPKF 123

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTI---ITISLTENYFTMLDFISANPHSI 184
           +R+S   G KRI     L +  K+  K  +   +   I+     +   M+         +
Sbjct: 124 ERISPLAGFKRIAGGGTLPDTFKALAKFAIFAVVLWNISKGAIPSAPRMVGLEPGPLLKM 183

Query: 185 LYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKN 244
           +    F     +I+  L IA     DI W   +  SKLKMS++++KDE K + G+P +K 
Sbjct: 184 MTDLGFRAASAMILAQLVIAGF---DIFWMRFRHISKLKMSREDLKDEYKNTEGDPHVKG 240

Query: 245 RQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMR 304
           RQK++     R +MM A   AT+++TNPTHYA+AL Y +    AP +VAKG + +A ++R
Sbjct: 241 RQKALRAKAARQRMMAAVKTATVVVTNPTHYAVALVYERGGGGAPRIVAKGMDDVAARIR 300

Query: 305 KIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            IA ++ IPI   P LAR+LF  +P++S IP   +K VA +I  ++  K
Sbjct: 301 DIAQDNRIPIVANPPLARALF-TLPLDSEIPAEHFKVVAAIIAYVWKLK 348


>gi|28869179|ref|NP_791798.1| flagellar biosynthetic protein FlhB [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213967544|ref|ZP_03395692.1| flagellar biosynthetic protein FlhB [Pseudomonas syringae pv.
           tomato T1]
 gi|301382881|ref|ZP_07231299.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           tomato Max13]
 gi|302061091|ref|ZP_07252632.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           tomato K40]
 gi|302131293|ref|ZP_07257283.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|28852419|gb|AAO55493.1| flagellar biosynthetic protein FlhB [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213927845|gb|EEB61392.1| flagellar biosynthetic protein FlhB [Pseudomonas syringae pv.
           tomato T1]
 gi|331016989|gb|EGH97045.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 378

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 102/351 (29%), Positives = 187/351 (53%), Gaps = 1/351 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+   +KTE P+ KK++D+  EG    S+E +    +L     LL F + GI  + S
Sbjct: 1   MAENENGQDKTEDPTEKKVKDSRAEGQIARSKELTTLVVMLMGAGGLLMFGA-GIAQMMS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           DL     + ++  + D S++   L    L A  +++P L+  +   +   ++    + + 
Sbjct: 60  DLMRDNFTISRETIMDQSYMGKALLSSGLHALVVMLPFLIAMLAAALVGPILLGGWLFST 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++   G+KR++S + LV  +KSF K +++  +  + L++    ++      
Sbjct: 120 KSLMPKFSRMNPAAGLKRMFSPHALVELLKSFGKFLIILAVALVVLSKERNDLVAIAHEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V      +   +  +   D+ +  ++ + KL M+KQE++DE K S G+P
Sbjct: 180 LEQAMIHSLLVVGWSSFWMACGLMFIAAADVPFVLYEAHKKLLMTKQEVRDEHKNSEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM +   A +IITNPTH+A+AL+Y   +  AP+L+AKG +L+A
Sbjct: 240 EVKQRIRQLQREMSQRRMMASIPEADVIITNPTHFAVALKYDPEQGGAPMLLAKGTDLVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            K+R+I   + I I E  +LARS++    ++  IP   Y AVAQ++  +Y 
Sbjct: 300 LKIREIGAHNQILILESAALARSIYYSTELDQEIPAGLYLAVAQVLAYVYQ 350


>gi|330961236|gb|EGH61496.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 378

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 109/357 (30%), Positives = 186/357 (52%), Gaps = 13/357 (3%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+   +KTE P+ KK++D+  +G    S+E +    +L     LL F S  I  + S
Sbjct: 1   MAENENGQDKTEDPTEKKVKDSRADGQIARSKELTTLVVMLMGSGGLLIFGS-DIAEMMS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIP---GLLLFMMFG---IGSYLIQR 114
            L     + T+  L D S++   L    L A  +V+P    +LL  + G   +G +L   
Sbjct: 60  ALMRDNFTITRETLMDQSYMGKALLSSGLHALVVVLPFLIAMLLAALVGPILLGGWLFTA 119

Query: 115 IPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTML 174
            P++      P F R++   G+KR+++ + LV  +KS  K +++  +    L      ++
Sbjct: 120 KPLM------PKFSRMNPAAGLKRMFAPSALVELLKSLGKFLIILAVALAVLNSERKDLI 173

Query: 175 DFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIK 234
                     + H+   V      +   +A +  +D+ +  +Q + KL M+KQE++DE K
Sbjct: 174 AIAHEPLEQAMIHSLIVVGWSSFWMACGLAFIAAVDVPFMLYQAHKKLLMTKQEVRDEHK 233

Query: 235 QSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAK 294
            S GNP +K R + + R   + +MM +   A +IITNPTH+A+AL+Y   +  AP+L+AK
Sbjct: 234 NSDGNPEVKQRIRQLQREMSQRRMMASIPEADVIITNPTHFAVALKYDPEQGGAPMLLAK 293

Query: 295 GQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           G +L+A K+R+I   + I I E  +LARS++    ++  IP   Y AVAQ++  +Y 
Sbjct: 294 GSDLVALKIREIGAHNQILILESAALARSIYYSTELDQEIPAGLYLAVAQVLAYVYQ 350


>gi|160902843|ref|YP_001568424.1| flagellar biosynthetic protein FlhB [Petrotoga mobilis SJ95]
 gi|160360487|gb|ABX32101.1| flagellar biosynthetic protein FlhB [Petrotoga mobilis SJ95]
          Length = 363

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 107/348 (30%), Positives = 189/348 (54%), Gaps = 9/348 (2%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A  +KTE P+ +++E A  EGN P S E ++  S L+  ++L   F P +  +    +  
Sbjct: 18  ADPDKTEDPTPRRLEKAREEGNIPQSNEFNMAVSFLSISLFLWIIFEPLLNDIFKVFYDY 77

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYL---IQRIPVLNLNH 122
           L+        D      LL +   +   L I  +L F++  + S L   IQ   +     
Sbjct: 78  LSLDLDYSPTD------LLGYEITAHMNLYIKLILFFVVAVVVSTLLGMIQTKFLFTFKS 131

Query: 123 VKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPH 182
           +K    +++  +G KR++S+ ++V  +K+ +K+ ++G +    +  N+F +L        
Sbjct: 132 LKLDLSKINPIKGFKRLFSLRSVVELIKALLKLTILGLLTYNIIKSNWFKILSLAGEETG 191

Query: 183 SILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPII 242
                 F  V  +L  + + +  L++ D  +  +++  +LKMSK E+K E K+  GNP I
Sbjct: 192 FSFNVIFDLVINILFQLGIVLLLLSLFDFWYQRYEYKKELKMSKYEVKQERKEIEGNPEI 251

Query: 243 KNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKK 302
           K RQ+ + R+  R +MM+    A ++ITNPTHYA+A+ Y   E  AP++VAKG++ +A K
Sbjct: 252 KQRQRELMRNLARSRMMQKVPEADVVITNPTHYAVAIEYKAEEMQAPIVVAKGKDEVAFK 311

Query: 303 MRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           +R+IA++H IPI E P+LAR ++++V +N  IP   Y  VA+++  +Y
Sbjct: 312 IREIAFKHGIPILERPALAREIYEKVELNEEIPEDLYTLVAEVLAYVY 359


>gi|315281330|ref|ZP_07869978.1| flagellar biosynthesis protein FlhB [Listeria marthii FSL S4-120]
 gi|313615028|gb|EFR88524.1| flagellar biosynthesis protein FlhB [Listeria marthii FSL S4-120]
          Length = 348

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 102/341 (29%), Positives = 183/341 (53%), Gaps = 5/341 (1%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A DNKTE  + ++I+ A NEGN   S+E +   S+L  +  LL+FF       T    V 
Sbjct: 2   AKDNKTEKATPRRIKKARNEGNVAKSKELNNAFSLL-IVAGLLYFFGEMFIKNTIQAFVA 60

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           L     +     S+ +F L        ++++P +++ ++FG+ +Y +Q   + +   VKP
Sbjct: 61  LLKQPPKLANMESYSLFYLMEFG----KVLLPVMIMVVIFGLMNYGVQVGILFSAKAVKP 116

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
            FKR++     KR++S+  LV  +K+ + I L+  +  I   ++  T++ +   N    L
Sbjct: 117 QFKRLNPANYFKRVFSVKGLVEVVKALLLITLLSYVAYIGFRDHLDTLISYTGQNWLYSL 176

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
              F   +   + + L IA + +LD  +  + +   L+MSKQEIKDE+K S G P +K R
Sbjct: 177 GQIFALFKNEFLALFLVIAVIGLLDFFYQRYDYKKGLRMSKQEIKDEMKDSEGRPEVKQR 236

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
           Q+SIAR  ++  + +  + AT ++ NPTH ++ +RY +T++ AP L+ KG++ +A  +R+
Sbjct: 237 QRSIARGLLQGSITKKMADATFVVNNPTHISVVMRYDKTKDHAPKLLVKGEDELALFIRQ 296

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           +A    +P+     LARS++     +  I    YK V +++
Sbjct: 297 VADTDGVPMITNRQLARSIYYTTNPDEYIQEDLYKDVIEVM 337


>gi|195953033|ref|YP_002121323.1| flagellar biosynthetic protein FlhB [Hydrogenobaculum sp. Y04AAS1]
 gi|195932645|gb|ACG57345.1| flagellar biosynthetic protein FlhB [Hydrogenobaculum sp. Y04AAS1]
          Length = 353

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 116/357 (32%), Positives = 199/357 (55%), Gaps = 19/357 (5%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYL-----LFFFSPGIYSVTS 60
           A +NKTE  +  +     +EGN   S+E      +++ L+ L     LFF    I+ + S
Sbjct: 2   ASENKTEKATPYRRGKLKSEGNVAKSQE------VVSALLMLVSTGALFFIGYKIFILFS 55

Query: 61  DLHVLLASATQRKLEDISHIVFLLTH-LSLSASRL---VIPGLLLFMMFGIGSYLIQRIP 116
           DL +L  S    +++D S      T  L LS  +L   + P  +L ++  +  Y++Q   
Sbjct: 56  DL-ILDGSL---RIDDPSFTPSDATKFLGLSFKKLLSDITPLFILAVLIVVFGYILQFGF 111

Query: 117 VLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDF 176
           +     ++P+F +++  +G+K ++S+N L   +K+ +K++L+       L  ++ T++  
Sbjct: 112 IFTFKPLEPNFSKLNPVDGLKNLFSLNALFELVKNSLKVMLLLIASFFILYFSFHTLVFS 171

Query: 177 ISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQS 236
              +P   L      + K+LI I +    L  LD  +    +  ++KMSKQE+KDE KQ 
Sbjct: 172 SYMSPSKGLSEIARLIFKLLISIGIIGLMLAGLDFAYKKFDYEKRIKMSKQEVKDEFKQF 231

Query: 237 YGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQ 296
            GN  +K + +       R +MM+   +A+++ITNPTH+A+ALRYI  ++ AP++VAKGQ
Sbjct: 232 EGNIEVKAKIRRRMMELSRSRMMQEVPKASVVITNPTHFAVALRYIPKQDRAPIVVAKGQ 291

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           + +AKK+ +IA  +++P+  +P LAR+L+K V I   IPP FYKAVA++I  I  +K
Sbjct: 292 DYMAKKIIEIAELNDVPVVRKPELARALYKAVDIEEEIPPEFYKAVAEIIAYIVKRK 348


>gi|218689877|ref|YP_002398089.1| flagellar biosynthesis protein FlhB [Escherichia coli ED1a]
 gi|218427441|emb|CAR08339.2| flagellar export pore protein [Escherichia coli ED1a]
          Length = 382

 Score =  166 bits (420), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 110/364 (30%), Positives = 197/364 (54%), Gaps = 29/364 (7%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREAS--LFSSILACLIY---------LLFFFS 52
           +D  D+KTEAP+  ++E A  EG  P SRE +  L   +  C+I+         L    S
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVCVIWFGGVSLARRLSGMLS 61

Query: 53  PGIY---SVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGS 109
            G++   S+ +D +++L        E +  ++ L++ + L A  L+ P +L  ++F   S
Sbjct: 62  AGLHFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVA--LISPVMLGGLVFSGKS 119

Query: 110 YLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTEN 169
                        ++P F +++   GIKRI+S       +K+ +K ILVG++    L  +
Sbjct: 120 -------------LQPKFSKLNPLPGIKRIFSAQTGAELLKAILKTILVGSVTGFFLWHH 166

Query: 170 YFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEI 229
           +  M+  ++ +P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I
Sbjct: 167 WPQMMRLMAESPITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDI 226

Query: 230 KDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAP 289
           +DE KQS G+P +K R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP
Sbjct: 227 RDEFKQSEGDPHVKGRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAP 286

Query: 290 VLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKI 349
            +VAKG  L+A ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  +
Sbjct: 287 KVVAKGAGLVALRIREIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWV 346

Query: 350 YHKK 353
           +  K
Sbjct: 347 WQLK 350


>gi|107024383|ref|YP_622710.1| flagellar biosynthesis protein FlhB [Burkholderia cenocepacia AU
           1054]
 gi|116688291|ref|YP_833914.1| flagellar biosynthesis protein FlhB [Burkholderia cenocepacia
           HI2424]
 gi|105894572|gb|ABF77737.1| flagellar biosynthetic protein FlhB [Burkholderia cenocepacia AU
           1054]
 gi|116646380|gb|ABK07021.1| flagellar biosynthetic protein FlhB [Burkholderia cenocepacia
           HI2424]
          Length = 399

 Score =  166 bits (419), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 105/359 (29%), Positives = 179/359 (49%), Gaps = 29/359 (8%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSP----------GIYSV 58
           +KTEA + ++ E A  EG    SRE + F+ + A          P          G ++ 
Sbjct: 8   DKTEAATPRRREKAREEGQVARSRELASFALLAAGFYGAWLLAGPSGAHLQAMLRGAFTF 67

Query: 59  TS----DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQR 114
                 D H +L++A    LE  + ++ LL    ++A         L     +G +LI +
Sbjct: 68  DRATAFDTHRMLSAAGSASLEGFAALLPLLALTGVAA---------LLAPMALGGWLISQ 118

Query: 115 IPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTML 174
                    +  F R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L
Sbjct: 119 ------KTFELKFDRLNPISGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELL 172

Query: 175 DFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIK 234
              +    + L  A   V       +  +  +  LD+ +   Q+  KL+M+K+E+K E +
Sbjct: 173 GLATQPLGAALPDALHLVAVCCGTTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEVKREHR 232

Query: 235 QSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAK 294
           ++ G+P +K R +   R+  R +MM A  +A +++TNPTH+A+AL+Y   E  AP +VAK
Sbjct: 233 ENEGDPHVKGRIRQQQRAIARRRMMAAVPKADVVVTNPTHFAVALQYTDGEMRAPKVVAK 292

Query: 295 GQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           G NL+A ++R++A EHN+P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 293 GVNLVAARIRELAAEHNVPLLEAPPLARALYHNVELEREIPGSLYSAVAEVLAWVYQLK 351


>gi|206558545|ref|YP_002229305.1| flagellar biosynthesis protein FlhB [Burkholderia cenocepacia
           J2315]
 gi|198034582|emb|CAR50448.1| flagellar biosynthetic protein FlhB [Burkholderia cenocepacia
           J2315]
          Length = 399

 Score =  166 bits (419), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 105/359 (29%), Positives = 179/359 (49%), Gaps = 29/359 (8%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSP----------GIYSV 58
           +KTEA + ++ E A  EG    SRE + F+ + A          P          G ++ 
Sbjct: 8   DKTEAATPRRREKAREEGQVARSRELASFALLAAGFYGAWLLAGPSGAHLQAMLRGAFTF 67

Query: 59  TS----DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQR 114
                 D H +L++A    LE  + ++ LL    ++A         L     +G +LI +
Sbjct: 68  DRATAFDTHRMLSAAGSASLEGFAALLPLLALTGVAA---------LLAPMALGGWLISQ 118

Query: 115 IPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTML 174
                    +  F R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L
Sbjct: 119 ------KTFELKFDRLNPISGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELL 172

Query: 175 DFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIK 234
              +    + L  A   V       +  +  +  LD+ +   Q+  KL+M+K+E+K E +
Sbjct: 173 GLATQPLGAALPDALHLVAVCCGTTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEVKREHR 232

Query: 235 QSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAK 294
           ++ G+P +K R +   R+  R +MM A  +A +++TNPTH+A+AL+Y   E  AP +VAK
Sbjct: 233 ENEGDPHVKGRIRQQQRAIARRRMMAAVPKADVVVTNPTHFAVALQYTDGEMRAPKVVAK 292

Query: 295 GQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           G NL+A ++R++A EHN+P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 293 GVNLVAARIRELAAEHNVPLLEAPPLARALYHNVELEREIPGSLYSAVAEVLAWVYQLK 351


>gi|254246770|ref|ZP_04940091.1| Flagellar biosynthesis pathway, component FlhB [Burkholderia
           cenocepacia PC184]
 gi|124871546|gb|EAY63262.1| Flagellar biosynthesis pathway, component FlhB [Burkholderia
           cenocepacia PC184]
          Length = 414

 Score =  166 bits (419), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 105/359 (29%), Positives = 179/359 (49%), Gaps = 29/359 (8%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSP----------GIYSV 58
           +KTEA + ++ E A  EG    SRE + F+ + A          P          G ++ 
Sbjct: 23  DKTEAATPRRREKAREEGQVARSRELASFALLAAGFYGAWLLAGPSGAHLQAMLRGAFTF 82

Query: 59  TS----DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQR 114
                 D H +L++A    LE  + ++ LL    ++A         L     +G +LI +
Sbjct: 83  DRATAFDTHRMLSAAGSASLEGFAALLPLLALTGVAA---------LLAPMALGGWLISQ 133

Query: 115 IPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTML 174
                    +  F R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L
Sbjct: 134 ------KTFELKFDRLNPISGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELL 187

Query: 175 DFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIK 234
              +    + L  A   V       +  +  +  LD+ +   Q+  KL+M+K+E+K E +
Sbjct: 188 GLATQPLGAALPDALHLVAVCCGTTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEVKREHR 247

Query: 235 QSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAK 294
           ++ G+P +K R +   R+  R +MM A  +A +++TNPTH+A+AL+Y   E  AP +VAK
Sbjct: 248 ENEGDPHVKGRIRQQQRAIARRRMMAAVPKADVVVTNPTHFAVALQYTDGEMRAPKVVAK 307

Query: 295 GQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           G NL+A ++R++A EHN+P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 308 GVNLVAARIRELAAEHNVPLLEAPPLARALYHNVELEREIPGSLYSAVAEVLAWVYQLK 366


>gi|320325130|gb|EFW81199.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320329389|gb|EFW85382.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 378

 Score =  166 bits (419), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 102/351 (29%), Positives = 187/351 (53%), Gaps = 1/351 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+   +KTE P+ KK++D+  +G    S+E +    +L     LL F S GI  + S
Sbjct: 1   MAENENGQDKTEDPTEKKVKDSRADGQIARSKELTTLVVMLMGAGGLLMFGS-GIAQMMS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           +L     + ++  L D S++   L    L A  +++P L+  ++  +   ++    +   
Sbjct: 60  ELMRDNFTISRETLMDQSYMGKALLSSGLHALVVMLPFLIAMLVAALVGPIMLGGWLFAT 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++   G+KR++S + LV  +KSF K +++  +  + L+     ++  +   
Sbjct: 120 KSLMPKFSRMNPAAGLKRMFSPHALVELLKSFGKFLIILAVALVVLSNERNDLVAIVHEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V      +   +  +   D+ +  ++ + KL M+KQE++DE K S G+P
Sbjct: 180 LEQAMIHSLLVVGWSSFWMACGLIFIAAADVPFVLYEAHKKLLMTKQEVRDEHKNSEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM +   A +IITNPTH+A+AL+Y   +  AP+L+AKG +L+A
Sbjct: 240 EVKQRIRQLQREMSQRRMMASIPEADVIITNPTHFAVALKYDPEQGGAPMLLAKGTDLVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            K+R+I   + I I E  +LARS++    ++  IP   Y AVAQ++  +Y 
Sbjct: 300 LKIREIGAHNQILILESAALARSIYYSTELDQEIPAGLYLAVAQVLAYVYQ 350


>gi|290893976|ref|ZP_06556951.1| flagellar biosynthesis protein FlhB [Listeria monocytogenes FSL
           J2-071]
 gi|290556422|gb|EFD89961.1| flagellar biosynthesis protein FlhB [Listeria monocytogenes FSL
           J2-071]
          Length = 348

 Score =  166 bits (419), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 102/341 (29%), Positives = 183/341 (53%), Gaps = 5/341 (1%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A DNKTE  + ++I+ A NEGN   S+E +   S+L  +  LL+FF       T    V 
Sbjct: 2   AKDNKTEKATPRRIKKARNEGNVAKSKELNNAFSLL-IVAGLLYFFGEMFIKNTIQAFVA 60

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           L     +     S+ +F L        ++++P +++ ++FG+ +Y +Q   + +   VKP
Sbjct: 61  LLKQPPKLANMESYSLFYLMEFG----KVLMPIMVMVVIFGLMNYGVQVGILFSAKAVKP 116

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
            FKR++     KR++S+  +V  +KS + I L+  +  I   ++  T++ +   N    L
Sbjct: 117 QFKRLNPANYFKRVFSVKGIVEVVKSLLLITLLSYVAYIGFRDHLDTLISYTGQNWLYSL 176

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
              F   +   + + L IA + +LD  +  + +   L+MSKQEIKDE+K S G P +K R
Sbjct: 177 GQIFALFKNEFLALFLVIAVIGLLDFFYQRYDYKKGLRMSKQEIKDEMKDSEGRPEVKQR 236

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
           Q+SIAR  ++  + +  + AT ++ NPTH ++ +RY +T++ AP L+ KG++ +A  +R+
Sbjct: 237 QRSIARGLLQGSITKKMADATFVVNNPTHISVVMRYDKTKDHAPKLLVKGEDELALFIRQ 296

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           +A    +P+     LARS++     +  I    YK V +++
Sbjct: 297 VADTDGVPMITNRQLARSIYYTTNPDEYIQEDLYKDVIEVM 337


>gi|218699549|ref|YP_002407178.1| flagellar biosynthesis protein FlhB [Escherichia coli IAI39]
 gi|218369535|emb|CAR17304.1| flagellar export pore protein [Escherichia coli IAI39]
          Length = 382

 Score =  166 bits (419), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 108/367 (29%), Positives = 196/367 (53%), Gaps = 35/367 (9%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGI-------- 55
           +D  D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G+        
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVSVIWFGGVSLARRLSG 58

Query: 56  ---------YSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFG 106
                    +S+ +D +++L        E +  ++ L++ + L A  L+ P +L  ++F 
Sbjct: 59  MLSAGLHFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVA--LISPVMLGGLVFS 116

Query: 107 IGSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISL 166
             S             ++P F +++   GIKRI+S       +K+ +K ILVG++    L
Sbjct: 117 GKS-------------LQPKFSKLNPLPGIKRIFSAQTGAELLKAILKTILVGSVTGFFL 163

Query: 167 TENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSK 226
             ++  M+  ++ +P + + +A   V    ++++L +  +   D+ +       KL+MS+
Sbjct: 164 WHHWPQMMRLMAESPITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSR 223

Query: 227 QEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEN 286
           Q+I+DE KQS G+P +K R + + R+  R +MM    +A +I+ NPTHY++AL+Y + + 
Sbjct: 224 QDIRDEFKQSEGDPHVKGRIRQMLRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKM 283

Query: 287 DAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
            AP +VAKG  L+A ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++
Sbjct: 284 SAPKVVAKGAGLVALRIREIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVL 343

Query: 347 YKIYHKK 353
             ++  K
Sbjct: 344 AWVWQLK 350


>gi|312621587|ref|YP_004023200.1| flagellar biosynthetic protein flhb [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312202054|gb|ADQ45381.1| flagellar biosynthetic protein FlhB [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 366

 Score =  165 bits (418), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 104/344 (30%), Positives = 187/344 (54%), Gaps = 1/344 (0%)

Query: 10  KTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLASA 69
           KTE  + +K ++A   G    SRE +   ++L  +++L F +S  I  +         S 
Sbjct: 16  KTEKATPRKRQEARKRGMVAKSREVTSAFALLISVLFLKFGYSLIIVPLQQGSKYFF-SN 74

Query: 70  TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKR 129
               LEDIS    LL+ +  ++ ++V+P  +  M         Q   ++    +K SF++
Sbjct: 75  LNYSLEDISDASKLLSFIITTSLKIVLPFCVTIMFVAAIVEWAQSSFLITGQSLKMSFQK 134

Query: 130 VSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAF 189
           ++  EG KRI+SIN++V  +KS +K++++G             +L+    N  +I+  +F
Sbjct: 135 INPIEGFKRIFSINSVVELIKSVLKVLIIGYTGYCYTQTFAKKLLEMYEMNVFTIVRFSF 194

Query: 190 FTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKSI 249
            +   +++ + +    + V+D  +   Q+  KL M+K+E+K+E KQ+ GNP IK++ +  
Sbjct: 195 DSAINLILWMAVMFFGIAVIDFIFQRQQYEKKLMMTKEEVKEEFKQTEGNPQIKSKIRER 254

Query: 250 ARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYE 309
            R     +M +   +A ++ITNPTHYA+AL Y   + DAP ++AKG++ IA+K+++ A +
Sbjct: 255 QRRISLQRMFQQLPKADVVITNPTHYAVALLYEPEKFDAPRVIAKGKDYIAQKIKQEAIK 314

Query: 310 HNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           H I I E   LAR+L+    +   IPP  Y+AVA+++  +Y  K
Sbjct: 315 HRIEIVENRELARALYNMCEVGDFIPPELYQAVAEVLAYVYSLK 358


>gi|323703184|ref|ZP_08114837.1| flagellar biosynthetic protein FlhB [Desulfotomaculum nigrificans
           DSM 574]
 gi|323531843|gb|EGB21729.1| flagellar biosynthetic protein FlhB [Desulfotomaculum nigrificans
           DSM 574]
          Length = 354

 Score =  165 bits (418), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 104/349 (29%), Positives = 191/349 (54%), Gaps = 2/349 (0%)

Query: 5   DAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHV 64
           +    KTE  + +++++A  +G  P S + +    +LA  I+ L      I         
Sbjct: 3   EGSQEKTEQATPRRLQEARRKGQVPKSADLNGALLLLAAGIFALMAKDSLISHTQRAFFG 62

Query: 65  LLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVK 124
              +   R+ +D S +V  L   +++     +P  L+ M+  +G+ + Q   +     + 
Sbjct: 63  YFNNLVVRRPQD-SQLVEYLIDFTVNIFASFMPFFLILMVVAVGANMAQVGFLFAPEVIL 121

Query: 125 PSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSI 184
           P  + ++   G+KRI+S  +L   +KS +K+ILVG +I  ++   +  +L    + P ++
Sbjct: 122 PKLEHLNPINGLKRIFSGRSLFELVKSILKVILVGWVIYAAVRGEFANLLAIFQSPPQTM 181

Query: 185 LYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKN 244
           L        KV+I        L++LD+ +  + +  +++MSKQE+K+E KQ+ G+P IK 
Sbjct: 182 LDQVLTVALKVIIWGTAAYLALSILDLMYQRYAFQKQMRMSKQEVKEEYKQTEGDPQIKG 241

Query: 245 RQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMR 304
             +   R  + + + +   +AT+++TNPTHYA+AL+Y + + DAPV+VAKG +L+AK++R
Sbjct: 242 WLRRRQRQLLMNLVRKEVPQATVVVTNPTHYAVALKY-ERDMDAPVVVAKGVDLLAKQIR 300

Query: 305 KIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           ++A EH+IP+ E   +AR L+  V I  AIP   Y+AVA+++  +Y  K
Sbjct: 301 EVAREHDIPVIENVEVARFLYAHVEIGQAIPVEMYQAVAEILAMVYRLK 349


>gi|323968302|gb|EGB63709.1| flagellar biosynthetic protein FlhB [Escherichia coli M863]
 gi|327253009|gb|EGE64663.1| flagellar biosynthetic protein FlhB [Escherichia coli STEC_7v]
          Length = 382

 Score =  165 bits (418), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 109/364 (29%), Positives = 197/364 (54%), Gaps = 29/364 (7%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREAS--LFSSILACLIY---------LLFFFS 52
           +D  D+KTEAP+  ++E A  EG  P SRE +  L   +  C+I+         L    S
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVCVIWFGGVSLARRLSGMLS 61

Query: 53  PGIY---SVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGS 109
            G++   S+ +D +++L        E +  ++ L++ + L A  L+ P +L  ++F   S
Sbjct: 62  AGLHFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVA--LISPVMLGGLVFSGKS 119

Query: 110 YLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTEN 169
                        ++P F +++   GIKR++S       +K+ +K ILVG++    L  +
Sbjct: 120 -------------LQPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFYLWHH 166

Query: 170 YFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEI 229
           +  M+  ++ +P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I
Sbjct: 167 WPQMMRLMAESPITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDI 226

Query: 230 KDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAP 289
           +DE KQS G+P +K R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP
Sbjct: 227 RDEFKQSEGDPHVKGRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAP 286

Query: 290 VLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKI 349
            +VAKG  L+A ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  +
Sbjct: 287 KVVAKGAGLVALRIREIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWV 346

Query: 350 YHKK 353
           +  K
Sbjct: 347 WQLK 350


>gi|323174603|gb|EFZ60224.1| flagellar biosynthetic protein FlhB [Escherichia coli LT-68]
          Length = 382

 Score =  165 bits (418), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 109/364 (29%), Positives = 197/364 (54%), Gaps = 29/364 (7%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREAS--LFSSILACLIY---------LLFFFS 52
           +D  D+KTEAP+  ++E A  EG  P SRE +  L   +  C+I+         L    S
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVCVIWFGGVSLARRLSGMLS 61

Query: 53  PGIY---SVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGS 109
            G++   S+ +D +++L        E +  ++ L++ + L A  L+ P +L  ++F   S
Sbjct: 62  AGLHFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVA--LISPVMLGGLVFSGKS 119

Query: 110 YLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTEN 169
                        ++P F +++   GIKR++S       +K+ +K ILVG++    L  +
Sbjct: 120 -------------LQPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHH 166

Query: 170 YFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEI 229
           +  M+  ++ +P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I
Sbjct: 167 WPQMMRLMAESPITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDI 226

Query: 230 KDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAP 289
           +DE KQS G+P +K R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP
Sbjct: 227 RDEFKQSEGDPHVKGRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAP 286

Query: 290 VLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKI 349
            +VAKG  L+A ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  +
Sbjct: 287 KVVAKGAGLVALRIREIGVENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWV 346

Query: 350 YHKK 353
           +  K
Sbjct: 347 WQLK 350


>gi|170683078|ref|YP_001743365.1| flagellar biosynthesis protein FlhB [Escherichia coli SMS-3-5]
 gi|170520796|gb|ACB18974.1| flagellar biosynthetic protein FlhB [Escherichia coli SMS-3-5]
          Length = 382

 Score =  165 bits (418), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 106/353 (30%), Positives = 195/353 (55%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G+ S+   L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVCVIWFGGV-SLARRLS 57

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++        + D + I+  +  L   A   ++P +   ++  I S ++    V + 
Sbjct: 58  GMLSAGLHFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVAIISPVMLGGLVFSG 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +
Sbjct: 118 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAES 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P
Sbjct: 178 PITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A
Sbjct: 238 HVKGRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 298 LRIREIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|78064847|ref|YP_367616.1| flagellar biosynthesis protein FlhB [Burkholderia sp. 383]
 gi|77965592|gb|ABB06972.1| Flagellar biosynthetic protein FlhB [Burkholderia sp. 383]
          Length = 398

 Score =  165 bits (418), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 103/359 (28%), Positives = 178/359 (49%), Gaps = 29/359 (8%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSP----------GIYSV 58
           +KTEA + ++ E A  EG    SRE + F+ + A          P          G ++ 
Sbjct: 8   DKTEAATPRRREKAREEGQVARSRELASFALLAAGFYGAWLLAGPSGGHLQAMLRGAFTF 67

Query: 59  TS----DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQR 114
                 D + +L++A    LE  + ++ +L    ++A         L     +G +LI  
Sbjct: 68  DRATAFDTNRMLSAAGSASLEGFAALLPILALTGVAA---------LLAPMALGGWLI-- 116

Query: 115 IPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTML 174
               +    +  F R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L
Sbjct: 117 ----SSKTFELKFDRLNPISGLGRIFSIQGPIQLGMSLAKTLVVGGIGGIAIWRSKDELL 172

Query: 175 DFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIK 234
              +      L  A   V       +  +  +  LD+ +   Q+  KL+M+K+E+K E +
Sbjct: 173 GLATQPLGVALPDALHLVAVCCGTTVAGMLVVAALDVPYQIWQYNKKLRMTKEEVKREHR 232

Query: 235 QSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAK 294
           ++ G+P +K R +   R+  R +MM A  +A +++TNPTH+A+AL+Y   E  AP +VAK
Sbjct: 233 ENEGDPHVKGRIRQQQRAIARRRMMAAVPKADVVVTNPTHFAVALQYTDGEMRAPKVVAK 292

Query: 295 GQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           G NL+A ++R++A EHN+P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 293 GVNLVAARIRELAAEHNVPLLEAPPLARALYHNVELEREIPGSLYSAVAEVLAWVYQLK 351


>gi|323527726|ref|YP_004229879.1| flagellar biosynthetic protein FlhB [Burkholderia sp. CCGE1001]
 gi|323384728|gb|ADX56819.1| flagellar biosynthetic protein FlhB [Burkholderia sp. CCGE1001]
          Length = 401

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 106/352 (30%), Positives = 183/352 (51%), Gaps = 19/352 (5%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE+ + ++++ A  EG    SRE S F+ +LA   + ++  S    S+   L  +L +
Sbjct: 8   EKTESATPRRLQKAREEGQIVRSRELSTFA-LLAAGFFGVWGMS---GSIGEHLQAMLRA 63

Query: 69  ATQRKLEDISHIVFLLTHLSLS----ASRLVIPGLLLFMMFGIGSYLIQRIPV-----LN 119
           A         H     TH  ++    ASR  +  LL  + F  G+  +          L+
Sbjct: 64  AFT-----FDHASAFETHRMMAGAGAASREGLYALLPILAF-TGAAALLAPMALGGWQLS 117

Query: 120 LNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISA 179
              ++P F R++   G+ +I+SIN  +    S  K ++VG I   ++      +L   + 
Sbjct: 118 AKGLEPKFDRLNPIAGLGKIFSINGPIQLGMSLAKTLVVGVIGGTAIWNRREEILALATQ 177

Query: 180 NPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
             H  L +    +     M +  +  +  LD+ +   Q++ KL+MSK+E+K E ++S G+
Sbjct: 178 PLHLALANTVHLIAVCCGMTVAGMFVVAALDVPYQLWQFHKKLRMSKEEVKREHRESEGD 237

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLI 299
           P +K R +   R+  R +MM    +A +++TNPTH+A+AL+Y   E  AP +VAKG NL+
Sbjct: 238 PHVKGRIRQQQRAIARRRMMTQVPKADVVVTNPTHFAVALQYTDGEMRAPKVVAKGVNLV 297

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           A ++R++A E+N+P+ E P LAR+L+  V +N  IP   Y AVA+++  +Y 
Sbjct: 298 AARIRELAAENNVPLLEAPPLARALYHNVELNREIPGQLYGAVAEVLAWVYQ 349


>gi|331647476|ref|ZP_08348568.1| flagellar biosynthetic protein FlhB [Escherichia coli M605]
 gi|330911689|gb|EGH40199.1| flagellar biosynthesis protein FlhB [Escherichia coli AA86]
 gi|331043200|gb|EGI15338.1| flagellar biosynthetic protein FlhB [Escherichia coli M605]
          Length = 382

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 106/353 (30%), Positives = 195/353 (55%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G+ S+   L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVCVIWFGGV-SLARRLS 57

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++        + D + I+  +  L   A   ++P +   ++  I S ++    V + 
Sbjct: 58  GMLSAGLHFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVAIISPVMLGGLVFSG 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +
Sbjct: 118 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAES 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P
Sbjct: 178 PITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A
Sbjct: 238 HVKGRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 298 LRIREIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|134094535|ref|YP_001099610.1| part of export apparatus for flagellar proteins [Herminiimonas
           arsenicoxydans]
 gi|133738438|emb|CAL61483.1| Flagellar biosynthetic protein FlhB [Herminiimonas arsenicoxydans]
          Length = 390

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 107/350 (30%), Positives = 184/350 (52%), Gaps = 15/350 (4%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE  S +K+E A  +G+ P SRE +  + +L       F+F+ G  ++ ++L+ +LAS
Sbjct: 8   EKTEPASPRKLEQAREQGDVPRSRELATCTLLLGA--SAAFWFTGG--NMIAELNSMLAS 63

Query: 69  ATQRKLEDISHIVFLLTHLSLSASRLVI---PGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
                 E    +  LL H + S  +L+I   P  L+ ++  + S ++    + +   ++P
Sbjct: 64  GLSFDREMAFDMELLLAHAAASIIKLLIAFAPAALILIVVALASPMLIGGWLFSAQALQP 123

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
           +F R++  +G+  + S  + V   K+  K IL+G I    +      +L  +S  P   L
Sbjct: 124 NFGRMNPIKGLGNMVSTRSAVELGKAIAKTILIGCIAWTVMKYEIDGVL-ALSVTP---L 179

Query: 186 YHAFFTVRKVLIMILLFIAT--LTVLDIGWSYHQWY--SKLKMSKQEIKDEIKQSYGNPI 241
                 V  +L++   FI +  + +  I   Y  W    KL MS+Q+++ E K+S GNP 
Sbjct: 180 QSGIEQVGHILLISFTFIVSGLIIIAGIDAPYQMWQHAKKLMMSRQDVRQESKESDGNPE 239

Query: 242 IKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAK 301
           IK + +   R   R +MM     A +++TNPTHYA+AL+Y +    AP +VAKG + +A 
Sbjct: 240 IKAKIRQQQREMARRRMMTEVPTADVVVTNPTHYAVALKYSENGMRAPTVVAKGADEVAA 299

Query: 302 KMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           K+R+IA E+N+ + E P LAR+LF+   +   IP   Y AVA+++  ++ 
Sbjct: 300 KIREIALENNVVMLEAPPLARALFRHAELGDEIPEALYIAVAEVLAYVFQ 349


>gi|331653290|ref|ZP_08354295.1| flagellar biosynthetic protein FlhB [Escherichia coli M718]
 gi|331049388|gb|EGI21460.1| flagellar biosynthetic protein FlhB [Escherichia coli M718]
          Length = 382

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 105/353 (29%), Positives = 197/353 (55%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G+ S+   L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVSVIWFGGV-SLARRLS 57

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++        ++D + I+  +  L   A   ++P +   ++  + S ++    V + 
Sbjct: 58  GMLSAGLHFDHSIIKDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSG 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S+      +K+ +K ILVG++    L  ++  M+  ++ +
Sbjct: 118 KSLQPKFSKLNPLPGIKRMFSVQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAES 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P
Sbjct: 178 PITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A
Sbjct: 238 HVKGRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 298 LRIREIGSENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|238927446|ref|ZP_04659206.1| flagellar biosynthesis protein FlhB [Selenomonas flueggei ATCC
           43531]
 gi|238884728|gb|EEQ48366.1| flagellar biosynthesis protein FlhB [Selenomonas flueggei ATCC
           43531]
          Length = 374

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 107/356 (30%), Positives = 181/356 (50%), Gaps = 19/356 (5%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A   KTE P++KK  DA  +G    S+E +    +L     L   +     S+      +
Sbjct: 24  AGGEKTEEPTAKKRADARKKGQVGRSQELNTAFVLLIGFFSLKLLWDYIYLSIAGYTTYV 83

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
            ++  Q  + D  +I+ +   +++  ++   P +   M+ G+     Q     N   ++ 
Sbjct: 84  FSNLNQ--VVDAENILRIFIGIAIVLAKTAFPIMFAIMLIGLAINFFQVGLTFNTESIEF 141

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDF--------I 177
              +++   G  RI+S  +LV   KSF KI+++G  +   + E    M  F        +
Sbjct: 142 KLDKLNPINGFGRIFSKRSLVELAKSFFKILVIGFFLYRFIHEQILAMPQFMFFDLTTSL 201

Query: 178 SANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSY 237
           S     I + AF  +  +++M L+        D G+   Q    LKM+KQE+KDE+KQS 
Sbjct: 202 SLVAEIIFHMAFIVIGVIMVMALM--------DYGYQKWQTTQDLKMTKQEVKDEMKQSE 253

Query: 238 GNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQN 297
           G+P IK + +   R     +MM+   +A +IITNPTH+A+AL Y Q    AP++VAKGQ+
Sbjct: 254 GDPQIKGKIRQKQRQMAMARMMKEVPKADVIITNPTHFAIALSY-QQGMSAPLVVAKGQD 312

Query: 298 LIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           ++A+++++IA E  +PI E   LAR+++  V I  AIP   Y+AVA+++  +Y  K
Sbjct: 313 IVAQRIKEIAREARVPIVENKPLARAIYAAVQIGDAIPQELYQAVAEVLAYVYRLK 368


>gi|291562038|emb|CBL40854.1| flagellar biosynthetic protein FlhB [butyrate-producing bacterium
           SS3/4]
          Length = 357

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 107/345 (31%), Positives = 190/345 (55%), Gaps = 6/345 (1%)

Query: 10  KTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLASA 69
           KTE P++KK  DA  EGN   SR+ +    ILA + + +  + P IY    +    +   
Sbjct: 8   KTEQPTAKKRRDARKEGNIFQSRDVATVV-ILAGIFFGIRIWLPFIYGQMKNYMTWVIDG 66

Query: 70  TQRKLEDI--SHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
             R  ED+  + +VF+   + L  +  +   LLL ++ GI ++ +Q    ++   ++P +
Sbjct: 67  AARSSEDMLSASLVFVTLSVFLKCALPL---LLLALLLGIVAHGVQTRFNVSFKSIRPKW 123

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
            R++   GIKR++S+ N V  +K+ +KI L+  ++   L ++   M   I  NP +   +
Sbjct: 124 NRLNPLSGIKRLFSMKNAVELVKNSIKITLLLVLLYNILKQDLQPMASMIDMNPAASAAY 183

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
               +  +LI + +    +   D  +   ++  +L+M+KQE+KDE KQ+ GNP IKNR K
Sbjct: 184 MMKMIFDLLIRVCIAFMVIAFGDYLYQRWEYEKELRMTKQEVKDEYKQTEGNPEIKNRIK 243

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
           S+ R     +MM+   +A +II NPTH A+AL+Y    ++APV++AKG + +A ++ K+ 
Sbjct: 244 SLQRQMASSRMMQKVPQADVIIRNPTHVAIALKYDPDHDNAPVVLAKGLDELALRIVKVG 303

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
            E+N+   E   LAR+++    ++  IP  FY AVA+++  +Y +
Sbjct: 304 EENNVYTIENKPLARAMYNSCELDRPIPSEFYTAVAEILVYLYKQ 348


>gi|220925376|ref|YP_002500678.1| flagellar biosynthetic protein FlhB [Methylobacterium nodulans ORS
           2060]
 gi|219949983|gb|ACL60375.1| flagellar biosynthetic protein FlhB [Methylobacterium nodulans ORS
           2060]
          Length = 353

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 106/353 (30%), Positives = 182/353 (51%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+ +   +++TE P+ K+++DA+  G+   S E +    +    + LL            
Sbjct: 1   MAGDTEQEDRTEEPTLKRLDDAIKRGDVATSVEVNTLFLLGGFTLVLLVAAGSAARGFAL 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           D+   LAS       D +    +      +    V   +   +  G+   L+Q   V   
Sbjct: 61  DMRGFLAS-LHAVPSDAAAYQAVARRALAALGLAVAVPVGAAVAAGLAGGLLQHPFVWTT 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +   ++RVS   G++R++       F K  VKI LVGT+  + L  +   +  F   +
Sbjct: 120 ETLSAKWERVSPLAGLRRLFGPEAWFQFGKGLVKIALVGTVAGLVLWGDRDRLEAFARLD 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P +IL      V +++  IL     L + D  +   +W ++L+M++ EIK+E+K+S GNP
Sbjct: 180 PAAILPATLVLVLRLMAGILAAYVVLALGDAVYQRLRWRARLRMTRTEIKEELKESDGNP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + +  +R R +MM A   AT+++ NPTH+A+ALRY +T   APV VAKG + +A
Sbjct: 240 EVKARLRQLRHARARKRMMAAVPTATVVVANPTHFAVALRY-ETGMAAPVCVAKGVDALA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+IA  + +P+ E P LAR+L   V I++AIP   YKAVA++I  +  ++
Sbjct: 299 LRIREIAGANGVPVVENPPLARALHATVEIDAAIPTEHYKAVAEVIGFVLRQR 351


>gi|395390|emb|CAA52218.1| flagellar biosynthetic protein [Bacillus subtilis]
          Length = 360

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 114/351 (32%), Positives = 187/351 (53%), Gaps = 13/351 (3%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIY---SVTSDLHVL 65
            KTE  + KK +D   +G    S + +   S ++ L+  L   + G Y    + S +   
Sbjct: 13  EKTEKATPKKRKDTRKKGQVAKSSDVN---SAVSLLVIFLSLIAIGPYMRDRLLSFIETF 69

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
              +   KL + S++  L   L      ++ P LL+ ++ G+ S  +Q   + +   ++P
Sbjct: 70  YTESLTMKLSE-SNVHTLFVSLLKDMGMILAPILLVALVAGVVSNYMQVGFLFSAEVIQP 128

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
             +++   +G KRIYS+  +V  +KS +KI++VG      L  +Y  +L      P   L
Sbjct: 129 KLEKLDPIKGFKRIYSMRAIVELIKSILKIVVVGFAAFAVLWLHYGEILRLPLLTPEEAL 188

Query: 186 YHAFFTVRKVLIMILLFIATLTVL---DIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPII 242
               F  +  L M L     L +L   D  +    +   +KMSKQ+IKDE K+S G+PII
Sbjct: 189 S---FVSKLTLWMGLSGAGALLILAGLDYLYQRFDYEKNIKMSKQDIKDEYKKSEGDPII 245

Query: 243 KNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKK 302
           K++ K   R     +MM+   +A +IITNPTHYA+AL+Y + + DAP +VAKG + +A K
Sbjct: 246 KSKIKQRQREMAMRRMMQEVPKADVIITNPTHYAIALKYDEEKMDAPYIVAKGVDHLALK 305

Query: 303 MRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +RKIA EH++ + E   LAR+L+ QV I+ A+P  F+K +A+++  +Y  K
Sbjct: 306 IRKIAKEHDVMMVENRPLARALYDQVEIDQAVPEEFFKVLAEILAYVYKTK 356


>gi|154686055|ref|YP_001421216.1| flagellar biosynthesis protein FlhB [Bacillus amyloliquefaciens
           FZB42]
 gi|154351906|gb|ABS73985.1| FlhB [Bacillus amyloliquefaciens FZB42]
          Length = 359

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 119/358 (33%), Positives = 192/358 (53%), Gaps = 27/358 (7%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREAS-------LFSSILACLIYL---LFFFSPGIYSV 58
            KTE  + KK +D   +G    S + +       +F S++A   Y+   L  F    Y+ 
Sbjct: 13  EKTEKATPKKRKDTRKKGQVAKSTDVNTAVSLLIIFLSLIALGPYMRDRLLSFIKTFYTK 72

Query: 59  TSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVL 118
           +  LH L ASA         H +F+ T   +S   ++ P +L+ ++ G+ S  +Q   + 
Sbjct: 73  SISLH-LSASAV--------HELFVDTVKDISL--ILAPIMLVALVAGVVSNYMQVGFLF 121

Query: 119 NLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFIS 178
           +   +KP   ++S  +G KRIYS+  +V  +KS +KI +VG    + L  +Y  +L    
Sbjct: 122 SAEVLKPDLNKLSPLKGFKRIYSMRAIVELVKSILKITVVGFAAFMVLWLHYGDILRLPL 181

Query: 179 ANPHSILYHAFFTVRKVLIMILLFIATLTVL---DIGWSYHQWYSKLKMSKQEIKDEIKQ 235
             P  +L    F  +  L M L     L +L   D  +    +   ++MSKQ+IKDE K+
Sbjct: 182 LTPAEVLT---FVSKLTLWMGLAGSGALMLLAGLDYLYQRFDYEKNIRMSKQDIKDEYKK 238

Query: 236 SYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKG 295
           S G+PIIK++ K   R     +MM+   +A +IITNPTHYA+AL+Y + + DAP +VAKG
Sbjct: 239 SEGDPIIKSKIKQKQREMAMRRMMQEVPKADVIITNPTHYAIALKYDEKKMDAPYIVAKG 298

Query: 296 QNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            + +A K+R+IA EH++   E   LAR+L+ QV I+ A+P  F+K +A+++  +Y  K
Sbjct: 299 VDHLALKIRQIAKEHDVMTIENRPLARALYDQVDIDQAVPEEFFKVIAEILAYVYKTK 356


>gi|304438443|ref|ZP_07398383.1| flagellar biosynthetic protein FlhB [Selenomonas sp. oral taxon 149
           str. 67H29BP]
 gi|304368526|gb|EFM22211.1| flagellar biosynthetic protein FlhB [Selenomonas sp. oral taxon 149
           str. 67H29BP]
          Length = 374

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 105/348 (30%), Positives = 180/348 (51%), Gaps = 3/348 (0%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A   KTE P++KK  DA  +G    S+E +    +L     L   +     S+ S    +
Sbjct: 24  AGGEKTEEPTAKKRADARKKGQVGRSQELNTAFVLLVGFFTLKLLWDSIYLSIASYTTYV 83

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
             +  Q    D  +I+ +   + +  ++   P +   M+ G+     Q     N   ++ 
Sbjct: 84  FTNLNQSV--DTENIIHIFIGIIVVLAKTAFPVMFAIMLIGLAINFFQVGLTFNTESIEF 141

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
              +++   G  RI+S  +LV   KSF KI+++G  +   + E    M  F+  +  + L
Sbjct: 142 KLDKLNPINGFGRIFSKRSLVELAKSFFKILVIGFFLYRFIHEQILAMPQFMFFDLTTSL 201

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
                 + ++  +++  I  + ++D G+   Q    LKM+KQE+KDE+KQS G+P IK +
Sbjct: 202 ALVAEIIFQMAFIVIGVIMIMALMDYGYQKWQTTQDLKMTKQEVKDEMKQSEGDPQIKGK 261

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
            +   R     +MM+   +A +I+TNPTHYA+AL Y Q    AP++VAKGQ+L+A+++++
Sbjct: 262 IRQKQRQMAMARMMKEVPKADVIVTNPTHYAIALSY-QQGMSAPLVVAKGQDLVAQRIKE 320

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           IA E  +PI E   LAR+++  V I  AIP   Y+AVA+++  +Y  K
Sbjct: 321 IAREARVPIIENKPLARAIYAAVQIGDAIPQELYQAVAEVLAYVYRLK 368


>gi|218705380|ref|YP_002412899.1| flagellar biosynthesis protein FlhB [Escherichia coli UMN026]
 gi|293405373|ref|ZP_06649365.1| flagellar biosynthetic protein flhB [Escherichia coli FVEC1412]
 gi|298381016|ref|ZP_06990615.1| flagellar biosynthetic protein flhB [Escherichia coli FVEC1302]
 gi|300899130|ref|ZP_07117412.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 198-1]
 gi|218432477|emb|CAR13370.1| flagellar export pore protein [Escherichia coli UMN026]
 gi|291427581|gb|EFF00608.1| flagellar biosynthetic protein flhB [Escherichia coli FVEC1412]
 gi|298278458|gb|EFI19972.1| flagellar biosynthetic protein flhB [Escherichia coli FVEC1302]
 gi|300357248|gb|EFJ73118.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 198-1]
          Length = 382

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 109/364 (29%), Positives = 197/364 (54%), Gaps = 29/364 (7%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREAS--LFSSILACLIY---------LLFFFS 52
           +D  D+KTEAP+  ++E A  EG  P SRE +  L   +  C+I+         L    S
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVCVIWFGGVSLARRLSGMLS 61

Query: 53  PGIY---SVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGS 109
            G++   S+ +D +++L        E +  ++ L++ + L A  L+ P +L  ++F   S
Sbjct: 62  AGLHFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVA--LISPVMLGGLVFSGKS 119

Query: 110 YLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTEN 169
                        ++P F +++   GIKR++S       +K+ +K ILVG++    L  +
Sbjct: 120 -------------LQPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHH 166

Query: 170 YFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEI 229
           +  M+  ++ +P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I
Sbjct: 167 WPQMMRLMAESPITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDI 226

Query: 230 KDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAP 289
           +DE KQS G+P +K R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP
Sbjct: 227 RDEFKQSEGDPHVKGRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAP 286

Query: 290 VLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKI 349
            +VAKG  L+A ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  +
Sbjct: 287 KVVAKGAGLVALRIREIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWV 346

Query: 350 YHKK 353
           +  K
Sbjct: 347 WQLK 350


>gi|116872068|ref|YP_848849.1| flagellar biosynthesis protein FlhB [Listeria welshimeri serovar 6b
           str. SLCC5334]
 gi|116740946|emb|CAK20066.1| flagellar biosynthetic protein FlhB, putative [Listeria welshimeri
           serovar 6b str. SLCC5334]
          Length = 348

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 101/341 (29%), Positives = 183/341 (53%), Gaps = 5/341 (1%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A DNKTE  + ++I+ A NEGN   S+E +   S+L  +  LL+FF       T    V 
Sbjct: 2   AKDNKTEKATPRRIKKARNEGNVAKSKELNNAFSLL-IVAGLLYFFGEMFIKNTIQAFVA 60

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           L     +     S+ +F L        ++++P +++ ++FG+ +Y +Q   + +   VKP
Sbjct: 61  LLKQPPKLANMESYSLFYLMEFG----KVLMPIMVMVVIFGLMNYAVQVGILFSAKAVKP 116

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
            FKR++     KR++S+  +V  +K+ + I L+  +  I   ++  T++ +   N    L
Sbjct: 117 QFKRLNPANYFKRVFSVKGIVEVVKALLLITLLSYVAYIGFRDHLDTLISYTGQNWLYSL 176

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
              F   +   + + L IA + +LD  +  + +   L+MSKQEIKDE+K S G P +K R
Sbjct: 177 SQIFALFKNEFLALFLVIAVIGLLDFFYQRYDYKKGLRMSKQEIKDEMKDSEGRPEVKQR 236

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
           Q+SIAR  ++  + +  + AT ++ NPTH ++ +RY + ++ AP L+AKG++ +A  +R+
Sbjct: 237 QRSIARGLLQGSITKKMADATFVVNNPTHISVVMRYDKAKDHAPKLLAKGEDELALFIRQ 296

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           +A    +P+     LARS++     +  I    YK V +++
Sbjct: 297 VADTDGVPMITNRQLARSIYYTTNPDEYIQEDLYKDVIEVM 337


>gi|330876032|gb|EGH10181.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 378

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 102/351 (29%), Positives = 187/351 (53%), Gaps = 1/351 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+   +KTE P+ KK++D+  EG    S+E +    +L     LL F + GI  + S
Sbjct: 1   MAENENGQDKTEDPTEKKVKDSRAEGQIARSKELTTLVVMLMGAGGLLMFGT-GIAQMMS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           +L     + ++  + D S++   L    L A  +++P L+  +   +   ++    + + 
Sbjct: 60  ELMRDNFTISRETIMDQSYMGKALLSSGLHALVVMLPFLIAMLAAALVGPILLGGWLFST 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++   G+KR++S + LV  +KSF K +++  +  + L++    ++      
Sbjct: 120 KSLMPKFSRMNPAAGLKRMFSPHALVELLKSFGKFLIILAVALVVLSKERNDLVAIAHEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V      +   +  +   D+ +  ++ + KL M+KQE++DE K S G+P
Sbjct: 180 LEQAMIHSLLVVGWSSFWMACGLMFIAAADVPFVLYEAHKKLLMTKQEVRDEHKNSEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R + + R   + +MM +   A +IITNPTH+A+AL+Y   +  AP+L+AKG +L+A
Sbjct: 240 EIKQRIRQLQREMSQRRMMASIPEADVIITNPTHFAVALKYDPEQGGAPMLLAKGTDLVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            K+R+I   + I I E  +LARS++    ++  IP   Y AVAQ++  +Y 
Sbjct: 300 LKIREIGAHNQILILESAALARSIYYSTELDQEIPAGLYLAVAQVLAYVYQ 350


>gi|300917538|ref|ZP_07134195.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 115-1]
 gi|300415243|gb|EFJ98553.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 115-1]
          Length = 382

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 105/353 (29%), Positives = 196/353 (55%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G+ S+   L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVCVIWFGGV-SLARRLS 57

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++        ++D + I+  +  L   A   ++P +   ++  + S ++    V + 
Sbjct: 58  GMLSAGLHFDHSIIKDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSG 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +
Sbjct: 118 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLLAES 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P
Sbjct: 178 PITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A
Sbjct: 238 HVKGRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 298 LRIREIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|218673114|ref|ZP_03522783.1| flagellar biosynthesis protein FlhB [Rhizobium etli GR56]
          Length = 137

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 72/127 (56%), Positives = 104/127 (81%)

Query: 224 MSKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQ 283
           M++ E+K+E KQ+ G+P +K+RQ+S+ R R R +M+    RAT++I NPTHYA+ALRY +
Sbjct: 1   MTRHEVKEENKQAQGDPFVKSRQRSLMRDRARRRMIANVHRATLVIANPTHYAVALRYAR 60

Query: 284 TENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVA 343
            ENDAPV++AKGQ+LIA K+R+IA ++ IP+FE+P LARS+F QV ++S IP VFYKAVA
Sbjct: 61  EENDAPVVLAKGQDLIALKIREIAEQNGIPVFEDPPLARSMFAQVSVDSVIPSVFYKAVA 120

Query: 344 QLIYKIY 350
           +LI+++Y
Sbjct: 121 ELIHRVY 127


>gi|15802292|ref|NP_288317.1| flagellar biosynthesis protein FlhB [Escherichia coli O157:H7
           EDL933]
 gi|12515942|gb|AAG56870.1|AE005410_6 putative part of export apparatus for flagellar proteins
           [Escherichia coli O157:H7 str. EDL933]
          Length = 382

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 106/353 (30%), Positives = 197/353 (55%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G+ S+   L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVSVIWFGGV-SLARRLS 57

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++        ++D + I+  +  L   A   ++P +   ++  + S ++    V + 
Sbjct: 58  GMLSAGLHFDHSIIKDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSG 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +
Sbjct: 118 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPHMMRLMAES 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P
Sbjct: 178 PITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A
Sbjct: 238 HVKGRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  E+N+P  E P LAR+L++ V I   IP   Y AVA+++  ++  K
Sbjct: 298 LRIREIGXENNVPTLEAPPLARALYRHVEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|16802721|ref|NP_464206.1| flagellar biosynthesis protein FlhB [Listeria monocytogenes EGD-e]
 gi|46906930|ref|YP_013319.1| flagellar biosynthesis protein FlhB [Listeria monocytogenes
           serotype 4b str. F2365]
 gi|47091642|ref|ZP_00229438.1| flagellar biosynthetic protein flhB, putative [Listeria
           monocytogenes str. 4b H7858]
 gi|47095244|ref|ZP_00232855.1| flagellar biosynthetic protein flhB, putative [Listeria
           monocytogenes str. 1/2a F6854]
 gi|217965223|ref|YP_002350901.1| flagellar biosynthesis protein [Listeria monocytogenes HCC23]
 gi|224498762|ref|ZP_03667111.1| flagellar biosynthesis protein FlhB [Listeria monocytogenes Finland
           1988]
 gi|224502016|ref|ZP_03670323.1| flagellar biosynthesis protein FlhB [Listeria monocytogenes FSL
           R2-561]
 gi|226223310|ref|YP_002757417.1| flagellar biosynthetic protein flhB [Listeria monocytogenes
           Clip81459]
 gi|254824041|ref|ZP_05229042.1| flagellar biosynthesis protein FlhB [Listeria monocytogenes FSL
           J1-194]
 gi|254829336|ref|ZP_05234023.1| flagellar biosynthesis protein FlhB [Listeria monocytogenes FSL
           N3-165]
 gi|254830330|ref|ZP_05234985.1| flagellar biosynthesis protein FlhB [Listeria monocytogenes 10403S]
 gi|254900085|ref|ZP_05260009.1| flagellar biosynthesis protein FlhB [Listeria monocytogenes J0161]
 gi|254911362|ref|ZP_05261374.1| conserved hypothetical protein [Listeria monocytogenes J2818]
 gi|254932041|ref|ZP_05265400.1| flagellar biosynthesis protein FlhB [Listeria monocytogenes
           HPB2262]
 gi|254935689|ref|ZP_05267386.1| flagellar biosynthesis protein FlhB [Listeria monocytogenes F6900]
 gi|254992440|ref|ZP_05274630.1| flagellar biosynthesis protein FlhB [Listeria monocytogenes FSL
           J2-064]
 gi|255521624|ref|ZP_05388861.1| flagellar biosynthesis protein FlhB [Listeria monocytogenes FSL
           J1-175]
 gi|284801009|ref|YP_003412874.1| flagellar biosynthesis protein FlhB [Listeria monocytogenes
           08-5578]
 gi|284994151|ref|YP_003415919.1| flagellar biosynthesis protein FlhB [Listeria monocytogenes
           08-5923]
 gi|16410068|emb|CAC98757.1| lmo0679 [Listeria monocytogenes EGD-e]
 gi|46880196|gb|AAT03496.1| putative flagellar biosynthetic protein flhB [Listeria
           monocytogenes serotype 4b str. F2365]
 gi|47016315|gb|EAL07237.1| flagellar biosynthetic protein flhB, putative [Listeria
           monocytogenes str. 1/2a F6854]
 gi|47019961|gb|EAL10698.1| flagellar biosynthetic protein flhB, putative [Listeria
           monocytogenes str. 4b H7858]
 gi|217334493|gb|ACK40287.1| flagellar biosynthesis protein [Listeria monocytogenes HCC23]
 gi|225875772|emb|CAS04475.1| Putative flagellar biosynthetic protein flhB [Listeria
           monocytogenes serotype 4b str. CLIP 80459]
 gi|258601748|gb|EEW15073.1| flagellar biosynthesis protein FlhB [Listeria monocytogenes FSL
           N3-165]
 gi|258608271|gb|EEW20879.1| flagellar biosynthesis protein FlhB [Listeria monocytogenes F6900]
 gi|284056571|gb|ADB67512.1| flagellar biosynthesis protein FlhB [Listeria monocytogenes
           08-5578]
 gi|284059618|gb|ADB70557.1| flagellar biosynthesis protein FlhB [Listeria monocytogenes
           08-5923]
 gi|293583594|gb|EFF95626.1| flagellar biosynthesis protein FlhB [Listeria monocytogenes
           HPB2262]
 gi|293589298|gb|EFF97632.1| conserved hypothetical protein [Listeria monocytogenes J2818]
 gi|293593270|gb|EFG01031.1| flagellar biosynthesis protein FlhB [Listeria monocytogenes FSL
           J1-194]
 gi|307570218|emb|CAR83397.1| flagellar biosynthetic protein [Listeria monocytogenes L99]
 gi|328467248|gb|EGF38328.1| flagellar biosynthesis protein FlhB [Listeria monocytogenes 1816]
 gi|328475644|gb|EGF46393.1| flagellar biosynthesis protein FlhB [Listeria monocytogenes 220]
 gi|332311104|gb|EGJ24199.1| Flagellar biosynthesis protein [Listeria monocytogenes str. Scott
           A]
          Length = 348

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 101/341 (29%), Positives = 183/341 (53%), Gaps = 5/341 (1%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A DNKTE  + ++I+ A NEGN   S+E +   S+L  +  LL+FF       T    V 
Sbjct: 2   AKDNKTEKATPRRIKKARNEGNVAKSKELNNAFSLL-IVAGLLYFFGEMFIKNTIQAFVA 60

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           L     +     S+ +F L        ++++P +++ ++FG+ +Y +Q   + +   VKP
Sbjct: 61  LLKQPPKLANMESYSLFYLMEFG----KVLMPIMVMVVIFGLMNYGVQVGILFSAKAVKP 116

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
            FKR++     KR++S+  +V  +K+ + I L+  +  I   ++  T++ +   N    L
Sbjct: 117 QFKRLNPANYFKRVFSVKGIVEVVKALLLITLLSYVAYIGFRDHLDTLISYTGQNWLYSL 176

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
              F   +   + + L IA + +LD  +  + +   L+MSKQEIKDE+K S G P +K R
Sbjct: 177 GQIFALFKNEFLALFLVIAVIGLLDFFYQRYDYKKGLRMSKQEIKDEMKDSEGRPEVKQR 236

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
           Q+SIAR  ++  + +  + AT ++ NPTH ++ +RY +T++ AP L+ KG++ +A  +R+
Sbjct: 237 QRSIARGLLQGSITKKMADATFVVNNPTHISVVMRYDKTKDHAPKLLVKGEDELALFIRQ 296

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           +A    +P+     LARS++     +  I    YK V +++
Sbjct: 297 VADTDGVPMITNRQLARSIYYTTNPDEYIQEDLYKDVIEVM 337


>gi|15831844|ref|NP_310617.1| flagellar biosynthesis protein FlhB [Escherichia coli O157:H7 str.
           Sakai]
 gi|168747910|ref|ZP_02772932.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4113]
 gi|168757917|ref|ZP_02782924.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4401]
 gi|168762323|ref|ZP_02787330.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4501]
 gi|168770866|ref|ZP_02795873.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4486]
 gi|168776570|ref|ZP_02801577.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4196]
 gi|168783183|ref|ZP_02808190.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4076]
 gi|168789748|ref|ZP_02814755.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC869]
 gi|168801881|ref|ZP_02826888.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC508]
 gi|195939584|ref|ZP_03084966.1| flagellar biosynthesis protein FlhB [Escherichia coli O157:H7 str.
           EC4024]
 gi|208810589|ref|ZP_03252465.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4206]
 gi|208816756|ref|ZP_03257876.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4045]
 gi|208821749|ref|ZP_03262069.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4042]
 gi|209400586|ref|YP_002270964.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4115]
 gi|217328966|ref|ZP_03445047.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           TW14588]
 gi|254793504|ref|YP_003078341.1| flagellar biosynthesis protein FlhB [Escherichia coli O157:H7 str.
           TW14359]
 gi|261227619|ref|ZP_05941900.1| predicted flagellar export pore protein [Escherichia coli O157:H7
           str. FRIK2000]
 gi|261258215|ref|ZP_05950748.1| predicted flagellar export pore protein [Escherichia coli O157:H7
           str. FRIK966]
 gi|13362058|dbj|BAB36013.1| flagellar biosynthesis protein FlhB [Escherichia coli O157:H7 str.
           Sakai]
 gi|187768084|gb|EDU31928.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4196]
 gi|188017418|gb|EDU55540.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4113]
 gi|188999430|gb|EDU68416.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4076]
 gi|189355171|gb|EDU73590.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4401]
 gi|189360277|gb|EDU78696.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4486]
 gi|189367382|gb|EDU85798.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4501]
 gi|189370698|gb|EDU89114.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC869]
 gi|189376036|gb|EDU94452.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC508]
 gi|208725105|gb|EDZ74812.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4206]
 gi|208731099|gb|EDZ79788.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4045]
 gi|208741872|gb|EDZ89554.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4042]
 gi|209161986|gb|ACI39419.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4115]
 gi|209767300|gb|ACI81962.1| flagellar biosynthesis protein FlhB [Escherichia coli]
 gi|209767302|gb|ACI81963.1| flagellar biosynthesis protein FlhB [Escherichia coli]
 gi|209767306|gb|ACI81965.1| flagellar biosynthesis protein FlhB [Escherichia coli]
 gi|217318313|gb|EEC26740.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           TW14588]
 gi|254592904|gb|ACT72265.1| predicted flagellar export pore protein [Escherichia coli O157:H7
           str. TW14359]
 gi|320188579|gb|EFW63241.1| Flagellar biosynthesis protein FlhB [Escherichia coli O157:H7 str.
           EC1212]
 gi|326342258|gb|EGD66039.1| Flagellar biosynthesis protein FlhB [Escherichia coli O157:H7 str.
           1044]
 gi|326343808|gb|EGD67570.1| Flagellar biosynthesis protein FlhB [Escherichia coli O157:H7 str.
           1125]
          Length = 382

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 106/353 (30%), Positives = 197/353 (55%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G+ S+   L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVSVIWFGGV-SLARRLS 57

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++        ++D + I+  +  L   A   ++P +   ++  + S ++    V + 
Sbjct: 58  GMLSAGLHFDHSIIKDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSG 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +
Sbjct: 118 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPHMMRLMAES 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P
Sbjct: 178 PITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A
Sbjct: 238 HVKGRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  E+N+P  E P LAR+L++ V I   IP   Y AVA+++  ++  K
Sbjct: 298 LRIREIGAENNVPTLEAPPLARALYRHVEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|303240269|ref|ZP_07326788.1| flagellar biosynthetic protein FlhB [Acetivibrio cellulolyticus
           CD2]
 gi|302592179|gb|EFL61908.1| flagellar biosynthetic protein FlhB [Acetivibrio cellulolyticus
           CD2]
          Length = 400

 Score =  164 bits (416), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 109/349 (31%), Positives = 190/349 (54%), Gaps = 7/349 (2%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYS-VTSDLHVLLA 67
           +KTE  + KK E A  EG    SRE +  + +L CL   +      +Y  + +   ++ A
Sbjct: 49  DKTEKATPKKREKAREEGQVLQSREMTA-AIVLLCLFITVKIAGGYMYEQIYAYFKIVFA 107

Query: 68  SATQRKLED---ISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVK 124
             +  KL D   +  ++ L   L L   ++V P   + ++ GI S   Q   +     + 
Sbjct: 108 DYS--KLTDLFTVEGLIKLFIDLLLRFLKIVAPVFAVALITGIVSGYAQVGFLFTTKTLA 165

Query: 125 PSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSI 184
             F R++   G KRI+S+ ++   +KS +KI+++G I    L +    +L+ ++ +  SI
Sbjct: 166 FKFSRINPLSGFKRIFSLRSVTELVKSILKIVVIGYIGYSYLADEAKNILNTMNMDVISI 225

Query: 185 LYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKN 244
             +   T   V I + + +  L VLD G+ + ++   LKMSKQEIK E K++ GNP +K 
Sbjct: 226 AAYICVTSINVAIRMCIAMLILGVLDYGYQWWEYEKSLKMSKQEIKQENKEAEGNPEVKA 285

Query: 245 RQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMR 304
           + +   R     +M++   +A ++ITNPTH+A+A++Y    +DAP+++AKGQ+ IA +++
Sbjct: 286 KIRQKQRQIALRRMLQDIPKADVVITNPTHFAVAIKYDPKVSDAPIVIAKGQDYIALRIK 345

Query: 305 KIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +IA E+ + I E   LAR+L+  V I   IPP  ++AVA+++  +Y  K
Sbjct: 346 EIAKENKVEIVENKPLARTLYASVDIGERIPPELFQAVAEVLAFVYSLK 394


>gi|331683387|ref|ZP_08383988.1| flagellar biosynthetic protein FlhB [Escherichia coli H299]
 gi|331079602|gb|EGI50799.1| flagellar biosynthetic protein FlhB [Escherichia coli H299]
          Length = 382

 Score =  164 bits (416), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 106/353 (30%), Positives = 196/353 (55%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G+ S+T  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVSVIWFGGV-SLTRRLS 57

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++        + D + I+  +  L   A   ++P +   ++  + S ++    V + 
Sbjct: 58  GMLSAGLHFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSG 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +
Sbjct: 118 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAILKSILVGSVTGFYLWHHWPQMMRLMAES 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P
Sbjct: 178 PITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A
Sbjct: 238 HVKGRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 298 LRIREIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|300904767|ref|ZP_07122595.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 84-1]
 gi|301306905|ref|ZP_07212951.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 124-1]
 gi|300403281|gb|EFJ86819.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 84-1]
 gi|300837880|gb|EFK65640.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 124-1]
 gi|315257287|gb|EFU37255.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 85-1]
          Length = 382

 Score =  164 bits (416), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 109/364 (29%), Positives = 197/364 (54%), Gaps = 29/364 (7%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREAS--LFSSILACLIY---------LLFFFS 52
           +D  D+KTEAP+  ++E A  EG  P SRE +  L   +  C+I+         L    S
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVCVIWFGGVSLARRLSGMLS 61

Query: 53  PGIY---SVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGS 109
            G++   S+ +D +++L        E +  ++ L++ + L A  L+ P +L  ++F   S
Sbjct: 62  AGLHFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVA--LISPVMLGGLVFSGKS 119

Query: 110 YLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTEN 169
                        ++P F +++   GIKR++S       +K+ +K ILVG++    L  +
Sbjct: 120 -------------LQPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHH 166

Query: 170 YFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEI 229
           +  M+  ++ +P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I
Sbjct: 167 WPQMMRLMAESPITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDI 226

Query: 230 KDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAP 289
           +DE KQS G+P +K R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP
Sbjct: 227 RDEFKQSEGDPHVKGRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAP 286

Query: 290 VLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKI 349
            +VAKG  L+A ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  +
Sbjct: 287 KVVAKGAGLLALRIREIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWV 346

Query: 350 YHKK 353
           +  K
Sbjct: 347 WQLK 350


>gi|17549613|ref|NP_522953.1| flagellar biosynthetic FlhB transmembrane protein [Ralstonia
           solanacearum GMI1000]
 gi|17431867|emb|CAD18545.1| probable flagellar biosynthetic flhb transmembrane protein
           [Ralstonia solanacearum GMI1000]
          Length = 387

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 108/366 (29%), Positives = 184/366 (50%), Gaps = 33/366 (9%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE D+   KTE  S++++E A  EG+ P SRE   F  +LA     L+     I    S
Sbjct: 1   MSE-DSDLEKTEPASARRLEQAREEGDVPQSRELVSFV-LLATGALGLWVMGESIVRTAS 58

Query: 61  DLHVLLASATQ-------RKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQ 113
                LA   +       R  E   ++      L++     V+ GL+L ++    S L  
Sbjct: 59  SF---LARCLEFHRYDYTRAQEQWQYVGAQFGPLAM-----VLAGLILMLVLAALSPLAL 110

Query: 114 RIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTM 173
               ++   + P   R+    G+KR++S+  L+   +   K++LVG +        ++ +
Sbjct: 111 TRGAVSFKPLTPDITRLIGMHGLKRMFSVQGLLELPRLLAKLVLVGGV-------GWWLI 163

Query: 174 L----DFISANPHSILYHAFFTVRKVLIMILLFIATLTVL----DIGWSYHQWYSKLKMS 225
           L    DF+   P   L         V  +  L +A + +L    D+  +  Q+  K +M+
Sbjct: 164 LHYRDDFVEL-PRQDLVAGMRDTMHVAGVAFLCMAGVMLLVAAVDVPLALWQYARKHRMT 222

Query: 226 KQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTE 285
           K+E++ E ++S G+P +K R +++ R   + +MM    +A +I+TNPTHYA+ALRY + E
Sbjct: 223 KEEVRKEHRESEGDPQLKGRIRAMQRQAAQRRMMADVPKADVIVTNPTHYAVALRYSEQE 282

Query: 286 NDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQL 345
             AP ++AKG +++A K+R++  EH IP+ E P LAR+L++   I   IP   Y AVA++
Sbjct: 283 GGAPRVLAKGADMVAAKIRELGAEHKIPMLEAPPLARALYRHTEIGHQIPAALYAAVAEV 342

Query: 346 IYKIYH 351
           +  +Y 
Sbjct: 343 LAYVYQ 348


>gi|307264886|ref|ZP_07546448.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|306920144|gb|EFN50356.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter wiegelii
           Rt8.B1]
          Length = 363

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 108/348 (31%), Positives = 185/348 (53%), Gaps = 2/348 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
           + KTE  + K+ +DA  +G    SRE +    I+A  + +     P +  + + +  LL 
Sbjct: 14  EEKTEPATPKRRQDARKKGQVFQSREITSALVIVAGFLAVNILAMPSLGKMMALIKYLLY 73

Query: 68  --SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
             S     + ++  I  L T++   A  +++P +LL  +  + S  +Q   V     +  
Sbjct: 74  TYSGANDDVFNVVGIRNLFTYVLQQAISIIMPIILLIFVVSLASTYLQVGFVFTTEPLAF 133

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
            F+R++  EG KRI+S   LV   KS  K+ ++  I+   L   Y  +   +  +   IL
Sbjct: 134 KFERLNPVEGFKRIFSKRALVELAKSIAKVAVLFYIMYSFLASQYKGIPMLLDMSVQDIL 193

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
            +A   +  + I I + +  L  LD  + + ++ + LKMSK++IK+E K++ GNP IK  
Sbjct: 194 KYALNILLGITIRIGIVLIVLGALDYFFQWREYETSLKMSKEDIKEEFKETEGNPQIKAE 253

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
            +   R     +MM+   +A ++ITNPTH A+AL Y    NDAPV++AKGQ++IA ++++
Sbjct: 254 IRRKQRQVSMRRMMQDLKKADVVITNPTHLAVALMYDSNVNDAPVVIAKGQDMIALRIKE 313

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            A + NIPI E   LA++L++   I   IPP  Y+AVA+++  +Y  K
Sbjct: 314 EAKKLNIPIVENKPLAQALYRSTEIGDMIPPELYQAVAEVLAYVYSLK 361


>gi|300914395|ref|ZP_07131711.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter sp. X561]
 gi|307724369|ref|YP_003904120.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter sp. X513]
 gi|300889330|gb|EFK84476.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter sp. X561]
 gi|307581430|gb|ADN54829.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter sp. X513]
          Length = 363

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 109/347 (31%), Positives = 183/347 (52%), Gaps = 2/347 (0%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA- 67
            KTE  + K+ +DA  +G    SRE +    I+A  + +     P +  + +    LL  
Sbjct: 15  EKTEPATPKRRQDARKKGQVFQSREITSALVIVAGFLAVNILTMPSLEKMMALTKYLLYT 74

Query: 68  -SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
            S     + ++  I  L T++   A  + +P +LL  +  + S  +Q   V     +   
Sbjct: 75  YSGANDDVFNVVGIRNLFTYVLQQAISIAMPIILLIFVVSLASTYLQVGFVFTAEPLAFK 134

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
           F+R++  EG KRI+S   LV  +KS  K+ ++  I+   L   Y  +   +  +   IL 
Sbjct: 135 FERLNPVEGFKRIFSKRALVELVKSIAKVAVLFYIMYSFLASQYKGIPMLLDMSVQDILK 194

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
           +A   +  + I I + +  L  LD  + + ++ + LKMSK++IK+E K++ GNP IK   
Sbjct: 195 YALNILLGITIRIGIVLIVLGALDYFFQWREYETSLKMSKEDIKEEFKETEGNPQIKAEI 254

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           +   R     +MM+   +A ++ITNPTH A+AL Y    NDAPV++AKGQ++IA +M++ 
Sbjct: 255 RRKQRQVSMRRMMQDLKKADVVITNPTHLAVALMYDSNVNDAPVVIAKGQDMIALRMKEE 314

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A + NIPI E   LA++L++   I   IPP  Y+AVA+++  +Y  K
Sbjct: 315 AKKLNIPIVENKPLAQALYRSTEIGDMIPPELYQAVAEVLAYVYSLK 361


>gi|291617775|ref|YP_003520517.1| FlhB [Pantoea ananatis LMG 20103]
 gi|291152805|gb|ADD77389.1| FlhB [Pantoea ananatis LMG 20103]
          Length = 397

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 107/358 (29%), Positives = 191/358 (53%), Gaps = 16/358 (4%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYS--- 57
           +SEN + + KTE+P++ ++E A  EG  P SRE    +S+L  L  ++  +  G      
Sbjct: 15  VSEN-SDEEKTESPTAHRLEKAREEGQIPRSRE---LTSLLMLLAGIMILWVGGAMMAHR 70

Query: 58  ----VTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQ 113
               V++ L    A  T  K+     I+  + +L + A   ++P L   ++  I S ++ 
Sbjct: 71  LAAMVSTGLRFDHAMVTDDKI-----IIAHVGNLIMQAIAALLPLLGGLVLVAIASPMLL 125

Query: 114 RIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTM 173
              V++   +K  F +++   G+KR+++        K  +K ILVG +    +  ++  M
Sbjct: 126 GGVVISGKSIKVDFGKLNPLSGLKRMFAAQAWTELFKGILKTILVGCVAGWYVWSHWPDM 185

Query: 174 LDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEI 233
           L  I+ +P + L H    +     +++L +  +   D+ W  +  + KL+MS+QEI+DE 
Sbjct: 186 LRLIAESPTTALIHGMDMIAICCSLVMLGLIPMVGYDVFWQLYSHFKKLRMSRQEIRDEH 245

Query: 234 KQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVA 293
           KQ  G+P +K R +   R+  R +MM    +A +I+TNPTHY++AL+Y + +  AP ++A
Sbjct: 246 KQQEGDPHVKGRIRQQMRAAARRRMMADVPKADVIVTNPTHYSVALQYNEKKMSAPKVIA 305

Query: 294 KGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           KG   IA ++R++  EH IP+ E P LAR+L++   I   IP   Y AVA+++  ++ 
Sbjct: 306 KGAGDIALRIRELGAEHRIPVLEAPPLARALYRHTEIGQHIPGALYGAVAEVLAWVWQ 363


>gi|209695727|ref|YP_002263657.1| flagellar biosynthesis protein FlhB [Aliivibrio salmonicida
           LFI1238]
 gi|208009680|emb|CAQ79979.1| polar flagellar assembly protein FlhB [Aliivibrio salmonicida
           LFI1238]
          Length = 376

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 113/362 (31%), Positives = 195/362 (53%), Gaps = 20/362 (5%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISRE-ASLFSSILACLIYLLFFFSPGIYSVT 59
           M+++D  + +TE  +SK+++ A ++G    S+E AS+  S+L C    L +F   +    
Sbjct: 1   MADSDGQE-RTEDATSKRLQQAKDKGQVARSKELASV--SVLVCGAISLMWFGDEVGKAL 57

Query: 60  SDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGL----LLFMMFGIGSYLIQRI 115
             +     S ++ ++ D +    LL  +  +   LV P L    +LF+   IG+  +  I
Sbjct: 58  LSIMSRFFSISREEIFDTNK---LLEIVGGALVALVFPVLKILLMLFVAALIGAAGLGGI 114

Query: 116 PVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGT----IITISLTENYF 171
              +     P   +++   GIKR++ + + V  +KS +K+ LVG     +I  S  + + 
Sbjct: 115 S-FSAEAAMPKPSKMNPMSGIKRMFGMQSWVELLKSILKVSLVGGTAFYLINKSKADLFQ 173

Query: 172 TMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKD 231
             LD   +N    ++H+   +   +++I   +  +  +DI +   Q  ++LKM+KQEIKD
Sbjct: 174 LSLDTYPSN----IFHSLDILLNFILLISCTLLIVVAIDIPFQIWQHANQLKMTKQEIKD 229

Query: 232 EIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVL 291
           E K++ G P +K R + + R   + +MM     A +I+TNP HY++ALRY QT++ AP++
Sbjct: 230 EYKETEGKPEVKGRIRMLQREMTQRRMMADVPSADVIVTNPEHYSVALRYDQTKDSAPIV 289

Query: 292 VAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           VAKG + IA K+R+IA EHNI I   P LAR+L+    +   IP   + AVAQ++  I+ 
Sbjct: 290 VAKGVDHIAMKIREIAREHNIDILPAPPLARALYHSTEVEQQIPDGLFAAVAQILAYIFQ 349

Query: 352 KK 353
            K
Sbjct: 350 MK 351


>gi|300764490|ref|ZP_07074483.1| flagellar biosynthetic protein flhB [Listeria monocytogenes FSL
           N1-017]
 gi|300514844|gb|EFK41898.1| flagellar biosynthetic protein flhB [Listeria monocytogenes FSL
           N1-017]
          Length = 348

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 101/341 (29%), Positives = 183/341 (53%), Gaps = 5/341 (1%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A DNKTE  + ++I+ A NEGN   S+E +   S+L  +  LL+FF       T    V 
Sbjct: 2   AKDNKTEKATPRRIKKARNEGNVAKSKELNNAFSLL-IVAGLLYFFGEMFIKNTIQAFVA 60

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           L     +     S+ +F L        ++++P +++ ++FG+ +Y +Q   + +   VKP
Sbjct: 61  LLKQPPKLANMESYSLFYLMEFG----KVLMPIMVMVVIFGLMNYGVQVGILFSAKAVKP 116

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
            FKR++     KR++S+  +V  +K+ + I L+  +  I   ++  T++ +   N    L
Sbjct: 117 QFKRLNPANYFKRVFSVKGIVEVVKALLLITLLSYVAYIGFRDHLDTLISYTGQNWLYSL 176

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
              F   +   + + L IA + +LD  +  + +   L+MSKQEIKDE+K S G P +K R
Sbjct: 177 GQIFALFKNEFLALFLVIAVIGLLDFFYQRYDYKKGLRMSKQEIKDEMKDSEGRPEVKQR 236

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
           Q+SIAR  ++  + +  + AT ++ NPTH ++ +RY +T++ AP L+ KG++ +A  +R+
Sbjct: 237 QRSIARGLLQGSITKKMADATFVVNNPTHISVVMRYDKTKDHAPKLLVKGEDELALFIRQ 296

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           +A    +P+     LARS++     +  I    YK V +++
Sbjct: 297 VADTDEVPMITNRQLARSIYYTTNPDEYIQEDLYKDVIEVM 337


>gi|324007265|gb|EGB76484.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 57-2]
          Length = 382

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 106/353 (30%), Positives = 195/353 (55%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G+ S+   L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVSVIWFGGV-SLARRLS 57

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++        + D + I+  +  L   A   ++P +   ++  I S ++    V + 
Sbjct: 58  GMLSAGLHFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVAIISPVMLGGLVFSG 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +
Sbjct: 118 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAES 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P
Sbjct: 178 PLTAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A
Sbjct: 238 HVKGRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 298 LRIREIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|24113260|ref|NP_707770.1| flagellar biosynthesis protein FlhB [Shigella flexneri 2a str. 301]
 gi|30063328|ref|NP_837499.1| flagellar biosynthesis protein FlhB [Shigella flexneri 2a str.
           2457T]
 gi|24052262|gb|AAN43477.1| putative part of export apparatus for flagellar proteins [Shigella
           flexneri 2a str. 301]
 gi|30041580|gb|AAP17308.1| putative part of export apparatus for flagellar proteins [Shigella
           flexneri 2a str. 2457T]
 gi|281601322|gb|ADA74306.1| putative part of export apparatus for flagellar proteins [Shigella
           flexneri 2002017]
 gi|313650088|gb|EFS14501.1| flagellar biosynthetic protein FlhB [Shigella flexneri 2a str.
           2457T]
 gi|332757344|gb|EGJ87681.1| flagellar biosynthetic protein FlhB [Shigella flexneri 2747-71]
 gi|332757435|gb|EGJ87770.1| flagellar biosynthetic protein FlhB [Shigella flexneri K-671]
 gi|332766606|gb|EGJ96810.1| flagellar biosynthetic protein FlhB [Shigella flexneri 2930-71]
 gi|333017652|gb|EGK36964.1| flagellar biosynthetic protein FlhB [Shigella flexneri K-304]
          Length = 397

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 106/353 (30%), Positives = 195/353 (55%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G+ S+   L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVSVIWFGGV-SLARRLS 57

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++        ++D + I+  +  L   A   ++P +   ++  + S ++    V + 
Sbjct: 58  GMLSAGLHFDHSIIKDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSG 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKRI+S       +K+ +K ILVG++    L  ++  M+  ++ +
Sbjct: 118 KSLQPKFSKLNPLPGIKRIFSAQTSAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAES 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P
Sbjct: 178 PITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R   + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A
Sbjct: 238 HVKGRICQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 298 LRIREIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|162139338|ref|YP_689375.2| flagellar biosynthesis protein FlhB [Shigella flexneri 5 str. 8401]
          Length = 397

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 106/353 (30%), Positives = 195/353 (55%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G+ S+   L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVSVIWFGGV-SLARRLS 57

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++        ++D + I+  +  L   A   ++P +   ++  + S ++    V + 
Sbjct: 58  GMLSAGLHFDHSIIKDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSG 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKRI+S       +K+ +K ILVG++    L  ++  M+  ++ +
Sbjct: 118 KSLQPKFSKLNPLPGIKRIFSAQTSAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAES 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P
Sbjct: 178 PITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R   + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A
Sbjct: 238 HVKGRICQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 298 LRIREIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|167040311|ref|YP_001663296.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter sp. X514]
 gi|166854551|gb|ABY92960.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter sp. X514]
          Length = 360

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 109/347 (31%), Positives = 183/347 (52%), Gaps = 2/347 (0%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA- 67
            KTE  + K+ +DA  +G    SRE +    I+A  + +     P +  + +    LL  
Sbjct: 12  EKTEPATPKRRQDARKKGQVFQSREITSALVIVAGFLAVNILTMPSLEKMMALTKYLLYT 71

Query: 68  -SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
            S     + ++  I  L T++   A  + +P +LL  +  + S  +Q   V     +   
Sbjct: 72  YSGANDDVFNVVGIRNLFTYVLQQAISIAMPIILLIFVVSLASTYLQVGFVFTAEPLAFK 131

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
           F+R++  EG KRI+S   LV  +KS  K+ ++  I+   L   Y  +   +  +   IL 
Sbjct: 132 FERLNPVEGFKRIFSKRALVELVKSIAKVAVLFYIMYSFLASQYKGIPMLLDMSVQDILK 191

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
           +A   +  + I I + +  L  LD  + + ++ + LKMSK++IK+E K++ GNP IK   
Sbjct: 192 YALNILLGITIRIGIVLIVLGALDYFFQWREYETSLKMSKEDIKEEFKETEGNPQIKAEI 251

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           +   R     +MM+   +A ++ITNPTH A+AL Y    NDAPV++AKGQ++IA +M++ 
Sbjct: 252 RRKQRQVSMRRMMQDLKKADVVITNPTHLAVALMYDSNVNDAPVVIAKGQDMIALRMKEE 311

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A + NIPI E   LA++L++   I   IPP  Y+AVA+++  +Y  K
Sbjct: 312 AKKLNIPIVENKPLAQALYRSTEIGDMIPPELYQAVAEVLAYVYSLK 358


>gi|170731604|ref|YP_001763551.1| flagellar biosynthesis protein FlhB [Burkholderia cenocepacia
           MC0-3]
 gi|169814846|gb|ACA89429.1| flagellar biosynthetic protein FlhB [Burkholderia cenocepacia
           MC0-3]
          Length = 399

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 105/359 (29%), Positives = 178/359 (49%), Gaps = 29/359 (8%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSP----------GIYSV 58
           +KTEA + ++ E A  EG    SRE + F+ + A          P          G ++ 
Sbjct: 8   DKTEAATPRRREKAREEGQVARSRELASFALLAAGFYGAWLLAGPSGAHLQAMLRGAFTF 67

Query: 59  TS----DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQR 114
                 D H +L++A    LE  + ++ LL    ++A         L     +G +LI +
Sbjct: 68  DRATAFDTHRMLSAAGSASLEGFAALLPLLALTGVAA---------LLAPMALGGWLISQ 118

Query: 115 IPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTML 174
                    +  F R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L
Sbjct: 119 ------KTFELKFDRLNPISGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELL 172

Query: 175 DFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIK 234
              +      L  A   V       +  +  +  LD+ +   Q+  KL+M+K+E+K E +
Sbjct: 173 GLATQPLGVALPDALHLVAVCCGTTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEVKREHR 232

Query: 235 QSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAK 294
           ++ G+P +K R +   R+  R +MM A  +A +++TNPTH+A+AL+Y   E  AP +VAK
Sbjct: 233 ENEGDPHVKGRIRQQQRAIARRRMMAAVPKADVVVTNPTHFAVALQYTDGEMRAPKVVAK 292

Query: 295 GQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           G NL+A ++R++A EHN+P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 293 GVNLVAARIRELAAEHNVPLLEAPPLARALYHNVELEREIPGSLYSAVAEVLAWVYQLK 351


>gi|16078701|ref|NP_389520.1| flagellar biosynthesis protein FlhB [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221309516|ref|ZP_03591363.1| flagellar biosynthesis protein FlhB [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221313840|ref|ZP_03595645.1| flagellar biosynthesis protein FlhB [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221318763|ref|ZP_03600057.1| flagellar biosynthesis protein FlhB [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221323035|ref|ZP_03604329.1| flagellar biosynthesis protein FlhB [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|321315405|ref|YP_004207692.1| flagellar biosynthesis protein FlhB [Bacillus subtilis BSn5]
 gi|7404374|sp|P35538|FLHB_BACSU RecName: Full=Flagellar biosynthetic protein flhB
 gi|2634010|emb|CAB13511.1| component of the flagellar export machinery [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|320021679|gb|ADV96665.1| flagellar biosynthesis protein FlhB [Bacillus subtilis BSn5]
          Length = 360

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 112/348 (32%), Positives = 184/348 (52%), Gaps = 7/348 (2%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE  + KK +D   +G    S + +   S+L   + L+         + S +      
Sbjct: 13  EKTEKATPKKRKDTRKKGQVAKSSDVNTAVSLLVIFLSLIAIGPYMRDRLLSFIETFYTE 72

Query: 69  ATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFK 128
           +   KL + S++  L   L      ++ P LL+ ++ G+ S  +Q   + +   ++P  +
Sbjct: 73  SLTMKLSE-SNVHTLFVSLLKDMGMILAPILLVALVAGVVSNYMQVGFLFSAEVIQPKLE 131

Query: 129 RVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHA 188
           ++   +G KRIYS+  +V  +KS +KI++VG      L  +Y  +L      P   L   
Sbjct: 132 KLDPIKGFKRIYSMRAIVELIKSILKIVVVGFAAFAVLWLHYGEILRLPLLTPEEALS-- 189

Query: 189 FFTVRKVLIMILLFIATLTVL---DIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
            F  +  L M L     L +L   D  +    +   +KMSKQ+IKDE K+S G+PIIK++
Sbjct: 190 -FVSKLTLWMGLSGAGALLILAGLDYLYQRFDYEKNIKMSKQDIKDEYKKSEGDPIIKSK 248

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
            K   R     +MM+   +A +IITNPTHYA+AL+Y + + DAP +VAKG + +A K+RK
Sbjct: 249 IKQRQREMAMRRMMQEVPKADVIITNPTHYAIALKYDEEKMDAPYIVAKGVDHLALKIRK 308

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           IA EH++ + E   LAR+L+ QV I+ A+P  F+K +A+++  +Y  K
Sbjct: 309 IAKEHDVMMVENRPLARALYDQVEIDQAVPEEFFKVLAEILAYVYKTK 356


>gi|312792666|ref|YP_004025589.1| flagellar biosynthetic protein flhb [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312179806|gb|ADQ39976.1| flagellar biosynthetic protein FlhB [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 366

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 104/346 (30%), Positives = 191/346 (55%), Gaps = 3/346 (0%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE  + +K ++A   G    SRE +   ++L  +++L F +S  +  +         S
Sbjct: 15  TKTEKATPRKRQEARKRGMVAKSREVTSAFALLISVLFLKFAYSSIVEPLQQGSKYFF-S 73

Query: 69  ATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFK 128
                LED+     LL+ +  ++ ++++P  L  M+        Q   ++    +K SF+
Sbjct: 74  NLNYNLEDVRDASRLLSFIITTSLKVILPFCLTIMLVAAIVEWAQSSFLITGQSLKMSFQ 133

Query: 129 RVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFT-MLDFISANPHSILYH 187
           +++  EG KRI+SIN++V  +KS +K++++G     S T+++   +L+    N  +I+  
Sbjct: 134 KINPIEGFKRIFSINSVVELIKSILKVLIIG-YTGYSYTQSFAKKLLEMYEMNVLTIVKF 192

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
           +F +   +++ + +    + V+D  +   Q+  KL M+K+E+K+E KQ+ GNP IK++ +
Sbjct: 193 SFDSAINLILWMSVMFFGIAVIDFIFQRQQYEKKLMMTKEEVKEEFKQTEGNPQIKSKIR 252

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              R     +M +   +A ++ITNPTHYA+AL Y   + DAP ++AKG++ IA K+++ A
Sbjct: 253 ERQRRISLQRMFQQLPKADVVITNPTHYAVALLYEPEKFDAPRVIAKGKDYIALKIKQEA 312

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            +H I I E   LAR+L+    I   IPP  Y+AVA+++  +Y  K
Sbjct: 313 IKHRIEIVENRELARALYNMCEIGDFIPPELYQAVAEVLAYVYSLK 358


>gi|312126838|ref|YP_003991712.1| flagellar biosynthetic protein flhb [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311776857|gb|ADQ06343.1| flagellar biosynthetic protein FlhB [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 366

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 105/345 (30%), Positives = 190/345 (55%), Gaps = 3/345 (0%)

Query: 10  KTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLASA 69
           KTE  + +K ++A   G    SRE +   ++L  +++L F +S  I  +         S 
Sbjct: 16  KTEKATPRKRQEARKRGMVAKSREVTSAFALLISVLFLKFGYSLIIEPLQQGSKYFF-SN 74

Query: 70  TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKR 129
               LED+     LL+ +  ++ ++V+P  L  M         Q   ++    +K SF++
Sbjct: 75  LNYNLEDVRDASRLLSFIITTSLKMVLPFCLTIMFVATIVEWAQSSFLITAQSLKMSFQK 134

Query: 130 VSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFT-MLDFISANPHSILYHA 188
           ++  EG KRI+SIN++V  +KS +K++++G     S T+++   +L+    N  +I+  +
Sbjct: 135 INPIEGFKRIFSINSVVELIKSILKVLIIG-YTGYSYTQSFAKKLLEMYEMNVLTIVKFS 193

Query: 189 FFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKS 248
           F +   +++ + +    + V+D  +   Q+  KL M+K+E+K+E KQ+ GNP IK++ + 
Sbjct: 194 FDSAINLILWMAVMFFGIAVIDFIFQRQQYEKKLMMTKEEVKEEFKQTEGNPQIKSKIRE 253

Query: 249 IARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAY 308
             R     +M +   +A ++ITNPTHYA+AL Y   + DAP ++AKG++ IA K+++ A 
Sbjct: 254 RQRRISLQRMFQQLPKADVVITNPTHYAVALLYEPEKFDAPRVIAKGKDYIALKIKQEAI 313

Query: 309 EHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +H I I E   LA++L+    I   IPP  Y+AVA+++  +Y  K
Sbjct: 314 KHRIEIVENRELAKALYNMCEIGDFIPPELYQAVAEVLAYVYSLK 358


>gi|297538882|ref|YP_003674651.1| flagellar biosynthetic protein FlhB [Methylotenera sp. 301]
 gi|297258229|gb|ADI30074.1| flagellar biosynthetic protein FlhB [Methylotenera sp. 301]
          Length = 394

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 106/361 (29%), Positives = 186/361 (51%), Gaps = 21/361 (5%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+   KTE  SSK++E+A  EG+ P SRE +  + +    + +L         +   L 
Sbjct: 3   EDSDLEKTEQASSKRLEEARKEGDVPRSRELATVTVLFTAGLTILIMSE----HLNQALK 58

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVI---PGLLLFMMFGIGSYLIQRIPVLNL 120
             +++  Q           LL   + S S L+    P  L+ +   I + ++    + + 
Sbjct: 59  TTMSAGLQFDRTAAFEPTVLLMRTADSISSLLTAFAPLALILVAVAIAAPVLVGGWIFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFIS-- 178
               P F R++  +G+  I S N+LV  +KS  K++LVG +  + ++ +   +L   +  
Sbjct: 119 KAFVPQFSRLNPIKGLTNIISKNSLVELVKSIAKVMLVGIVAYVVISHDMEPILTLSTLP 178

Query: 179 -----ANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEI 233
                A   S++   F T+    +  L+FIA +   D+ +  + + +KLKM+K+E++ E 
Sbjct: 179 LKSSIAQVGSLMLTGFLTI----VSTLVFIAAI---DVPYQLYHYANKLKMTKEEVRQES 231

Query: 234 KQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVA 293
           K+S GNP IK + +   R   + +MM     A ++ITNPTHYA+A++Y      APV+VA
Sbjct: 232 KESDGNPEIKAKIRQQQREMAKRRMMSEIPNADVVITNPTHYAVAIKYQDEGMRAPVVVA 291

Query: 294 KGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           KG + +A K+R++A EH + I E P LAR+L+    + + IP   Y AVA+++  ++  +
Sbjct: 292 KGADEVALKIREVAGEHKVLIMESPKLARALYAHTELGNEIPEALYSAVAEILAYVFQMR 351

Query: 354 I 354
           I
Sbjct: 352 I 352


>gi|326389464|ref|ZP_08211031.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter ethanolicus
           JW 200]
 gi|325994469|gb|EGD52894.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter ethanolicus
           JW 200]
          Length = 363

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 108/348 (31%), Positives = 185/348 (53%), Gaps = 2/348 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
           + KTE  + K+ +DA  +G    SRE +    I+A  + +     P +  + + +  LL 
Sbjct: 14  EEKTEPATPKRRQDARKKGQVFQSREITSALVIVAGFLAVNILAMPSLGKMMALIKYLLY 73

Query: 68  --SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
             S     + ++  I  L T++   A  +++P +LL  +  + S  +Q   V     +  
Sbjct: 74  TYSGANDDVFNVVGIRNLFTYVLQQAISIIMPIILLIFVVSLASTYLQVGFVFTTEPLAF 133

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
            F+R++  EG KRI+S   LV   KS  K+ ++  I+   L   Y  +   +  +   IL
Sbjct: 134 KFERLNPVEGFKRIFSKRALVELAKSIAKVAVLFYIMYSFLASQYKGIPMLLDMSVQDIL 193

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
            +A   +  + I I + +  L  LD  + + ++ + LKMSK++IK+E K++ GNP IK  
Sbjct: 194 KYALNILLGITIRIGIVLIVLGALDYFFQWREYETSLKMSKEDIKEEFKETEGNPQIKAE 253

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
            +   R     +MM+   +A ++ITNPTH A+AL Y    NDAPV++AKGQ++IA ++++
Sbjct: 254 IRRKQRQVSMKRMMQDLKKADVVITNPTHLAVALMYDSNVNDAPVVIAKGQDMIALRIKE 313

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            A + NIPI E   LA++L++   I   IPP  Y+AVA+++  +Y  K
Sbjct: 314 EAKKLNIPIVENKPLAQALYRSTEIGDMIPPELYQAVAEVLAYVYSLK 361


>gi|26248146|ref|NP_754186.1| flagellar biosynthesis protein FlhB [Escherichia coli CFT073]
 gi|91211104|ref|YP_541090.1| flagellar biosynthesis protein FlhB [Escherichia coli UTI89]
 gi|110641997|ref|YP_669727.1| flagellar biosynthesis protein FlhB [Escherichia coli 536]
 gi|117624031|ref|YP_852944.1| flagellar biosynthesis protein FlhB [Escherichia coli APEC O1]
 gi|191172970|ref|ZP_03034504.1| flagellar biosynthetic protein FlhB [Escherichia coli F11]
 gi|218558744|ref|YP_002391657.1| flagellar biosynthesis protein FlhB [Escherichia coli S88]
 gi|227885693|ref|ZP_04003498.1| flagellar biosynthesis protein FlhB [Escherichia coli 83972]
 gi|237705835|ref|ZP_04536316.1| flagellar biosynthesis protein FlhB [Escherichia sp. 3_2_53FAA]
 gi|300994042|ref|ZP_07180661.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 45-1]
 gi|301050765|ref|ZP_07197623.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 185-1]
 gi|306814291|ref|ZP_07448457.1| flagellar biosynthesis protein FlhB [Escherichia coli NC101]
 gi|26108550|gb|AAN80753.1|AE016762_6 Flagellar biosynthetic protein flhB [Escherichia coli CFT073]
 gi|91072678|gb|ABE07559.1| flagellar biosynthetic protein FlhB [Escherichia coli UTI89]
 gi|110343589|gb|ABG69826.1| flagellar biosynthetic protein FlhB [Escherichia coli 536]
 gi|115513155|gb|ABJ01230.1| flagellar biosynthesis protein B [Escherichia coli APEC O1]
 gi|190906681|gb|EDV66286.1| flagellar biosynthetic protein FlhB [Escherichia coli F11]
 gi|218365513|emb|CAR03240.1| flagellar export pore protein [Escherichia coli S88]
 gi|226900592|gb|EEH86851.1| flagellar biosynthesis protein FlhB [Escherichia sp. 3_2_53FAA]
 gi|227837266|gb|EEJ47732.1| flagellar biosynthesis protein FlhB [Escherichia coli 83972]
 gi|294491560|gb|ADE90316.1| flagellar biosynthetic protein FlhB [Escherichia coli IHE3034]
 gi|300297582|gb|EFJ53967.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 185-1]
 gi|300406410|gb|EFJ89948.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 45-1]
 gi|305852450|gb|EFM52901.1| flagellar biosynthesis protein FlhB [Escherichia coli NC101]
 gi|307553898|gb|ADN46673.1| flagellar biosynthetic protein FlhB [Escherichia coli ABU 83972]
 gi|307626638|gb|ADN70942.1| flagellar biosynthesis protein FlhB [Escherichia coli UM146]
 gi|315290307|gb|EFU49683.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 153-1]
 gi|323186760|gb|EFZ72080.1| flagellar biosynthetic protein FlhB [Escherichia coli RN587/1]
 gi|323952382|gb|EGB48255.1| flagellar biosynthetic protein FlhB [Escherichia coli H252]
 gi|324013524|gb|EGB82743.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 60-1]
          Length = 382

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 106/353 (30%), Positives = 195/353 (55%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G+ S+   L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVSVIWFGGV-SLARRLS 57

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++        + D + I+  +  L   A   ++P +   ++  I S ++    V + 
Sbjct: 58  GMLSAGLHFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVAIISPVMLGGLVFSG 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +
Sbjct: 118 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAES 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P
Sbjct: 178 PITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A
Sbjct: 238 HVKGRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 298 LRIREIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|71736663|ref|YP_275525.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257484900|ref|ZP_05638941.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|289651607|ref|ZP_06482950.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|298487818|ref|ZP_07005858.1| Flagellar biosynthesis protein flhB [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|71557216|gb|AAZ36427.1| flagellar biosynthetic protein FlhB [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|298157543|gb|EFH98623.1| Flagellar biosynthesis protein flhB [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|330889044|gb|EGH21705.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv. mori
           str. 301020]
 gi|330986505|gb|EGH84608.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331011080|gb|EGH91136.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 378

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 102/351 (29%), Positives = 186/351 (52%), Gaps = 1/351 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+   +KTE P+ KK++D+  +G    S+E +    +L     LL F S GI  + S
Sbjct: 1   MAENENGQDKTEDPTEKKVKDSRADGQIARSKELTTLVVMLMGAGGLLMFGS-GIAQMMS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           +L     + ++  L D S++   L    L A  +++P L+  ++  +   ++    +   
Sbjct: 60  ELMRDNFTISRETLMDQSYMGKALLSSGLHALVVMLPFLIAMLVAALVGPIMLGGWLFAT 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++   G+KR++S + LV  +KSF K +++  +  + L+     ++      
Sbjct: 120 KSLMPKFSRMNPAAGLKRMFSPHALVELLKSFGKFLIILAVALVVLSNERNDLVAIAHEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V      +   +  +   D+ +  ++ + KL M+KQE++DE K S G+P
Sbjct: 180 LEQAMIHSLLVVGWSSFWMACGLIFIAAADVPFVLYEAHKKLLMTKQEVRDEHKNSEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM +   A +IITNPTH+A+AL+Y   +  AP+L+AKG +L+A
Sbjct: 240 EVKQRIRQLQREMSQRRMMASIPEADVIITNPTHFAVALKYDPEQGGAPMLLAKGTDLVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            K+R+I   + I I E  +LARS++    ++  IP   Y AVAQ++  +Y 
Sbjct: 300 LKIREIGAHNQILILESAALARSIYYSTELDQEIPAGLYLAVAQVLAYVYQ 350


>gi|239997097|ref|ZP_04717621.1| flagellar biosynthesis protein [Alteromonas macleodii ATCC 27126]
          Length = 374

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 104/356 (29%), Positives = 198/356 (55%), Gaps = 23/356 (6%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPG-----IYSVTSDLH 63
            KTE P+ KK+EDA  +G    SRE S  ++++  +   +F F  G     ++ +T  + 
Sbjct: 6   EKTEDPTGKKLEDARKKGQLARSRELS--TTLVLIVSAFMFLFVGGWIAESVFKLTQRMF 63

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLN-- 121
           +L    ++ +  DI+H+ F     + SA   V P +LL+M+  + + +   I +   N  
Sbjct: 64  IL----SRDETYDITHM-FGAWGEAFSA---VGPTVLLYMVVAMIAGIYGSIALGGFNFT 115

Query: 122 --HVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKII-LVGTIITISLT-ENYFTMLDFI 177
               KP   ++S  +G KR++ +N LV  +KS  K++ ++G  I   L  E+    LD +
Sbjct: 116 WEGAKPKGSKMSPIQGFKRMFGMNGLVELLKSIAKVVVIIGMAIGALLFFEDEALHLD-M 174

Query: 178 SANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSY 237
              P +I +HA   ++   ++++  +  + ++D+ +  ++   ++KM+KQE+KDE K + 
Sbjct: 175 ELYPGNI-FHALDMLKWAFLILVCGMIPIALIDVPYQMYKHNKEMKMTKQEVKDERKNAE 233

Query: 238 GNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQN 297
           G+P++K R + +       +MM+   +A +++TNPTH+++A++Y +    APV+VAKG +
Sbjct: 234 GDPMVKGRIRRLQYQAATKRMMQEVPQADVVVTNPTHFSVAIKYDEKGVRAPVVVAKGAD 293

Query: 298 LIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            +A  +RKIA  +++P+   P LAR++F    ++  IP   + AVAQ++  +Y  K
Sbjct: 294 ELAMHIRKIATANDVPLIPSPMLARAIFYSTEVDDEIPNALFMAVAQVLAHVYQLK 349


>gi|83944181|ref|ZP_00956637.1| flagella-associated protein [Sulfitobacter sp. EE-36]
 gi|83955118|ref|ZP_00963774.1| flagella-associated protein [Sulfitobacter sp. NAS-14.1]
 gi|83840447|gb|EAP79620.1| flagella-associated protein [Sulfitobacter sp. NAS-14.1]
 gi|83845048|gb|EAP82929.1| flagella-associated protein [Sulfitobacter sp. EE-36]
          Length = 375

 Score =  164 bits (414), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 106/358 (29%), Positives = 185/358 (51%), Gaps = 12/358 (3%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN     KT  P+ KK++DA  +G+ P S+E      ++A L             +  
Sbjct: 1   MAENSDSTEKTLEPTEKKLKDARKKGDVPSSKETGNMVVVVAMLGIAALVLPYQAPQIVV 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLL-----LFMMFGIGSYLIQRI 115
            L VLL  +    +      V  L  +      +++  +L     LF+   IG+ +IQ  
Sbjct: 61  ALSVLLDHSPNLMVATGEPGVIRLGQIMSEFFYMIVWAVLPIFGVLFLGGAIGA-VIQGE 119

Query: 116 PVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTI---ITISLTENYFT 172
            V+    +KP   ++S  EG+KR++S N LV F KS VK++ +G +    T       +T
Sbjct: 120 TVVAAERIKPKLSKLSPLEGLKRLFSANALVEFAKSIVKVLAIGGLAVWFTNEAVRRIWT 179

Query: 173 MLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDE 232
              FI   P  +  +      K+LI   + +  + + DI W    W  K +MS+++IKDE
Sbjct: 180 SSGFI---PEHLPGYLTAAAVKLLIAAAILLVPIAIADILWRRFDWRRKQRMSQKDIKDE 236

Query: 233 IKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLV 292
            K+S G+P I+ ++    R   + + + A   A +I+TNPTHY++AL+Y   ++ APV +
Sbjct: 237 HKESEGSPEIRQKRARRRRELSQQRTITAVPLADVILTNPTHYSIALKYDPAQDMAPVCI 296

Query: 293 AKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           AKG + +A+++R++A EH+IP+ E   L R L+ ++ ++  IP   ++ VA++I  ++
Sbjct: 297 AKGADHLARRIREVAAEHDIPMIENKPLTRMLYDEIDVDQVIPVAHWEIVAEIISFVF 354


>gi|315286607|gb|EFU46040.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 110-3]
          Length = 400

 Score =  164 bits (414), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 106/353 (30%), Positives = 195/353 (55%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G+ S+   L 
Sbjct: 20  SDESDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVSVIWFGGV-SLARRLS 75

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++        + D + I+  +  L   A   ++P +   ++  I S ++    V + 
Sbjct: 76  GMLSAGLHFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVAIISPVMLGGLVFSG 135

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +
Sbjct: 136 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAES 195

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P
Sbjct: 196 PITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDP 255

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A
Sbjct: 256 HVKGRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVA 315

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 316 LRIREIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 368


>gi|330880588|gb|EGH14737.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 378

 Score =  164 bits (414), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 101/351 (28%), Positives = 186/351 (52%), Gaps = 1/351 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+   +KTE P+ KK++D+  +G    S+E +    +L     LL F S GI  + S
Sbjct: 1   MAENENGQDKTEDPTEKKVKDSRADGQIARSKELTTLVVMLMGAGGLLMFGS-GIAQMMS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           +L     + ++  L D S++   L    L A  +++P L+  ++  +   ++    +   
Sbjct: 60  ELMRDNFTISRETLMDQSYMGKALLSSGLHALVVMLPFLIAMLVAALVGPIMLGGWLFAT 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++   G+KR++S + LV  +KSF K +++  +  + L+     ++  +   
Sbjct: 120 KSLMPKFSRMNPAAGLKRMFSPHALVELLKSFGKFLIILAVALVVLSNERNDLVAIVHEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V      +   +  +   D+ +  ++ +  L M+KQE++DE K S G+P
Sbjct: 180 LEQAMIHSLLVVGWSSFWMACGLIFIAAADVPFVLYEAHKTLLMTKQEVRDEQKNSEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM +   A +IITNPTH+A+AL+Y   +  AP+L+AKG +L+A
Sbjct: 240 EVKQRIRQLQREMSQRRMMASIPEADVIITNPTHFAVALKYDPEQGGAPMLLAKGTDLVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            K+R+I   + I I E  +LARS++    ++  IP   Y AVAQ++  +Y 
Sbjct: 300 LKIREIGAHNQILILESAALARSIYYSTELDQEIPAGLYLAVAQVLAYVYQ 350


>gi|300311341|ref|YP_003775433.1| flagellar biosynthesis FlhB transmembrane protein [Herbaspirillum
           seropedicae SmR1]
 gi|300074126|gb|ADJ63525.1| flagellar biosynthesis FlhB transmembrane protein [Herbaspirillum
           seropedicae SmR1]
          Length = 391

 Score =  164 bits (414), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 106/360 (29%), Positives = 193/360 (53%), Gaps = 25/360 (6%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLL-----FFFSPGIYSV 58
            D+   +TE  + K+IE A  +G+ P SRE      +  CL+ L+     + FS  + + 
Sbjct: 3   EDSDMERTEPATGKRIERAREQGDVPRSRE------LATCLVLLVGGSCVWMFSGPVVTS 56

Query: 59  TSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVL 118
              + V + S  +  + D   ++ L++   L  +  VIP   L  +  + + L     + 
Sbjct: 57  LDRIMVAMMSLERAAIYDPVVLMNLISARCLDVAIAVIPLAFLMTLAAMAAPLTLGGWLF 116

Query: 119 NLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDF-- 176
           N++ + P F +++   G   ++S+N+LV   K+ +K +LVGT+  +++      ++    
Sbjct: 117 NVSSLAPKFSKLNPISGFANMFSVNSLVELGKAVLKTLLVGTVAWVTIRSQLDAVMGLGV 176

Query: 177 -----ISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKD 231
                  A+   +L+ +F T    ++  L+FIA   VLD+ +    +  KL+M+++E+K 
Sbjct: 177 ESLKTAGAHAAQLLWISFIT----MVSALIFIA---VLDVPYQLWNYGRKLRMTREEVKQ 229

Query: 232 EIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVL 291
           E K+S G+P IK + +++ R+  R +MM     A +++TNPTHYA+AL+Y + +  AP +
Sbjct: 230 EHKESEGDPHIKGKIRAMQRAMARRRMMAEVPTADVVVTNPTHYAVALKYSEGKMGAPKV 289

Query: 292 VAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           VAKG + IA K+R++A EH +P+ E P LAR+L     I   IP   Y AVA+++  ++ 
Sbjct: 290 VAKGSDEIAAKIRELAREHRVPLLEAPPLARALHTHTEIGDEIPEALYTAVAEVLAYVFQ 349


>gi|170694379|ref|ZP_02885533.1| flagellar biosynthetic protein FlhB [Burkholderia graminis C4D1M]
 gi|170140802|gb|EDT08976.1| flagellar biosynthetic protein FlhB [Burkholderia graminis C4D1M]
          Length = 401

 Score =  164 bits (414), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 105/351 (29%), Positives = 183/351 (52%), Gaps = 17/351 (4%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE+ + ++++ A  EG    SRE S F+ +LA   + ++  S    S+   L  +L +
Sbjct: 8   EKTESATPRRLQKAREEGQIARSRELSTFA-LLAAGFFGVWGMSD---SIGEHLQAMLRA 63

Query: 69  ATQRKLEDISHIVFLLTH-LSLSASRLVIPGL--LLFMMFGIGSYLIQRIPV-----LNL 120
           A         H     TH + + A      GL  LL ++   G+  +          L+ 
Sbjct: 64  AFT-----FDHAGAFETHRMMIGAGAASREGLYALLPILAVTGAAALLAPMALGGWQLST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F+R++   G+ +I+SIN  +    S  K ++VG I   ++      +L   +  
Sbjct: 119 KGLEPKFERLNPIAGLGKIFSINGPIQLAMSLAKTLVVGIIGGTAIWNRREEILALATQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            H  L +    +     M +  +  +  LD+ +   Q++ KL+MSK+E+K E ++S G+P
Sbjct: 179 LHLALANTVHLIAVCCGMTVAGMFVVAALDVPYQLWQFHKKLRMSKEEVKREHRESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A
Sbjct: 239 HVKGRIRQQQRAIARRRMMTQVPKADVVVTNPTHFAVALQYTDGEMRAPKVVAKGVNLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            ++R++A E+N+P+ E P LAR+L+  V +N  IP   Y AVA+++  +Y 
Sbjct: 299 ARIRELAAENNVPLLEAPPLARALYHNVELNREIPGQLYGAVAEVLAWVYQ 349


>gi|289629017|ref|ZP_06461971.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|330866461|gb|EGH01170.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           aesculi str. 0893_23]
          Length = 378

 Score =  164 bits (414), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 102/351 (29%), Positives = 186/351 (52%), Gaps = 1/351 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+   +KTE P+ KK++D+  +G    S+E +    +L     LL F S GI  + S
Sbjct: 1   MAENENGQDKTEDPTEKKVKDSRADGQIARSKELTTLLVMLMGAGGLLMFGS-GIAQMMS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           +L     + ++  L D S++   L    L A  +++P L+  ++  +   ++    +   
Sbjct: 60  ELMRDNFTISRETLMDQSYMGKALLSSGLHALVVMLPFLIAMLVAALVGPIMLGGWLFAT 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++   G+KR++S + LV  +KSF K +++  +  + L+     ++      
Sbjct: 120 KSLMPKFSRMNPAAGLKRMFSPHALVELLKSFGKFLIILAVALVVLSNERNDLVAIAHEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V      +   +  +   D+ +  ++ + KL M+KQE++DE K S G+P
Sbjct: 180 LEQAMIHSLLVVGWSSFWMACGLIFIAAADVPFVLYEAHKKLLMTKQEVRDEHKNSEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM +   A +IITNPTH+A+AL+Y   +  AP+L+AKG +L+A
Sbjct: 240 EVKQRIRQLQREMSQRRMMASIPEADVIITNPTHFAVALKYDPEQGGAPMLLAKGTDLVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            K+R+I   + I I E  +LARS++    ++  IP   Y AVAQ++  +Y 
Sbjct: 300 LKIREIGAHNQILILESAALARSIYYSTELDQEIPAGLYLAVAQVLAYVYQ 350


>gi|295678071|ref|YP_003606595.1| flagellar biosynthetic protein FlhB [Burkholderia sp. CCGE1002]
 gi|295437914|gb|ADG17084.1| flagellar biosynthetic protein FlhB [Burkholderia sp. CCGE1002]
          Length = 411

 Score =  164 bits (414), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 109/361 (30%), Positives = 188/361 (52%), Gaps = 22/361 (6%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   KTE+ + ++++ A  EG    SRE S F+ +LA   Y       G++ ++ 
Sbjct: 1   MAE-DSDLEKTESATPRRLQKAREEGQIVRSRELSTFA-LLAAGFY-------GVWGMSG 51

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGL-LLFMMFGIGSYLIQRIPV-- 117
           ++   L +  +  L      VF    + + A      GL  L  + G+        P+  
Sbjct: 52  NIGEHLQNMVRASLMFNHASVFDTNRMLIGAGTAGREGLYALVPVLGVTGLAALLAPMAL 111

Query: 118 ----LNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTM 173
               L+   ++P F R++  EG  R++SIN  +    S  K ++VG I   ++   +   
Sbjct: 112 GGWQLSAKGLEPKFNRLNPIEGFGRMFSINGPIQLGMSLAKTLVVGLIGGTAIWNRHEQF 171

Query: 174 LDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIG---WSYHQWYSKLKMSKQEIK 230
           L   +   +  L ++   +     M +  +  +  LD+    WSYH+   KL+M+K+E+K
Sbjct: 172 LALATQPLNVALANSMHLIAVCCGMTVAGMFAVAALDVPYQLWSYHK---KLRMTKEEVK 228

Query: 231 DEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPV 290
            E ++S G+P IK + +   R+  R +MM    +A +++TNPTH+A+AL+Y   E  AP 
Sbjct: 229 REHRESEGDPHIKGKIRQQQRAIARRRMMAQVPKADVVVTNPTHFAVALQYTDGEMRAPK 288

Query: 291 LVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           +VAKG NL+A ++R+IA E+N+P+ E P LAR+L+  V +N  IP   Y AVA+++  +Y
Sbjct: 289 VVAKGVNLVAARIREIATENNVPLLEAPPLARALYHNVDLNREIPGPLYGAVAEVLAWVY 348

Query: 351 H 351
            
Sbjct: 349 Q 349


>gi|289433957|ref|YP_003463829.1| flagellar biosynthetic protein FlhB [Listeria seeligeri serovar
           1/2b str. SLCC3954]
 gi|289170201|emb|CBH26741.1| flagellar biosynthetic protein FlhB [Listeria seeligeri serovar
           1/2b str. SLCC3954]
          Length = 348

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 101/341 (29%), Positives = 182/341 (53%), Gaps = 5/341 (1%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A DNKTE  + ++I+ A NEGN   S+E +   S+L  +  LL+FF       T    V 
Sbjct: 2   AKDNKTEKATPRRIKKARNEGNVAKSKELNNAFSLL-IVAGLLYFFGGMFIKNTIQAFVA 60

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           L           S+ +F +        ++++P +++ ++FG+ +Y +Q   + +   VKP
Sbjct: 61  LLKQPPNLASIESYSLFYIMEFG----KVLLPVMIMVVIFGLMNYGVQVGILFSAKAVKP 116

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
            FKR++     KR++S+  LV  +K+ + I L+  +  I   ++  T++ +   N    L
Sbjct: 117 QFKRLNPANYFKRVFSVKGLVEVVKALLLITLLSYVAYIGFRDHLQTLISYTGQNWLYSL 176

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
              F   +   + + L IA + +LD  +  + +   L+MSKQEIKDE+K S G P +K R
Sbjct: 177 KQIFSLFKNEFLALFLVIAVIGLLDFFYQRYDYKKGLRMSKQEIKDEMKDSEGRPEVKQR 236

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
           Q+SIAR  ++  + +  + AT ++ NPTH ++ +RY + ++ AP L+AKG++ +A  +R+
Sbjct: 237 QRSIARGLLQGSITKKMADATFVVNNPTHISVVMRYDKAKDHAPKLLAKGEDELALFIRQ 296

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           +A    +P+     LARS++     +  I    YK V +++
Sbjct: 297 VAETDGVPMITNRQLARSIYYTTNPDEYIQEDLYKDVIEVM 337


>gi|293604994|ref|ZP_06687390.1| flagellar biosynthetic protein FlhB [Achromobacter piechaudii ATCC
           43553]
 gi|292816599|gb|EFF75684.1| flagellar biosynthetic protein FlhB [Achromobacter piechaudii ATCC
           43553]
          Length = 384

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 110/348 (31%), Positives = 187/348 (53%), Gaps = 11/348 (3%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIY-SVTSDLHVLLA 67
            K+EA S +++E A  EG    SRE   F  +LA  + +++     +Y  ++  LH  LA
Sbjct: 8   EKSEAASPRRLEKAREEGQIARSRELGTFM-MLAAGVGVIWAGGGSLYRGLSGVLHNGLA 66

Query: 68  SATQRKLED----ISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
              QR + D    +   V    H  L+   L + G+L  +   + S L+  I V++   +
Sbjct: 67  F-DQRIVTDPGVMVEQAVIGFGHALLAL--LPVFGVLAVVAV-LSSVLLGGI-VISGKPL 121

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           + +F ++SL  G+KR++S   +V  +K+  K +LVG +    +   +  ML  +   P +
Sbjct: 122 QANFSKLSLFAGLKRMFSSQTVVELIKALAKALLVGGVAVWVIWRYHDDMLGLMHVAPSA 181

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            L  A   V     +I+  +  + +LD+ W       KL+MSK++++ E K+S G+P +K
Sbjct: 182 ALIKALSLVAICCALIVASLLVIVLLDVPWQIFSHLKKLRMSKEDVRQEHKESEGDPHVK 241

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R +   R   R +MM    RA +++TNPTHYA+AL+Y + ++ AP ++AKG  LIA K+
Sbjct: 242 ARIRQQQRQAARRRMMSEVPRADVVVTNPTHYAVALKYDEDKSGAPRVIAKGTGLIAAKI 301

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           R++A E+ IP  E P LAR+L + V +   IP   Y AVA+++  ++ 
Sbjct: 302 RELAAENRIPTLEAPPLARALHQHVELGKEIPAELYTAVAEVLAWVFQ 349


>gi|262273550|ref|ZP_06051364.1| flagellar biosynthesis protein FlhB [Grimontia hollisae CIP 101886]
 gi|262222528|gb|EEY73839.1| flagellar biosynthesis protein FlhB [Grimontia hollisae CIP 101886]
          Length = 375

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 119/365 (32%), Positives = 198/365 (54%), Gaps = 30/365 (8%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS++ A D KTE PS +KI  A  EGN P SRE  L ++++     LL      + + +S
Sbjct: 1   MSDSSAQD-KTERPSEQKIRKAREEGNLPRSRE--LVTALMMVASALL------LSAFSS 51

Query: 61  DLHVLLASATQRKLEDISHIVF-------LLTHLSLSASRLVIPGLLLFMMFGIGSYLIQ 113
            +H  + S ++  L      +F       LL   ++ A++ + P   L M+  IG+ L++
Sbjct: 52  AIHHTIVSVSEMTLNIDKDTIFSPDKMGELLWQSAILATQALAPLFALIMLVSIGANLLR 111

Query: 114 RIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTM 173
               ++   + P   +++   GIKRI+S N+LV  +KS +K+  +G  +   L  +Y   
Sbjct: 112 GGWNISTKAMMPKLSKLNPLSGIKRIFSANSLVELIKSILKVTFIGGAL-YWLINHY--- 167

Query: 174 LDFISANPHSILYHA-------FFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSK 226
           L+ I A  H+ L  A        +T   V  ++LLFIA   VL++ +S +++  KLKM+K
Sbjct: 168 LNEIIALQHTRLSAAIPAFLDLLWTGLFVYGLVLLFIA---VLEMPYSSYEYIKKLKMTK 224

Query: 227 QEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEN 286
           QE+K+E K + G P IK R + + R   +    +    A +IITNPTHYA+AL+Y  ++ 
Sbjct: 225 QEVKEEHKNTEGRPEIKARIRQLQRQMSQRAFAKTVPTADVIITNPTHYAVALKYDLSKA 284

Query: 287 DAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           +AP ++AKG +  A ++R+IA +H +P+ E P LAR+++        IP   Y AVA ++
Sbjct: 285 NAPFVIAKGVDQAALQIRQIAQQHGLPVVEVPPLARAVYYSTNEWQEIPAQLYVAVAHVL 344

Query: 347 YKIYH 351
             ++ 
Sbjct: 345 NYVFQ 349


>gi|52080241|ref|YP_079032.1| flagellar biosynthesis protein FlhB [Bacillus licheniformis ATCC
           14580]
 gi|52785618|ref|YP_091447.1| flagellar biosynthesis protein FlhB [Bacillus licheniformis ATCC
           14580]
 gi|319645980|ref|ZP_08000210.1| FlhB protein [Bacillus sp. BT1B_CT2]
 gi|52003452|gb|AAU23394.1| flagella-associated protein [Bacillus licheniformis ATCC 14580]
 gi|52348120|gb|AAU40754.1| FlhB [Bacillus licheniformis ATCC 14580]
 gi|317391730|gb|EFV72527.1| FlhB protein [Bacillus sp. BT1B_CT2]
          Length = 359

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 108/349 (30%), Positives = 193/349 (55%), Gaps = 9/349 (2%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE  + KK  ++  +G   +++ A + +++   +++L F F   I     D  + L  
Sbjct: 13  EKTEKATPKKRRESRKKGQ--VAKSADVNTAVTLLIVFLSFLF---IGPFMRDRLLGLIE 67

Query: 69  ATQRKL----EDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVK 124
              ++L      +++I  L   + L +  ++ P LL  ++ G+ S  +Q   +     +K
Sbjct: 68  KYYKELITMKVSVANIPGLFQSVVLESGLIMAPLLLTAVVSGVLSNYMQVGFLFAPEAIK 127

Query: 125 PSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSI 184
           P  K++    G KRIYSI  +V  +KS +KI++VG +    L  N+  +L   + +    
Sbjct: 128 PDLKKLDPLNGFKRIYSIRAIVELLKSILKIVIVGGVTFAVLWLNFDKILRIPALSAGEA 187

Query: 185 LYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKN 244
           L +  +    + +   + +  L VLD  +    +   ++MSKQ+IKDE K++ G+P+IK+
Sbjct: 188 LSYVGWLTFLMGVSAAVALIFLAVLDYLYQKFDYEKNIRMSKQDIKDEYKKTEGDPLIKS 247

Query: 245 RQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMR 304
           + K   +     +MM+   +A +IITNPTHYA+AL+Y + + DAP ++AKG +L+A K+R
Sbjct: 248 KIKQKQKEMAMRRMMQEVPKADVIITNPTHYAVALKYDENKMDAPFIIAKGVDLMALKIR 307

Query: 305 KIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +IA EH++   E   LAR+L+ QV I+ A+P  F+KAVA+++  +Y  K
Sbjct: 308 QIAKEHDVMTVENRPLARALYDQVEIDQAVPEEFFKAVAEILAYVYKTK 356


>gi|296534146|ref|ZP_06896642.1| flagellar biosynthetic protein FlhB [Roseomonas cervicalis ATCC
           49957]
 gi|296265522|gb|EFH11651.1| flagellar biosynthetic protein FlhB [Roseomonas cervicalis ATCC
           49957]
          Length = 353

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 106/360 (29%), Positives = 187/360 (51%), Gaps = 23/360 (6%)

Query: 1   MSENDAPDNKTEA----PSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSP--G 54
           M+E + P   +E     PS  K+  A   G  P++REA   +S+     + L +F P  G
Sbjct: 1   MAEKEGPGGDSEEKELDPSEAKLRKARESGEVPLAREAVQLASLCGG-AFALSWFGPALG 59

Query: 55  IYSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQR 114
            + V     +   S   R   ++S +      L+L  + L   G ++         L Q 
Sbjct: 60  HHMVEQGRSLFALSHEARWQLELSEMAVRAAPLALGVAGLAATGAVVV-------TLAQT 112

Query: 115 IPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTI---ITISLTENYF 171
             +++   + P+  ++S   G+KR++    LV F ++ +K++  G     ++  +TE   
Sbjct: 113 RLLVSAKPLAPNPMKLSPLRGLKRMFGPQALVEFGRAMLKVVACGLAMWWVSDGITERLP 172

Query: 172 TMLDFISANPHSILYH-AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIK 230
             L    A P   L   A   + ++L   LL    + ++D+GW   +   K++MS+QE+K
Sbjct: 173 QTL----ALPLEELGGLAAELIERLLRGALLAFTVVALVDLGWVRLRHMQKMRMSRQEMK 228

Query: 231 DEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPV 290
           DE+K+S G+P I+ R++ IA  R R + M    +AT+I+TNPTHYA+AL Y +  + AP 
Sbjct: 229 DEMKESEGDPHIRGRRRQIALRRSRSRAMAEVPKATVIVTNPTHYAVALSYRRGIDAAPR 288

Query: 291 LVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           +VA+G + +A ++R+ A +H +P+   P LAR+L++ V   + IP   ++AVA+LI  ++
Sbjct: 289 VVARGVDSMAARIRREAEKHGVPVLPNPPLARALYR-VEEGAQIPAEHFEAVAELIALVW 347


>gi|59712446|ref|YP_205222.1| flagellar biosynthesis protein FlhB [Vibrio fischeri ES114]
 gi|59480547|gb|AAW86334.1| flagellar export pore protein FlhB [Vibrio fischeri ES114]
          Length = 376

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 107/361 (29%), Positives = 197/361 (54%), Gaps = 18/361 (4%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISRE-ASLFSSILACLIYLLFFFSPGIYSVT 59
           M+E+D  + +TE  +SK+++ A ++G    S+E AS+  S+L C    L +F   +    
Sbjct: 1   MAESDGQE-RTEDATSKRLQQAKDKGQVARSKELASV--SVLVCGAVALMWFGEDVARAL 57

Query: 60  SDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPG-LLLFMMFGIGSYLIQRIPVL 118
             +     S ++ ++ D + ++ ++    ++   LV P  L+L  +F         +  +
Sbjct: 58  FSVMERFFSISREEIYDTNKLLEIVGGALIA---LVFPVFLILITLFVAALAGAAGLGGI 114

Query: 119 NLNH--VKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTI---ITISLTENYFTM 173
           + +     P F +++   GIKR++ + + V  +KS +K+ LVG +   +     E+ F +
Sbjct: 115 SFSSEAAMPKFSKMNPMSGIKRMFGMQSWVELLKSILKVSLVGGMAFYLIEGSKEDLFQL 174

Query: 174 -LDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDE 232
            LD   AN    ++H+   +   +++I   +  +  +DI +   Q  ++LKM+KQE+KDE
Sbjct: 175 SLDTYPAN----IFHSLDILLNFILLISCTLLIVVAIDIPFQIWQHANQLKMTKQEVKDE 230

Query: 233 IKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLV 292
            K++ G P +K R + + R   + +MM     A +++TNP HY++ALRY Q+++ AP++V
Sbjct: 231 YKETEGKPEVKGRIRMLQREMTQRRMMADVPSADVVVTNPEHYSVALRYDQSKDAAPIVV 290

Query: 293 AKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
           AKG + +A K+R+IA EHNI I   P LAR+L+    +   IP   + AVAQ++  I+  
Sbjct: 291 AKGVDHVAMKIREIAREHNIDILPAPPLARALYHSTELEQQIPDGLFAAVAQILAYIFQM 350

Query: 353 K 353
           K
Sbjct: 351 K 351


>gi|157161351|ref|YP_001458669.1| flagellar biosynthesis protein FlhB [Escherichia coli HS]
 gi|170019775|ref|YP_001724729.1| flagellar biosynthesis protein FlhB [Escherichia coli ATCC 8739]
 gi|188494102|ref|ZP_03001372.1| flagellar biosynthetic protein FlhB [Escherichia coli 53638]
 gi|193069902|ref|ZP_03050851.1| flagellar biosynthetic protein FlhB [Escherichia coli E110019]
 gi|194439073|ref|ZP_03071156.1| flagellar biosynthetic protein FlhB [Escherichia coli 101-1]
 gi|218695446|ref|YP_002403113.1| flagellar biosynthesis protein FlhB [Escherichia coli 55989]
 gi|253773163|ref|YP_003035994.1| flagellar biosynthesis protein FlhB [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254161940|ref|YP_003045048.1| flagellar biosynthesis protein FlhB [Escherichia coli B str.
           REL606]
 gi|300822346|ref|ZP_07102487.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 119-7]
 gi|300928913|ref|ZP_07144417.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 187-1]
 gi|301645603|ref|ZP_07245532.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 146-1]
 gi|307138545|ref|ZP_07497901.1| flagellar biosynthesis protein FlhB [Escherichia coli H736]
 gi|331642498|ref|ZP_08343633.1| flagellar biosynthetic protein FlhB [Escherichia coli H736]
 gi|157067031|gb|ABV06286.1| flagellar biosynthetic protein FlhB [Escherichia coli HS]
 gi|169754703|gb|ACA77402.1| flagellar biosynthetic protein FlhB [Escherichia coli ATCC 8739]
 gi|188489301|gb|EDU64404.1| flagellar biosynthetic protein FlhB [Escherichia coli 53638]
 gi|192956802|gb|EDV87256.1| flagellar biosynthetic protein FlhB [Escherichia coli E110019]
 gi|194422032|gb|EDX38036.1| flagellar biosynthetic protein FlhB [Escherichia coli 101-1]
 gi|218352178|emb|CAU97917.1| flagellar export pore protein [Escherichia coli 55989]
 gi|242377601|emb|CAQ32357.1| flagellar biosynthesis protein FlhB, subunit of Flagellar Export
           Apparatus and Flagellum [Escherichia coli BL21(DE3)]
 gi|253324207|gb|ACT28809.1| flagellar biosynthetic protein FlhB [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253973841|gb|ACT39512.1| flagellar biosynthesis protein B [Escherichia coli B str. REL606]
 gi|253978035|gb|ACT43705.1| flagellar biosynthesis protein B [Escherichia coli BL21(DE3)]
 gi|300463067|gb|EFK26560.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 187-1]
 gi|300525229|gb|EFK46298.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 119-7]
 gi|301076135|gb|EFK90941.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 146-1]
 gi|315617894|gb|EFU98492.1| flagellar biosynthetic protein FlhB [Escherichia coli 3431]
 gi|323937138|gb|EGB33418.1| flagellar biosynthetic protein FlhB [Escherichia coli E1520]
 gi|323961935|gb|EGB57534.1| flagellar biosynthetic protein FlhB [Escherichia coli H489]
 gi|323972611|gb|EGB67814.1| flagellar biosynthetic protein FlhB [Escherichia coli TA007]
 gi|331039296|gb|EGI11516.1| flagellar biosynthetic protein FlhB [Escherichia coli H736]
 gi|332089613|gb|EGI94715.1| flagellar biosynthetic protein FlhB [Shigella boydii 5216-82]
 gi|332343606|gb|AEE56940.1| flagellar biosynthetic protein FlhB [Escherichia coli UMNK88]
          Length = 382

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 105/353 (29%), Positives = 196/353 (55%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G+ S+   L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVSVIWFGGV-SLARRLS 57

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++        ++D + I+  +  L   A   ++P +   ++  + S ++    V + 
Sbjct: 58  GMLSAGLHFDHSIIKDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSG 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +
Sbjct: 118 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAES 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P
Sbjct: 178 PITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A
Sbjct: 238 HVKGRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 298 LRIREIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|309702103|emb|CBJ01418.1| flagellar biosynthesis protein FlhB [Escherichia coli ETEC H10407]
          Length = 382

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 105/353 (29%), Positives = 196/353 (55%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G+ S+   L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVSVIWFGGV-SLARRLS 57

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++        ++D + I+  +  L   A   ++P +   ++  + S ++    V + 
Sbjct: 58  DMLSAGLHFDHSIIKDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSG 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +
Sbjct: 118 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAES 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P
Sbjct: 178 PITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A
Sbjct: 238 HVKGRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 298 LRIREIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|206889713|ref|YP_002249863.1| flagellar biosynthetic protein FlhB [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206741651|gb|ACI20708.1| flagellar biosynthetic protein FlhB [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 353

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 100/349 (28%), Positives = 189/349 (54%), Gaps = 9/349 (2%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             +TE  + ++ E A  +G  P SRE  L   I   +I+L F FS G + ++   H+  A
Sbjct: 6   QERTEQATPRRREKARQKGEVPRSRE--LTGIIGTWMIFLYFVFS-GTFLISIMQHMKEA 62

Query: 68  SATQRKLEDISHIVFLLTHLSLS---ASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVK 124
               +  E ++  +  +    +       L I G+LLF +  +  + IQ   +     + 
Sbjct: 63  FTRVKNPEFVASAIITIIKDEIKWYFIQFLPIGGVLLFGVLLV--HFIQTGFLFTGATLV 120

Query: 125 PSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSI 184
           P   ++S  +GIK+++S+N L   +K  +K++ +G +I   L ++   +   I  +  +I
Sbjct: 121 PDVSKISPLKGIKKLFSLNALFETIKGILKLVALGIVIYFVLKKDVNILPLLIDMDVKAI 180

Query: 185 LYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKN 244
              +F  + ++++  L+ +     +D  +   Q+   L+M+KQEIK+E K++ G+P+++ 
Sbjct: 181 AGISFQKIYQLILACLIMLTVFAGIDFAYQRWQYERNLRMTKQEIKEEFKETEGSPMVRA 240

Query: 245 RQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMR 304
           R +S+ R   R +MM+   +A ++ITNP H A+ ++Y     +AP +VAKG NL+A++++
Sbjct: 241 RIRSLQREMARKRMMQEVPKADVVITNPLHLAVCIKYDSKNMNAPAVVAKGANLLAERIK 300

Query: 305 KIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +IA    +PI+E   LAR+L++ +P+   IP   YKAVA ++  +Y  K
Sbjct: 301 EIARASGVPIYENKPLARALYR-IPLGEEIPEALYKAVATILATVYKIK 348


>gi|308048765|ref|YP_003912331.1| flagellar biosynthetic protein FlhB [Ferrimonas balearica DSM 9799]
 gi|307630955|gb|ADN75257.1| flagellar biosynthetic protein FlhB [Ferrimonas balearica DSM 9799]
          Length = 389

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 102/360 (28%), Positives = 189/360 (52%), Gaps = 15/360 (4%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFF---FSPGIYS 57
           M+END+   +TE  + ++ E A  +G  P S+E    + ++A    +L         + +
Sbjct: 1   MAENDSSQERTEEATPRRREQAREKGQVPRSKELGTAAVLVAAAAGMLMMGGQIGEAMLT 60

Query: 58  VTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPV 117
           V      L    T+ ++ D+  I  L + +    S L++P L   ++  I  +L   I +
Sbjct: 61  VAKSQFEL----TRAEVFDLGEISELFSRI---LSELMVPVLGFVLVLFIAGFL-GNIGL 112

Query: 118 LNLN----HVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTM 173
             ++       P   ++S   G KR++ +  LV  +KS  K  ++  +    L+ N+  +
Sbjct: 113 GGMSFSWQAAAPKASKMSPLAGFKRMFGLQALVELVKSIAKFAVIALVAWALLSVNFDQI 172

Query: 174 LDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEI 233
           L   S NP   +  A   + K+ +++   +  + ++D  +       +LKM+KQE+KDE 
Sbjct: 173 LQLSSGNPEGAVRDALALLLKLFVLLCSSLLIIVIIDAPYQLWNHNKQLKMTKQEVKDEY 232

Query: 234 KQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVA 293
           KQ+ G P +K + + + R   + +MM    +A +++ NPTHY++ALRY ++ N+AP++VA
Sbjct: 233 KQTEGKPEVKGKIRQLQREMAQRRMMAEVPKADVVVVNPTHYSVALRYDKSINNAPLVVA 292

Query: 294 KGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           KG + IA K+R+IA EH +P+   P+LAR+++    ++S IP   + AVAQ++  +Y  K
Sbjct: 293 KGTDEIALKIREIAREHEVPVVSSPALARAVYYSTKLDSPIPEGLFTAVAQILAYVYQLK 352


>gi|320198575|gb|EFW73175.1| Flagellar biosynthesis protein FlhB [Escherichia coli EC4100B]
          Length = 382

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 105/353 (29%), Positives = 196/353 (55%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G+ S+   L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVSVIWFGGV-SLARRLS 57

Query: 64  VLLASATQRK---LEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++  +     + D + I+  +  L   A   ++P +   ++  + S ++    V + 
Sbjct: 58  GMLSAGLRFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSG 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +
Sbjct: 118 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAES 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P
Sbjct: 178 PITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A
Sbjct: 238 HVKGRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 298 LRIREIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|94264043|ref|ZP_01287843.1| Flagellar biosynthetic protein FlhB [delta proteobacterium MLMS-1]
 gi|94266371|ref|ZP_01290070.1| Flagellar biosynthetic protein FlhB [delta proteobacterium MLMS-1]
 gi|93453023|gb|EAT03511.1| Flagellar biosynthetic protein FlhB [delta proteobacterium MLMS-1]
 gi|93455554|gb|EAT05741.1| Flagellar biosynthetic protein FlhB [delta proteobacterium MLMS-1]
          Length = 356

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 103/360 (28%), Positives = 185/360 (51%), Gaps = 15/360 (4%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVT- 59
           M+E  +   KTE P+ +++ +A N+G+   S E    + +LA +I L F        VT 
Sbjct: 1   MAEEQSGQEKTEKPTERRLLEARNKGDVAKSMEVPSAAVLLAGVIVLYFTGEYMFNRVTG 60

Query: 60  ------SDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQ 113
                 S+LH +  SA    + +I+  V LL +  L       P +L   +  + +  +Q
Sbjct: 61  MMQFYLSNLHDIEISAAS--MPNITRQVMLLIYTVL------WPLMLTVFLAALAANYLQ 112

Query: 114 RIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTM 173
              +     + P  +++   +G+ R++S   L N  KS  K  LVG I    +      +
Sbjct: 113 VGFLFTAEKITPKLEKIDPLKGLGRLFSKQTLNNAFKSIAKFSLVGYIAYSEIIRAMPEI 172

Query: 174 LDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEI 233
           L      P+ IL     T   + +   +    + ++D  +   Q+  K+KM+KQ++KDE 
Sbjct: 173 LPLADKAPYPILVFMVETAFWIFLKCAVLFILIALIDYAFQRWQFMEKMKMTKQDMKDES 232

Query: 234 KQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVA 293
           KQS G+P +K R +SI     + +MM    +A +++TNPTH A+A++Y      AP ++A
Sbjct: 233 KQSEGDPHVKGRIRSIQMEMAKKRMMAEVPKADVVVTNPTHLAVAIKYDALTMKAPEVLA 292

Query: 294 KGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           KG  ++A K++++A EH +P+ E+  LA++L++ V I  +IP   ++AVA+++  +Y+ K
Sbjct: 293 KGAGVVANKIKEVAREHQVPVVEDKPLAQALYQNVEIGGSIPENLFQAVAEVLAYVYNLK 352


>gi|34558296|ref|NP_908111.1| flagellar biosynthesis protein FlhB [Wolinella succinogenes DSM
           1740]
 gi|34484015|emb|CAE11011.1| FLAGELLAR BIOSYNTHETIC PROTEIN FLHB [Wolinella succinogenes]
          Length = 352

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 113/363 (31%), Positives = 187/363 (51%), Gaps = 33/363 (9%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLI--YLLF-FFSPGIYSVTSDLHV 64
           + KTE PS KKIE A  +GN P S E  +F  +L  LI  Y+LF ++  G   V   +  
Sbjct: 5   EEKTEEPSGKKIEKAREDGNVPKSPEVVVFFGLLVGLILIYVLFTYWVDGTGRVFHQVTP 64

Query: 65  LLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVK 124
                  RK       + L   ++L    LVIP  +  M+ G+   + Q   +L+   ++
Sbjct: 65  YFHEEIGRK-----DAISLAISIALEYFLLVIPLFIALMIIGVAGNVSQFGFLLSSKAIE 119

Query: 125 PSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTE----NYFTMLDFISAN 180
           P F +++   G+K ++S+  L++           GT++T+ +       ++  L FI   
Sbjct: 120 PKFSKLNPITGLKNLFSLKKLLD-----------GTLLTVKVLTAFGIGFWVFLSFIGEL 168

Query: 181 PHSILYHAFFTVR-------KVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEI 233
               L+  F  +R        +  ++LLF   +  +D     +Q++  L+M+KQE+KDE 
Sbjct: 169 TTVSLFPLFDQMRWFKDKALILAAILLLFFFVMASIDFAIKRYQYFKSLRMTKQEVKDEY 228

Query: 234 KQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVA 293
           KQ  GNP IK + + +       +MM+    A ++ITNPTHYA+ALRY   +  AP ++A
Sbjct: 229 KQMEGNPEIKRKIRQLMMQAAMKRMMQQLPTADVVITNPTHYAVALRYNTQKERAPRVIA 288

Query: 294 KGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQL---IYKIY 350
           KG + +A ++++IA EH I I E  +LAR L+K   ++  IP   ++AVA++   +YK+ 
Sbjct: 289 KGVDFMAIRIKEIAREHEIQIVENKTLARELYKNADVDKEIPETLFQAVAEVLAYVYKLN 348

Query: 351 HKK 353
            KK
Sbjct: 349 KKK 351


>gi|320194407|gb|EFW69038.1| Flagellar biosynthesis protein FlhB [Escherichia coli WV_060327]
          Length = 382

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 105/353 (29%), Positives = 195/353 (55%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G+ ++   L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVSVIWFGGV-ALARPLS 57

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++        + D + I+  +  L   A   ++P +   ++  I S ++    V + 
Sbjct: 58  GMLSAGLHFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVAIISPVMLGGLVFSG 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +
Sbjct: 118 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAES 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P
Sbjct: 178 PITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A
Sbjct: 238 HVKGRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 298 LRIREIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|291484192|dbj|BAI85267.1| flagellar biosynthesis protein FlhB [Bacillus subtilis subsp. natto
           BEST195]
          Length = 360

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 112/348 (32%), Positives = 184/348 (52%), Gaps = 7/348 (2%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE  + KK +D   +G    S + +   S+L   + L+         + S +      
Sbjct: 13  EKTEKATPKKRKDTRKKGQVAKSSDVNTAVSLLVIFLSLIAIGPYMRDRLLSFIETFYTE 72

Query: 69  ATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFK 128
           +   KL + S++  L   L      ++ P LL+ ++ G+ S  +Q   + +   ++P  +
Sbjct: 73  SLTMKLSE-SNVHTLFVSLLKDMGIILAPILLVALVAGVVSNYMQVGFLFSAEVIQPKLE 131

Query: 129 RVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHA 188
           ++   +G KRIYS+  +V  +KS +KI++VG      L  +Y  +L      P   L   
Sbjct: 132 KLDPIKGFKRIYSMRAIVELIKSILKIVVVGFAAFAVLWLHYGEILRLPLLTPEEALS-- 189

Query: 189 FFTVRKVLIMILLFIATLTVL---DIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
            F  +  L M L     L +L   D  +    +   +KMSKQ+IKDE K+S G+PIIK++
Sbjct: 190 -FVSKLTLWMGLSGAGALLILAGLDYLYQRFDYEKNIKMSKQDIKDEYKKSEGDPIIKSK 248

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
            K   R     +MM+   +A +IITNPTHYA+AL+Y + + DAP +VAKG + +A K+RK
Sbjct: 249 IKQRQREMAMRRMMQEVPKADVIITNPTHYAIALKYDEEKMDAPYIVAKGVDHLALKIRK 308

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           IA EH++ + E   LAR+L+ QV I+ A+P  F+K +A+++  +Y  K
Sbjct: 309 IAKEHDVMMVENRPLARALYDQVEIDQAVPEEFFKVLAEILAYVYKTK 356


>gi|191168095|ref|ZP_03029894.1| flagellar biosynthetic protein FlhB [Escherichia coli B7A]
 gi|309796010|ref|ZP_07690423.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 145-7]
 gi|190901893|gb|EDV61643.1| flagellar biosynthetic protein FlhB [Escherichia coli B7A]
 gi|308120460|gb|EFO57722.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 145-7]
          Length = 382

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 105/353 (29%), Positives = 195/353 (55%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G+ S+   L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVSVIWFGGV-SLARRLS 57

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++        + D + I+  +  L   A   ++P +   ++  + S ++    V + 
Sbjct: 58  GMLSAGLHFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSG 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +
Sbjct: 118 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFYLWHHWPQMMRLMAES 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P
Sbjct: 178 PITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A
Sbjct: 238 HVKGRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 298 LRIREIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|259908202|ref|YP_002648558.1| Flagellar biosynthesis protein FlhB [Erwinia pyrifoliae Ep1/96]
 gi|224963824|emb|CAX55326.1| Flagellar biosynthesis protein FlhB [Erwinia pyrifoliae Ep1/96]
 gi|283478130|emb|CAY74046.1| Flagellar biosynthetic protein FlhB [Erwinia pyrifoliae DSM 12163]
          Length = 383

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 97/351 (27%), Positives = 191/351 (54%), Gaps = 7/351 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+ + KTE+P++ ++E A  EG  P SRE    +S+L  +  L   +  G + +   + 
Sbjct: 3   QDSDEEKTESPTAHRLEKAREEGQIPRSRE---LTSLLMLMTGLSILWVGGEW-MGRKMG 58

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            LLA         + D S ++ L+ ++ L A   V+P +   ++  I + ++    V++ 
Sbjct: 59  ALLADGLVFNHSVVSDTSQMLRLIANMLLQAVMAVLPMMFGLVVVAIAAPMLLGGLVISG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K    +++  +G+ +++S+ +    +K+ +K  LVG +  + +  ++  ML  ++ +
Sbjct: 119 KAIKFDPGKMNPIKGLGKLFSVQSAAELLKAVLKATLVGVVCGLYIWHHWAGMLHLMAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + L  A   +    I+++L ++ +   D+ +    ++  L+MS Q+I+DE KQ  G+P
Sbjct: 179 PLTALAGAMNMIAMCCILVVLGLSPMVGFDVFYQLFSYFKNLRMSHQDIRDEHKQQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A +I+TNPTHY++AL+Y + +  AP +VAKG   IA
Sbjct: 239 HVKGRIRQQMRAAARRRMMADVPKADVIVTNPTHYSVALQYDEKKMSAPKVVAKGAGDIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            ++R++   + IP+ E P LAR+L++   I   IP   Y AVA+++  ++ 
Sbjct: 299 LRIRELGAANRIPVLEAPPLARALYRHSEIGQHIPGALYAAVAEVLAWVWQ 349


>gi|254491439|ref|ZP_05104618.1| flagellar biosynthetic protein FlhB [Methylophaga thiooxidans
           DMS010]
 gi|224462917|gb|EEF79187.1| flagellar biosynthetic protein FlhB [Methylophaga thiooxydans
           DMS010]
          Length = 377

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 113/370 (30%), Positives = 194/370 (52%), Gaps = 33/370 (8%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  A + KTE P++K++++A N+G  P SRE +    ++A  + LLF     I S+  
Sbjct: 1   MAEQSAQE-KTEEPTAKRLDEARNKGQVPRSRELTTVMVLIASAVALLFMGKNIIASMAQ 59

Query: 61  DLHVLLASATQRKLED----ISHIVFLLTHLSLSASRL--VIPGLLLFMMFGIGSYLIQR 114
            ++    S T+++L D    I H ++ +  ++   S    V     L     IG +    
Sbjct: 60  VMNKSF-SFTRKELFDPMAMIHHFIYTIETIAFDLSMFLGVTVLAALAAPALIGGW---- 114

Query: 115 IPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITI---SLTENYF 171
               +   + P  +R+   +G+KRI+    L+   K+  K ILVG I T    S+ +   
Sbjct: 115 --NFSAQAMAPKGERMDPLKGLKRIFGPQGLIELAKALGKFILVGVISTAILWSIRDQLL 172

Query: 172 TM----LDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQ 227
           T+    ++   A+   +    F  +   LI+I L      +    W++++   +L+M+KQ
Sbjct: 173 TLGRQEVNVAMADLGYLTMWVFLAICASLILIALIDVPFQI----WNHNR---QLRMTKQ 225

Query: 228 EIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEND 287
           E+KDE+K++ GNP +K R + +     + +MM+    A ++ITNPTHYA+ALRY QT+  
Sbjct: 226 EVKDEMKETDGNPEVKGRIRRMQVELSQQRMMQDIPSADVVITNPTHYAVALRYDQTKTG 285

Query: 288 APVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI- 346
           APV+VAKG + I++++R +A  +++PI   P L R+++    I   IP   Y AVAQ++ 
Sbjct: 286 APVVVAKGADFISQQIRLVAEHNDVPILSAPPLTRAVYYSTEIGDEIPSGLYIAVAQVLA 345

Query: 347 ----YKIYHK 352
                + YHK
Sbjct: 346 FVFQLRRYHK 355


>gi|120554898|ref|YP_959249.1| flagellar biosynthesis protein FlhB [Marinobacter aquaeolei VT8]
 gi|120324747|gb|ABM19062.1| flagellar biosynthetic protein FlhB [Marinobacter aquaeolei VT8]
          Length = 378

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 101/354 (28%), Positives = 179/354 (50%), Gaps = 9/354 (2%)

Query: 2   SENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFF---FSPGIYSV 58
            END    KTE P+ +++E A  EG    S+E +  + +LA    LL F       I S+
Sbjct: 3   EENDNSQEKTEEPTPRRLEKAKEEGQTARSKELATMAVLLAGAGGLLIFGTSLGASIESI 62

Query: 59  TSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGI-GSYLIQRIPV 117
             D  V+  SA    + D  H+   L   +  A+  + P L++ ++  I GS  I  + +
Sbjct: 63  MRDSFVIERSA----IFDTRHMSVQLILAAKEAAWALSPILVMLLIAAIAGSIGIGGL-L 117

Query: 118 LNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFI 177
            +   + P F R+   +G+ R++S+ +L+  +K+  K+ LV  +  + L      +L   
Sbjct: 118 FSAKAIAPKFNRMDPIKGLGRMFSMRSLIELVKAIAKVGLVMAVAILILNLRTEDLLAIA 177

Query: 178 SANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSY 237
                  + H  +T+      +      +  +D+ +  +    KL+M+KQE+KDE K + 
Sbjct: 178 EEPTVPAMEHVLWTLGWSFFFLSCATIAIAAIDVPFQIYDHQKKLRMTKQEVKDEYKDTE 237

Query: 238 GNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQN 297
           G P +K + + + R   + +MM+   +A ++ITNPTHYA+AL+Y Q    APV+VAKG +
Sbjct: 238 GKPEVKGKIRQLQREMAQRRMMQDVPKADVVITNPTHYAVALKYDQKTMGAPVVVAKGAD 297

Query: 298 LIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            +A K+ +IA E+ + +   P L R+++    I   IP   Y A+AQ++  ++ 
Sbjct: 298 EVAFKIMEIARENKVEVLRTPPLTRAVYHNTDIGEEIPDGLYMAIAQVLAYVFQ 351


>gi|188592105|ref|YP_001796703.1| flagellar biosynthesis protein flhb [Cupriavidus taiwanensis LMG
           19424]
 gi|170938479|emb|CAP63466.1| FlhB: Flagellar biosynthetic protein. flhB/hrpN/yscU/spaS family
           [Cupriavidus taiwanensis LMG 19424]
          Length = 380

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 106/358 (29%), Positives = 180/358 (50%), Gaps = 27/358 (7%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE  S +++E A  EG    SRE + F  ++A +         G++++   L   L  
Sbjct: 8   EKTEPASPRRLEKAREEGQVVRSRELATFVMLIAGVT--------GLWTLGGHLGRSLNQ 59

Query: 69  ATQRKLEDISHIVF----LLTHLSLSASRLVIPGLLLFMMFGI---------GSYLIQRI 115
             Q  L       F    +L+  +L     ++  L L ++FG+         G +     
Sbjct: 60  VMQGALRFEPATAFDPARMLSRFALMVWDSLLAFLPLLLLFGVAALAAPLLLGGW----- 114

Query: 116 PVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLD 175
            V +     P F R+S   G+ R++S ++LV  +K+  K +LVG +    L       + 
Sbjct: 115 -VFSGKSFAPQFSRLSPIAGLGRMFSAHSLVELLKAVAKSLLVGAVGAWVLWRRLPEAIA 173

Query: 176 FISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQ 235
            ++A     L H    V    +++ L +  +  +D+ W Y +++ KL+M+K+E+K E K+
Sbjct: 174 LMNAPVQEALLHMVDLVMFCCLVVSLSLLVVAAIDVPWQYWEFFKKLRMTKEEVKQEFKE 233

Query: 236 SYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKG 295
           S G+P IKNR +   R+  R +MM    +A +++TNPTH+A+ALRY +    AP +VAKG
Sbjct: 234 SEGDPHIKNRIRQQQRAMARRRMMTEVPKADVVVTNPTHFAVALRYEEGRMGAPRVVAKG 293

Query: 296 QNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
              +A ++R +A EH +P+   P LAR+L + V +   IP   Y AVA+++  +Y  K
Sbjct: 294 TGEVAARIRALAAEHRVPLMSAPPLARALHRHVELGQEIPAGLYTAVAEVLAWVYQLK 351


>gi|293446267|ref|ZP_06662689.1| flagellar biosynthetic protein FlhB [Escherichia coli B088]
 gi|291323097|gb|EFE62525.1| flagellar biosynthetic protein FlhB [Escherichia coli B088]
          Length = 396

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 105/353 (29%), Positives = 195/353 (55%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G+ S+   L 
Sbjct: 16  SDESDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVSVIWFGGV-SLARRLS 71

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++        + D + I+  +  L   A   ++P +   ++  + S ++    V + 
Sbjct: 72  GMLSAGLHFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSG 131

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +
Sbjct: 132 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAES 191

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P
Sbjct: 192 PITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDP 251

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A
Sbjct: 252 HVKGRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVA 311

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 312 LRIREIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 364


>gi|149182522|ref|ZP_01860995.1| flagellar biosynthesis protein B [Bacillus sp. SG-1]
 gi|148849782|gb|EDL63959.1| flagellar biosynthesis protein B [Bacillus sp. SG-1]
          Length = 360

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 115/351 (32%), Positives = 194/351 (55%), Gaps = 13/351 (3%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            K+E  + KK +D+  +G    S++ +    +LA  ++L F  S  I  V  DL  +  S
Sbjct: 14  EKSEKATPKKRQDSRKKGQTAKSQDVNTAIILLAVFLFLTFSASY-IGDVIFDLFRI--S 70

Query: 69  ATQRKLEDISHIVFLLTHLSL--SASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
                + D++   F+L  + +    + L+ P +L+ ++ G+ S  IQ   +     ++P 
Sbjct: 71  FQDYMMMDLTQDSFMLIVMEVLQQVAILLGPIMLVALLAGLFSNYIQVGVMFTAEPLQPK 130

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLD--FISANPHSI 184
            +++   +G KRI+S+  +V  +KS +KI  VG I  + L  N   +L   F SA   S+
Sbjct: 131 LEKIDPIKGAKRIFSLRAIVELLKSILKIGFVGAITFVILWMNIDEVLGLSFKSAY-DSL 189

Query: 185 LYHAFFTVRKVLI--MILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPII 242
              A  TV+  +   + LLF   L+V D  +  + +   ++MSKQ+IKDE K + G+P+I
Sbjct: 190 AAMASLTVQMGIAASLALLF---LSVFDYLYQKYDFEKNIRMSKQDIKDEHKNAEGDPLI 246

Query: 243 KNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKK 302
           K++ K   R     +MM+    A ++ITNPTHYA+AL+Y + ++DAP ++AKG + +A+K
Sbjct: 247 KSKIKQRQREMAMRRMMQEVPEADVVITNPTHYAIALKYDENKSDAPYVIAKGVDYMAQK 306

Query: 303 MRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           ++ IA EH+I + E   LARSL+    I   IP  F+KAVA+++  +Y  K
Sbjct: 307 IKYIAGEHDIIMVENRPLARSLYDSAEIGDTIPEEFFKAVAEILAYVYRMK 357


>gi|332756021|gb|EGJ86374.1| flagellar biosynthetic protein FlhB [Shigella flexneri 4343-70]
 gi|333003254|gb|EGK22800.1| flagellar biosynthetic protein FlhB [Shigella flexneri K-218]
          Length = 397

 Score =  163 bits (412), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 105/353 (29%), Positives = 194/353 (54%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G+ S+   L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVSVIWFGGV-SLARRLS 57

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++        ++D + I+  +  L   A   ++P +   ++  + S ++    V + 
Sbjct: 58  GMLSAGLHFDHSIIKDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSG 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKRI+S       +K+ +K ILVG++    L  ++  M+  ++ +
Sbjct: 118 KSLQPKFSKLNPLPGIKRIFSAQTSAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAES 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQ  G+P
Sbjct: 178 PITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQGEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R   + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A
Sbjct: 238 HVKGRICQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 298 LRIREIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|315296540|gb|EFU55837.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 16-3]
          Length = 382

 Score =  163 bits (412), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 105/353 (29%), Positives = 195/353 (55%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G+ ++   L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVSVIWFGGV-ALARRLS 57

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++        + D + I+  +  L   A   ++P +   ++  I S ++    V + 
Sbjct: 58  GMLSAGLHFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVAIISPVMLGGLVFSG 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +
Sbjct: 118 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAES 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P
Sbjct: 178 PITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A
Sbjct: 238 HVKGRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 298 LRIREIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|16129832|ref|NP_416394.1| flagellin export apparatus, substrate specificity protein
           [Escherichia coli str. K-12 substr. MG1655]
 gi|89108720|ref|AP_002500.1| predicted flagellar export pore protein [Escherichia coli str. K-12
           substr. W3110]
 gi|157156351|ref|YP_001463185.1| flagellar biosynthesis protein FlhB [Escherichia coli E24377A]
 gi|170081536|ref|YP_001730856.1| flagellar export pore protein [Escherichia coli str. K-12 substr.
           DH10B]
 gi|193065459|ref|ZP_03046528.1| flagellar biosynthetic protein FlhB [Escherichia coli E22]
 gi|194429326|ref|ZP_03061852.1| flagellar biosynthetic protein FlhB [Escherichia coli B171]
 gi|209919306|ref|YP_002293390.1| flagellar biosynthesis protein FlhB [Escherichia coli SE11]
 gi|218554468|ref|YP_002387381.1| flagellar biosynthesis protein FlhB [Escherichia coli IAI1]
 gi|238901095|ref|YP_002926891.1| putative flagellar export pore protein [Escherichia coli BW2952]
 gi|256017916|ref|ZP_05431781.1| flagellar biosynthesis protein FlhB [Shigella sp. D9]
 gi|260844290|ref|YP_003222068.1| putative flagellar export pore protein FlhB [Escherichia coli
           O103:H2 str. 12009]
 gi|260855820|ref|YP_003229711.1| putative flagellar export pore protein FlhB [Escherichia coli
           O26:H11 str. 11368]
 gi|260868478|ref|YP_003234880.1| putative flagellar export pore protein FlhB [Escherichia coli
           O111:H- str. 11128]
 gi|293410191|ref|ZP_06653767.1| flagellar biosynthetic protein FlhB [Escherichia coli B354]
 gi|293415195|ref|ZP_06657838.1| flagellar biosynthetic protein FlhB [Escherichia coli B185]
 gi|300819864|ref|ZP_07100049.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 107-1]
 gi|300924972|ref|ZP_07140897.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 182-1]
 gi|300951503|ref|ZP_07165338.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 116-1]
 gi|300956607|ref|ZP_07168886.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 175-1]
 gi|301029330|ref|ZP_07192427.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 196-1]
 gi|301327670|ref|ZP_07220877.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 78-1]
 gi|307314208|ref|ZP_07593818.1| flagellar biosynthetic protein FlhB [Escherichia coli W]
 gi|331668576|ref|ZP_08369424.1| flagellar biosynthetic protein FlhB [Escherichia coli TA271]
 gi|331673405|ref|ZP_08374173.1| flagellar biosynthetic protein FlhB [Escherichia coli TA280]
 gi|331677765|ref|ZP_08378440.1| flagellar biosynthetic protein FlhB [Escherichia coli H591]
 gi|332278948|ref|ZP_08391361.1| flagellar biosynthesis protein FlhB [Shigella sp. D9]
 gi|2494574|sp|P76299|FLHB_ECOLI RecName: Full=Flagellar biosynthetic protein flhB
 gi|1736533|dbj|BAA15696.1| predicted flagellar export pore protein [Escherichia coli str. K12
           substr. W3110]
 gi|1788188|gb|AAC74950.1| flagellin export apparatus, substrate specificity protein
           [Escherichia coli str. K-12 substr. MG1655]
 gi|157078381|gb|ABV18089.1| flagellar biosynthetic protein FlhB [Escherichia coli E24377A]
 gi|169889371|gb|ACB03078.1| predicted flagellar export pore protein [Escherichia coli str. K-12
           substr. DH10B]
 gi|192926864|gb|EDV81489.1| flagellar biosynthetic protein FlhB [Escherichia coli E22]
 gi|194412633|gb|EDX28929.1| flagellar biosynthetic protein FlhB [Escherichia coli B171]
 gi|209912565|dbj|BAG77639.1| flagellar protein FlhB [Escherichia coli SE11]
 gi|218361236|emb|CAQ98820.1| flagellar export pore protein [Escherichia coli IAI1]
 gi|222033628|emb|CAP76369.1| flagellar biosynthetic protein flhB [Escherichia coli LF82]
 gi|238862415|gb|ACR64413.1| predicted flagellar export pore protein [Escherichia coli BW2952]
 gi|257754469|dbj|BAI25971.1| predicted flagellar export pore protein FlhB [Escherichia coli
           O26:H11 str. 11368]
 gi|257759437|dbj|BAI30934.1| predicted flagellar export pore protein FlhB [Escherichia coli
           O103:H2 str. 12009]
 gi|257764834|dbj|BAI36329.1| predicted flagellar export pore protein FlhB [Escherichia coli
           O111:H- str. 11128]
 gi|260448997|gb|ACX39419.1| flagellar biosynthetic protein FlhB [Escherichia coli DH1]
 gi|284921799|emb|CBG34872.1| flagellar biosynthesis protein FlhB [Escherichia coli 042]
 gi|291432843|gb|EFF05822.1| flagellar biosynthetic protein FlhB [Escherichia coli B185]
 gi|291470659|gb|EFF13143.1| flagellar biosynthetic protein FlhB [Escherichia coli B354]
 gi|299877756|gb|EFI85967.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 196-1]
 gi|300316589|gb|EFJ66373.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 175-1]
 gi|300418847|gb|EFK02158.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 182-1]
 gi|300449253|gb|EFK12873.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 116-1]
 gi|300527561|gb|EFK48623.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 107-1]
 gi|300845765|gb|EFK73525.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 78-1]
 gi|306906177|gb|EFN36695.1| flagellar biosynthetic protein FlhB [Escherichia coli W]
 gi|312946479|gb|ADR27306.1| flagellar biosynthesis protein FlhB [Escherichia coli O83:H1 str.
           NRG 857C]
 gi|315061186|gb|ADT75513.1| predicted flagellar export pore protein [Escherichia coli W]
 gi|315136523|dbj|BAJ43682.1| flagellar biosynthetic protein FlhB [Escherichia coli DH1]
 gi|323180678|gb|EFZ66223.1| flagellar biosynthetic protein FlhB [Escherichia coli 1180]
 gi|323186344|gb|EFZ71694.1| flagellar biosynthetic protein FlhB [Escherichia coli 1357]
 gi|323378237|gb|ADX50505.1| flagellar biosynthetic protein FlhB [Escherichia coli KO11]
 gi|323940452|gb|EGB36643.1| flagellar biosynthetic protein FlhB [Escherichia coli E482]
 gi|323948234|gb|EGB44222.1| flagellar biosynthetic protein FlhB [Escherichia coli H120]
 gi|324017961|gb|EGB87180.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 117-3]
 gi|324118940|gb|EGC12829.1| flagellar biosynthetic protein FlhB [Escherichia coli E1167]
 gi|331063770|gb|EGI35681.1| flagellar biosynthetic protein FlhB [Escherichia coli TA271]
 gi|331069603|gb|EGI40990.1| flagellar biosynthetic protein FlhB [Escherichia coli TA280]
 gi|331074225|gb|EGI45545.1| flagellar biosynthetic protein FlhB [Escherichia coli H591]
 gi|332101300|gb|EGJ04646.1| flagellar biosynthesis protein FlhB [Shigella sp. D9]
          Length = 382

 Score =  163 bits (412), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 105/353 (29%), Positives = 195/353 (55%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G+ S+   L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVSVIWFGGV-SLARRLS 57

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++        + D + I+  +  L   A   ++P +   ++  + S ++    V + 
Sbjct: 58  GMLSAGLHFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSG 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +
Sbjct: 118 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAES 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P
Sbjct: 178 PITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A
Sbjct: 238 HVKGRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 298 LRIREIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|3169254|gb|AAC17834.1| flagellar protein FlhB [Escherichia coli]
          Length = 382

 Score =  163 bits (412), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 108/367 (29%), Positives = 197/367 (53%), Gaps = 35/367 (9%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGI-------- 55
           +D  D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G+        
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVSVIWFGGVSLARRLSG 58

Query: 56  ---------YSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFG 106
                    +S+ +D +++L        E +  ++ L++ + L A  L+ P +L  ++F 
Sbjct: 59  MLSAGLHFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVA--LISPVMLGGLVFS 116

Query: 107 IGSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISL 166
             S             ++P F +++   GIKR++S       +K+ +K ILVG++    L
Sbjct: 117 GKS-------------LQPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFL 163

Query: 167 TENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSK 226
             ++  M+  ++ +P + + +A   V    ++++L +  +   D+ +       KL+MS+
Sbjct: 164 WHHWPQMMRLMAESPITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSR 223

Query: 227 QEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEN 286
           Q+I+DE KQS G+P +K R + + R+R R +MM    +A +I+ NPTHY++AL+Y + + 
Sbjct: 224 QDIRDEFKQSEGDPHVKGRIRQMQRARARRRMMADVPKADVIVNNPTHYSVALQYDENKM 283

Query: 287 DAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
            AP +VAKG  L+A ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++
Sbjct: 284 SAPKVVAKGAGLVALRIREIGAENNVPTLEAPRLARALYRHAEIGQQIPGQLYAAVAEVL 343

Query: 347 YKIYHKK 353
             ++  K
Sbjct: 344 AWVWQLK 350


>gi|332140595|ref|YP_004426333.1| flagellar biosynthesis protein [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327550617|gb|AEA97335.1| flagellar biosynthesis protein [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 374

 Score =  163 bits (412), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 100/356 (28%), Positives = 192/356 (53%), Gaps = 23/356 (6%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLF---FFSPGIYSVTSDLHVL 65
            KTE P+ KK++DA  +G    SRE S    ++   +  LF   + +  ++ +T  + +L
Sbjct: 6   EKTEDPTGKKLDDARKKGQLARSRELSTTLVLIVSAVMFLFVGGWIAESVFKLTRRMFIL 65

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLN---- 121
               ++ +  DI+H+ F     + SA   V P +LL+M+  + + +   I +   N    
Sbjct: 66  ----SRDETYDITHM-FGAWGEAFSA---VGPAVLLYMVVAMIAGIYGSIALGGFNFTWE 117

Query: 122 HVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKII-LVGTIITISL---TENYFTMLDFI 177
             KP   ++S  +G KR++  N LV  +KS  K++ ++G  I   L    E     ++  
Sbjct: 118 GAKPKGSKMSPIQGFKRMFGTNGLVELLKSIAKVVVIIGMAIGALLFFEDEALHLDMELY 177

Query: 178 SANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSY 237
             N    L+HA   ++   ++++  +  + ++D+ +  ++   ++KM+KQE+KDE K + 
Sbjct: 178 PGN----LFHAMDILKWAFLILVCGMIPIALIDVPYQMYKHNKEMKMTKQEVKDERKNAE 233

Query: 238 GNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQN 297
           G+P++K R + +       +MM+   +A +++TNPTH+++A++Y +    APV+VAKG +
Sbjct: 234 GDPMVKGRIRRLQYQAATKRMMQEVPQADVVVTNPTHFSVAIKYDEKGIRAPVVVAKGAD 293

Query: 298 LIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            +A  +RKIA  +++P+   P LAR++F    ++  IP   + AVAQ++  +Y  K
Sbjct: 294 ELAMHIRKIATANDVPLIPSPMLARAIFYSTEVDDEIPNALFMAVAQVLAHVYQLK 349


>gi|312969924|ref|ZP_07784107.1| flagellar biosynthetic protein FlhB [Escherichia coli 1827-70]
 gi|310338209|gb|EFQ03298.1| flagellar biosynthetic protein FlhB [Escherichia coli 1827-70]
          Length = 382

 Score =  162 bits (411), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 105/353 (29%), Positives = 196/353 (55%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G+ S+   L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVSVIWFGGV-SLARRLS 57

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++        ++D + I+  +  L   A   ++P +   ++  + S ++    V + 
Sbjct: 58  GMLSAGLHFDHSIIKDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSG 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +
Sbjct: 118 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAES 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P
Sbjct: 178 PITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A
Sbjct: 238 HVKGRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLLA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 298 LRIREIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|300694355|ref|YP_003750328.1| flagellar export pore protein [Ralstonia solanacearum PSI07]
 gi|299076392|emb|CBJ35708.1| flagellar export pore protein [Ralstonia solanacearum PSI07]
          Length = 389

 Score =  162 bits (411), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 107/364 (29%), Positives = 183/364 (50%), Gaps = 29/364 (7%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE D+   KTE+ S +++E A  EG+ P SRE   F         LL   + G++ +  
Sbjct: 1   MSE-DSDLEKTESASPRRLEQAREEGDVPQSRELVSF--------VLLAVAAGGLWVMGE 51

Query: 61  DLHVLLASATQRKLE----DISHIVFLLTHLSLSASRL--VIPGLLLFMMFGIGSYLIQR 114
            +    +S   R LE    D +       ++      L  V+ GL+L ++    S L   
Sbjct: 52  SIVRTASSFLARCLEFHRYDYTRAQAQWQYVGAQFGPLAMVLAGLMLMLVLASLSPLALT 111

Query: 115 IPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTML 174
              ++   + P   R+    G+KR++S+  L+   +   K+ LVG +        ++ +L
Sbjct: 112 RGAISFKPLTPDISRLIGLHGLKRMFSVQGLLELPRLLAKLALVGGV-------GWWLIL 164

Query: 175 DFISAN---PHSILYHAFFTVRKVLIMILLFIATLTVL----DIGWSYHQWYSKLKMSKQ 227
            +  A    P   L         V  +  L +A + +L    D+  +  Q+  K +M+K+
Sbjct: 165 HYRDAFVELPRGDLVAGMRDTMHVAGVAFLCMAGVMLLVAAVDVPLALWQYARKHRMTKE 224

Query: 228 EIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEND 287
           E++ E ++S G+P +K R +++ R   + +MM    +A +I+TNPTHYA+ALRY + E  
Sbjct: 225 EVRKEHRESEGDPQLKGRIRAMQRQAAQRRMMADVPKADVIVTNPTHYAVALRYSEQEGG 284

Query: 288 APVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIY 347
           AP ++AKG +L+A K+R++  EH IP+ E P LAR+L++   I   IP   Y AVA+++ 
Sbjct: 285 APRVLAKGADLVAAKIRELGAEHRIPVLEAPPLARALYRHTEIGHQIPAALYAAVAEVLA 344

Query: 348 KIYH 351
            +Y 
Sbjct: 345 YVYQ 348


>gi|291283062|ref|YP_003499880.1| Flagellar biosynthetic protein FlhB [Escherichia coli O55:H7 str.
           CB9615]
 gi|209767298|gb|ACI81961.1| flagellar biosynthesis protein FlhB [Escherichia coli]
 gi|209767304|gb|ACI81964.1| flagellar biosynthesis protein FlhB [Escherichia coli]
 gi|290762935|gb|ADD56896.1| Flagellar biosynthetic protein FlhB [Escherichia coli O55:H7 str.
           CB9615]
 gi|320641734|gb|EFX11122.1| flagellar biosynthesis protein FlhB [Escherichia coli O157:H7 str.
           G5101]
 gi|320647094|gb|EFX15927.1| flagellar biosynthesis protein FlhB [Escherichia coli O157:H- str.
           493-89]
 gi|320652377|gb|EFX20675.1| flagellar biosynthesis protein FlhB [Escherichia coli O157:H- str.
           H 2687]
 gi|320657978|gb|EFX25740.1| flagellar biosynthesis protein FlhB [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320658551|gb|EFX26245.1| flagellar biosynthesis protein FlhB [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320668449|gb|EFX35276.1| flagellar biosynthesis protein FlhB [Escherichia coli O157:H7 str.
           LSU-61]
          Length = 382

 Score =  162 bits (411), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 105/353 (29%), Positives = 196/353 (55%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G+ S+   L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVSVIWFGGV-SLARRLS 57

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++        ++D + I+  +  L   A   ++P +   ++  + S ++    V + 
Sbjct: 58  GMLSAGLHFDHSIIKDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSG 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +
Sbjct: 118 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPHMMRLMAES 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P
Sbjct: 178 PITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A
Sbjct: 238 HVKGRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 298 LRIREIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|167587841|ref|ZP_02380229.1| flagellar biosynthesis protein FlhB [Burkholderia ubonensis Bu]
          Length = 403

 Score =  162 bits (411), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 106/361 (29%), Positives = 180/361 (49%), Gaps = 33/361 (9%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGI------------- 55
           +KTEA + ++ E A  EG    SRE + F+ +LA   Y  +  +  I             
Sbjct: 8   DKTEAATPRRREKAREEGQVARSRELASFA-LLASGFYGTWLLAGPIGRHLQTMLRGAFT 66

Query: 56  --YSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQ 113
               +  D + +L SA    LE ++ +  LL  + ++A         L     +G +LI 
Sbjct: 67  FDRGIAFDTNRMLTSAGSVSLEGLAALAPLLAMMGVAA---------LLAPMALGGWLIS 117

Query: 114 -RIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFT 172
            +   L L+ + P         G+ RI+S+   +    S  K ++VG I  I++  +   
Sbjct: 118 SKTFELKLDRLNPIT-------GLGRIFSVQGPIQLGMSLAKTLVVGGIGGIAIWRSKDE 170

Query: 173 MLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDE 232
           +L       H+ L  A   V       +  +  +  LD+ +   Q+  KL+M+K+E+K E
Sbjct: 171 LLGLAMQPLHAALADALHLVAVCCGTTVAGMLVVAALDVPYQLWQYNKKLRMTKEEVKRE 230

Query: 233 IKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLV 292
            +++ G+P +K R +   R+  R +MM A  +A +++TNPTH+A+AL+Y      AP +V
Sbjct: 231 HRENEGDPHVKGRIRQQQRAIARRRMMAAVPKADVVVTNPTHFAVALQYTDGAMRAPKVV 290

Query: 293 AKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
           AKG NL+A ++R++A EHN+P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  
Sbjct: 291 AKGVNLVAARIRELAAEHNVPLLEAPPLARALYHNVELEREIPGSLYSAVAEVLAWVYQL 350

Query: 353 K 353
           K
Sbjct: 351 K 351


>gi|77918767|ref|YP_356582.1| flagellar biosynthesis protein FlhB [Pelobacter carbinolicus DSM
           2380]
 gi|77544850|gb|ABA88412.1| flagellar biosynthetic protein FlhB [Pelobacter carbinolicus DSM
           2380]
          Length = 351

 Score =  162 bits (411), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 106/353 (30%), Positives = 188/353 (53%), Gaps = 10/353 (2%)

Query: 5   DAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSD-LH 63
           D+   +TE  + K+  D   +G    S+E    ++++   + L  F++P  +   SD LH
Sbjct: 3   DSDQERTEQATGKRRADFRQKGQVAQSKEVHT-AALMTGTLLLWTFYAPLFWRTLSDMLH 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
            L + A   ++  +S  V LL  L    + L+ P +L  ++ GI S  +Q   +     +
Sbjct: 62  HLWSLAGDFEVTPVSA-VMLLGQLGQKIALLLAPIMLTTLVIGILSSYLQVGWLFTTKPL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN-PH 182
            P F +++   G+ ++ S  + +  +KS +K+ LVG +    +   +   LD +  +   
Sbjct: 121 APDFSKMNPVPGLAKLISKRSFIEVVKSLLKVFLVGVVAYKVILAEFGQALDLVDMDIND 180

Query: 183 SILYHAFFTVRKVL--IMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           S++Y A    R +L    +++ +A L  L + W   Q   K+KM+KQE K+E K+S G+P
Sbjct: 181 SVVYLARVAARILLRTCGVMILLALLDFLFVRWEMEQ---KMKMTKQEQKEEHKESEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R +S+     R +MM    +A ++ITNPTH ++AL Y ++   AP +VAKG + +A
Sbjct: 238 QIKARIRSMQMQAARRRMMAEVPKADVVITNPTHLSVALAYDRSRMSAPQIVAKGADAVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+IA EH +P+ E   +AR LFK V +   +P   ++AVA+++  +Y  K
Sbjct: 298 MRIREIAREHKVPLVENKPVARVLFK-VDLGKDVPEEMFQAVAEILAYVYGLK 349


>gi|296274004|ref|YP_003656635.1| flagellar biosynthetic protein FlhB [Arcobacter nitrofigilis DSM
           7299]
 gi|296098178|gb|ADG94128.1| flagellar biosynthetic protein FlhB [Arcobacter nitrofigilis DSM
           7299]
          Length = 350

 Score =  162 bits (411), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 109/350 (31%), Positives = 196/350 (56%), Gaps = 18/350 (5%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
           +KTE P++KK+E A  EGN P S E    + +L   +Y+LF+ S   Y     L + + +
Sbjct: 6   DKTEEPTAKKLEKARGEGNVPKSGEVVGAAILLFGTVYMLFW-STYTYDSIKKLMIYIFN 64

Query: 69  ATQRKLE-----DISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
              ++L      ++++ +      SL+   LV+  +LL ++  +  +     P+      
Sbjct: 65  KIGQELTSTDYYNMTNAIITTIFYSLAPFFLVV--ILLAIILNVVQFGFLTNPI------ 116

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           K  F++++   G+K ++S+  L+   K   K+ L+  ++TI     Y   +  +  +  S
Sbjct: 117 KLKFEKLNPVSGLKGLFSLKKLLEATKLLAKLTLIVFVMTILFGLTYKGFIAMMDKDITS 176

Query: 184 ILYHAFFTVRKVLIMILLFIATL-TVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPII 242
            L  A FT+    +  +LFI  L  ++D  ++ H ++  LKMSK+E+KDE K   G+P +
Sbjct: 177 SL-DAMFTLLLYFVGAILFIVILFAIIDYFFTRHYYFKSLKMSKEEVKDEHKNMEGDPKV 235

Query: 243 KNRQKSIARSRIRHKMMEATSR-ATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAK 301
           K + K I + ++ ++ M A+++ A ++ITNPTHY++AL+Y    N AP +VAKG + +A 
Sbjct: 236 KAKIKGI-QYKLHYERMRASAKDADVVITNPTHYSVALQYDSAVNSAPKVVAKGIDFLAL 294

Query: 302 KMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           K+R +A E+ IPI E P+LAR+L+ Q+ I+  IP  FY+A+A++   ++ 
Sbjct: 295 KIRDVAKENKIPIIENPALARALYDQIQIDQEIPGEFYQAMAEVFSYVFE 344


>gi|237653600|ref|YP_002889914.1| flagellar biosynthesis protein FlhB [Thauera sp. MZ1T]
 gi|237624847|gb|ACR01537.1| flagellar biosynthetic protein FlhB [Thauera sp. MZ1T]
          Length = 380

 Score =  162 bits (411), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 107/362 (29%), Positives = 188/362 (51%), Gaps = 29/362 (8%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSIL---ACLIYLLFFFSPGIYSVTS 60
            D+   KTE PSS+++E A  EG  P SRE S F   +   A L+ L  + +  +  +  
Sbjct: 3   EDSDLEKTEDPSSRRLEQAREEGQVPQSRELSTFLVTMTGAATLLLLGGWMAGRVMGLFR 62

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLF-----------MMFGIGS 109
           D       A  R+     +++  +    L  + L +  + LF           M+ G   
Sbjct: 63  D-----GFAFDRRAAFDENVMLDMLERMLGGALLTL--MPLFVALMVAAVAAPMVLG--- 112

Query: 110 YLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTEN 169
            L+    VL L      F R+   +G+ R++S++ LV   K+ +K +LVG +  + L   
Sbjct: 113 GLVFAPKVLGLK-----FDRLDPLQGLGRMFSLHGLVEMFKAILKSVLVGGVAALVLWYE 167

Query: 170 YFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEI 229
           +  +   +     + +     T+    ++I+L +  L  +D+ +   Q++ KL+M+K+E+
Sbjct: 168 FEHLFSLMVEPLETGMADFSATIVFATLLIVLSLGLLAAIDVPFQLWQYHKKLRMTKEEV 227

Query: 230 KDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAP 289
           K E K+  G+P+IK R +++ R   R +MM    +A +++TNPTH+++AL+Y   +  AP
Sbjct: 228 KRESKEQEGDPMIKGRIRAMQREMARRRMMAEVPKADVVVTNPTHFSVALKYDAAKMGAP 287

Query: 290 VLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKI 349
           V+VAKG+  +A K+R+IA E  +P+ E P LAR+L+K   +  AIP   Y AVA+++  +
Sbjct: 288 VVVAKGRGELALKIREIAKESEVPLLEAPPLARALYKHCELEQAIPAALYTAVAEVMAYV 347

Query: 350 YH 351
           Y 
Sbjct: 348 YQ 349


>gi|310767884|gb|ADP12834.1| Flagellar biosynthesis protein FlhB [Erwinia sp. Ejp617]
          Length = 383

 Score =  162 bits (411), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 98/351 (27%), Positives = 190/351 (54%), Gaps = 7/351 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+ + KTE+P++ ++E A  EG  P SRE    +S+L  +  L   +  G + +   + 
Sbjct: 3   QDSDEEKTESPTAHRLEKAREEGQIPRSRE---LTSLLMLMTGLSILWVGGEW-MGRKMG 58

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            LLA         + D S ++ L+ ++ L A   V+P +   ++  I + ++    VL+ 
Sbjct: 59  ALLADGLVFNHSVVSDTSQMLRLIANMLLQAVMAVLPMMFGLVVVAIAAPMLLGGLVLSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K    +++  +G+ +++S  +    +K+ +K  LVG +  + +  ++  ML  ++ +
Sbjct: 119 KAIKFDPGKMNPIKGLGKLFSAQSAAELLKAVLKATLVGVVCGLYIWHHWAGMLHLMAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + L  A   +    I+++L ++ +   D+ +    ++  L+MS Q+I+DE KQ  G+P
Sbjct: 179 PLTALAGAMNMIAMCCILVVLGLSPIVGFDVFYQLFSYFKNLRMSHQDIRDEHKQQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A +I+TNPTHY++AL+Y + +  AP +VAKG   IA
Sbjct: 239 HVKGRIRQQMRAAARRRMMADVPKADVIVTNPTHYSVALQYDEKKMSAPKVVAKGAGDIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            ++R++   + IP+ E P LAR+L++   I   IP   Y AVA+++  ++ 
Sbjct: 299 LRIRELGAANRIPVLEAPPLARALYRHSEIGQHIPGALYAAVAEVLAWVWQ 349


>gi|301018276|ref|ZP_07182787.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 69-1]
 gi|331663378|ref|ZP_08364288.1| flagellar biosynthetic protein FlhB [Escherichia coli TA143]
 gi|300399746|gb|EFJ83284.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 69-1]
 gi|331059177|gb|EGI31154.1| flagellar biosynthetic protein FlhB [Escherichia coli TA143]
          Length = 382

 Score =  162 bits (411), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 110/366 (30%), Positives = 198/366 (54%), Gaps = 33/366 (9%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISRE-ASLFSSILACLIYLLFF------------ 50
           +D  D+KTEAP+  ++E A  EG  P SRE  SL   IL   + +++F            
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLL--ILVVGVSVIWFGGVSLARRLSGM 59

Query: 51  FSPGIY---SVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGI 107
            S G++   S+ +D +++L        E +  ++ L++ + L A  L+ P +L  ++F  
Sbjct: 60  LSAGLHFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVA--LISPVMLGGLVFSG 117

Query: 108 GSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLT 167
            S             ++P F +++   GIKR++S       +K+ +K ILVG++    L 
Sbjct: 118 KS-------------LQPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLW 164

Query: 168 ENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQ 227
            ++  M+  ++ +P + + +A   V    ++++L +  +   D+ +       KL+MS+Q
Sbjct: 165 HHWPQMMRLMAESPITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQ 224

Query: 228 EIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEND 287
           +I+DE KQS G+P +K R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  
Sbjct: 225 DIRDEFKQSEGDPHVKGRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMS 284

Query: 288 APVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIY 347
           AP +VAKG  L+A ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++ 
Sbjct: 285 APKVVAKGAGLVALRIREIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLA 344

Query: 348 KIYHKK 353
            ++  K
Sbjct: 345 WVWQLK 350


>gi|116694207|ref|YP_728418.1| flagellar biosynthesis protein FlhB [Ralstonia eutropha H16]
 gi|113528706|emb|CAJ95053.1| flagellar biosynthesis protein [Ralstonia eutropha H16]
          Length = 380

 Score =  162 bits (411), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 105/358 (29%), Positives = 180/358 (50%), Gaps = 27/358 (7%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE  S +++E A  EG    SRE + F  ++A +         G++++   L   L  
Sbjct: 8   EKTEPASPRRLEKAREEGQVVRSRELATFVMLIAGVT--------GLWTLGGHLGRSLNQ 59

Query: 69  ATQRKLEDISHIVF----LLTHLSLSASRLVIPGLLLFMMFGI---------GSYLIQRI 115
             Q  L       F    +L+  ++     ++  L L  +FG+         G +     
Sbjct: 60  VMQGALRFEPATAFDTSRMLSRFAMMVWDSLLAFLPLLFLFGVAALAAPLLLGGW----- 114

Query: 116 PVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLD 175
            V +     P F R+S   G+ R++S ++LV  +K+  K +LVG++    L       + 
Sbjct: 115 -VFSGKSFAPQFSRLSPLAGLGRMFSAHSLVELLKAVAKSLLVGSVGAWVLWRRLPEAIA 173

Query: 176 FISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQ 235
            ++A     L H    V    +++ L +  +  +D+ W Y +++ KL+M+K+E+K E K+
Sbjct: 174 LMNAPVQEALLHMVDLVMYCCLVVSLSLLVVAAIDVPWQYWEFFKKLRMTKEEVKQEFKE 233

Query: 236 SYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKG 295
           S G+P IK R +   R+  R +MM    +A +++TNPTH+A+ALRY +    AP +VAKG
Sbjct: 234 SEGDPHIKGRIRQQQRAMARRRMMTEVPKADVVVTNPTHFAVALRYEEGRMGAPRVVAKG 293

Query: 296 QNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
              IA ++R++A EH +P+   P LAR+L + V +   IP   Y AVA+++  +Y  K
Sbjct: 294 TGDIAARIRELAAEHRVPLMSAPPLARALHRHVELGQEIPAGLYTAVAEVLAWVYQLK 351


>gi|332994108|gb|AEF04163.1| flagellar biosynthesis protein [Alteromonas sp. SN2]
          Length = 376

 Score =  162 bits (411), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 105/364 (28%), Positives = 200/364 (54%), Gaps = 24/364 (6%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPG-----I 55
           M+++D+ + KTE P+ KK+ED   +G    SRE S  ++++  +   +F F  G     +
Sbjct: 1   MADSDSSE-KTEDPTGKKLEDTRKKGQIARSRELS--TTLVLVVSAFMFLFVGGWIAESV 57

Query: 56  YSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGI--GSYLIQ 113
           + +T  + VL    ++ +  D +H   +      + S + +P +LL+M   +  G Y   
Sbjct: 58  FKLTQRMFVL----SRDETYDTTH---MFGAWGEAISTVSVP-VLLYMTVAMLAGIYGSI 109

Query: 114 RIPVLNLNHVKPSFK--RVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLT--EN 169
            +   N       FK  ++S   G KR++ +N LV  +KS  K++++  +   +L   E+
Sbjct: 110 ALGGYNFTWEGAKFKGSKMSPLSGFKRMFGMNGLVELIKSIAKVVVIVGMALGALLFFED 169

Query: 170 YFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEI 229
               LD +   P +I +HA   ++   IM++  +  + ++D+ +  ++   ++KM+KQE+
Sbjct: 170 EALHLD-LELYPGNI-FHALDMLKWAFIMLVCGMIPIALIDVPYQIYKHNKEIKMTKQEV 227

Query: 230 KDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAP 289
           KDE K S G+P++K R + +       +MM+   +A +++TNPTHY++A++Y  + N AP
Sbjct: 228 KDERKNSEGDPLVKGRIRRLQYQAATKRMMQEVPQADVVVTNPTHYSVAIKYDDSGNRAP 287

Query: 290 VLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKI 349
           V+VAKG + +A  +RKIA  +++P+   P LAR+++    I+  +P   + AVAQ++  +
Sbjct: 288 VVVAKGTDELAMHIRKIATANDVPLIPSPMLARAVYYSTEIDGEVPNALFMAVAQVLAHV 347

Query: 350 YHKK 353
           Y  K
Sbjct: 348 YQLK 351


>gi|194434131|ref|ZP_03066400.1| flagellar biosynthetic protein FlhB [Shigella dysenteriae 1012]
 gi|194417675|gb|EDX33775.1| flagellar biosynthetic protein FlhB [Shigella dysenteriae 1012]
 gi|332095083|gb|EGJ00117.1| flagellar biosynthetic protein FlhB [Shigella dysenteriae 155-74]
          Length = 382

 Score =  162 bits (411), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 105/353 (29%), Positives = 194/353 (54%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G+ S+   L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVCVIWFGGV-SLARRLS 57

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++        + D + I+  +  L   A   ++P +   +   + S ++    V + 
Sbjct: 58  GMLSAGLHFDHSIINDPNLILGQIILLIREAMLALLPLISGVVPVALISPVMLGGLVFSG 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +
Sbjct: 118 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTVFFLWHHWPQMMRLMAES 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P
Sbjct: 178 PITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A
Sbjct: 238 HVKGRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 298 LRIREIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|149928479|ref|ZP_01916714.1| Flagellar biosynthetic protein FlhB [Limnobacter sp. MED105]
 gi|149822813|gb|EDM82064.1| Flagellar biosynthetic protein FlhB [Limnobacter sp. MED105]
          Length = 376

 Score =  162 bits (411), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 107/352 (30%), Positives = 192/352 (54%), Gaps = 18/352 (5%)

Query: 8   DNKTEAPSS-KKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLL 66
           D + + P+S +KI  A  EGN P SRE      +LA  + LL+     + S +  L    
Sbjct: 6   DQEKDLPASEQKIRKAREEGNLPRSRELGGGVVLLAG-VGLLYTMGGELVSQSEKLMRQG 64

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNH---- 122
               + +  D  H+      +   +  ++IP   LF++  + + ++  I V   N     
Sbjct: 65  LVLDRAQAFDTKHMGLKWVSMLQESLFILIP---LFLVVVVAA-IVSNIAVGGFNWSTKP 120

Query: 123 VKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENY--FTMLDFISAN 180
           ++P   +++  +G+K I+S+N L   +K+ +K +++G +  + L ++   FT L   SA 
Sbjct: 121 LEPKLSKLNPVKGLKNIFSVNGLAELVKAILKTVVLGGVGYLLLMQDLGEFTQL---SAM 177

Query: 181 P--HSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYG 238
           P  H +   A  T++  LI+ + F+  +++ D+ +   ++Y  L+M+ +E+K E K+S G
Sbjct: 178 PLEHGMAETARITIKDALILAIAFLLIVSI-DVPYQLWRYYKGLRMNLEELKRESKESDG 236

Query: 239 NPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL 298
           +P +K + KS+ R   R +MM +   A +I+TNPTHY++AL+Y +    AP +VAKG   
Sbjct: 237 DPHLKGKIKSMQREAARRRMMASVPNADVIVTNPTHYSVALKYDKDGKGAPRVVAKGIGP 296

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           +A K+R++A E+ +P+ E P LAR+L+  V +   IP   Y AVA+L+  +Y
Sbjct: 297 LALKIREVAQENKVPLVEAPPLARALYSNVELEQEIPGALYTAVAKLLAYVY 348


>gi|313896030|ref|ZP_07829584.1| flagellar biosynthetic protein FlhB [Selenomonas sp. oral taxon 137
           str. F0430]
 gi|312975455|gb|EFR40916.1| flagellar biosynthetic protein FlhB [Selenomonas sp. oral taxon 137
           str. F0430]
          Length = 374

 Score =  162 bits (410), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 111/356 (31%), Positives = 183/356 (51%), Gaps = 19/356 (5%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A   KTE P++KK  DA  +G    S+E +         + L+ FFS  +  +   +++ 
Sbjct: 24  AGGEKTEEPTAKKRADARKKGQVGRSQELN------TAFVLLIGFFS--LKLLWDSIYLA 75

Query: 66  LASATQRKLE------DISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLN 119
           +AS T           D  +IV L   +    ++  +P +L  M+ G+     Q    LN
Sbjct: 76  IASYTTYVFANLNQPVDTENIVRLFIGIMEILAKTALPIMLFIMLIGLAVNFFQ--VGLN 133

Query: 120 LNHVKPSFKRVSLR--EGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFI 177
            N     FK   L    G  RI+S  +LV   KSF KI+++G  +   + E    M  F+
Sbjct: 134 FNTEAIEFKLDKLNPINGFGRIFSKRSLVELAKSFFKILVIGFFLYRFIHEQIIAMPQFM 193

Query: 178 SANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSY 237
             +  + L      + ++  +++  I  + V D G+   Q    LKM+KQE+KDE+KQ+ 
Sbjct: 194 FFDLTTSLALVAEIIFRMAFIVIGVIMIMAVADYGYQNWQTTQDLKMTKQEVKDEMKQTE 253

Query: 238 GNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQN 297
           G+P IK + +   R     +MM+   +A +IITNPTHYA+AL Y +    AP ++AKGQ+
Sbjct: 254 GDPQIKGKIRQKQRQMAMARMMKEVPKADVIITNPTHYAVALAY-EKGMVAPTVLAKGQD 312

Query: 298 LIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           L+A++++++  E  +PI E   LAR+L+  V +  A+P   Y+AVA+++  +Y  K
Sbjct: 313 LVAQRIKELGREARVPIVENKPLARTLYAAVQVGDAVPQELYQAVAEVLAYVYRLK 368


>gi|327399034|ref|YP_004339903.1| flagellar biosynthetic protein FlhB [Hippea maritima DSM 10411]
 gi|327181663|gb|AEA33844.1| flagellar biosynthetic protein FlhB [Hippea maritima DSM 10411]
          Length = 353

 Score =  162 bits (410), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 107/354 (30%), Positives = 196/354 (55%), Gaps = 14/354 (3%)

Query: 7   PD-NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHV- 64
           PD +KTE  + K+ ++A  EG    S E +    +LA +++  +F +        D+ + 
Sbjct: 2   PDEDKTEQATPKRRQEAREEGRVAKSVELNTAFLMLAAVVFF-YFTASNFGEKIKDVLIY 60

Query: 65  --LLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPV---LN 119
              LAS  +  L+    +V  ++    S   +++P    F++    ++LI  + V   + 
Sbjct: 61  FFTLASNFEITLDSFDILVKRISGFMFS---ILLP---FFIVMATIAFLINVVQVGFYIT 114

Query: 120 LNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISA 179
              ++  F +++   G K ++S+ +    +KS +K  ++G I+ I + +N  +       
Sbjct: 115 PKAMEIKFDKINPVNGFKNMFSLRSFGELVKSLLKASVMGYILWIFIQKNINSWSSLSKT 174

Query: 180 NPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
           N  ++      ++  V++ IL+FI  + +LD  +  + +   + M+KQE+KDE KQ  G+
Sbjct: 175 NQTAVFLVMIKSMFLVVVYILIFIIFMAILDYLFQKYTFEKSIMMTKQEVKDEYKQMEGD 234

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLI 299
           P IK + +S+     R +MME   +A ++ITNPTHYA+AL+Y      AP +VAKG NLI
Sbjct: 235 PKIKQKIRSMQMEMTRKRMMEEVKKADVVITNPTHYAVALKYDSATMAAPKVVAKGINLI 294

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           AKK+++IA E+++PI E+P LARSL+++V ++  IP   Y+AVA+++  ++  K
Sbjct: 295 AKKIKEIAKENDVPIVEKPELARSLYEKVKLDREIPEELYQAVAEILAYVFKLK 348


>gi|149194192|ref|ZP_01871290.1| flagellar biosynthetic protein FlhB [Caminibacter mediatlanticus
           TB-2]
 gi|149136145|gb|EDM24623.1| flagellar biosynthetic protein FlhB [Caminibacter mediatlanticus
           TB-2]
          Length = 351

 Score =  162 bits (410), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 107/353 (30%), Positives = 188/353 (53%), Gaps = 18/353 (5%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE P+ KK+E+A  EGN   S E S F  +L   I +LF+     + +        + 
Sbjct: 6   EKTEEPTPKKLEEAKKEGNIAKSMEVSGFVVLLVGSIIILFYLKYVTFYLEEYFRYFYSY 65

Query: 69  ATQRKLEDISHIVF-LLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
                +E   +I F L+   +     L+ P  +  ++ GI   ++Q   +  +  + P  
Sbjct: 66  IG---VELTKNIFFNLIIKSTYYFFILIAPIFIALILAGIIGNVMQFGFLFTIKPILPKL 122

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
           ++++  +G+KR++S+  LV  +K+ +K   +  ++  +L  N      F+   P   L +
Sbjct: 123 EKINPIKGLKRLFSVKTLVEGLKTTLKT-FIAFLVGFTLFYN------FLQEIPRLELMN 175

Query: 188 AFFTVR----KVLIMILLFIATL---TVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            F  ++    K +I+I   +       ++D  +  + +   L+MSKQEIKDE KQ+ GNP
Sbjct: 176 FFEQLKWFEDKAVILIFSLLGVFFIFAIIDFTYQKYTYKKSLRMSKQEIKDEYKQTEGNP 235

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + + R   + +MM    +A ++ITNPTHYA+A+RY +T+++AP +VAKG + +A
Sbjct: 236 EVKAKIRQLQREMAKKRMMAEVPKADVVITNPTHYAVAIRYDKTKDEAPRVVAKGVDNLA 295

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+++IA E  + I E P LAR L+K V +   IP   +KAVA+++  +Y  K
Sbjct: 296 IKIKEIAREAGVMIVENPPLARELYKSVEVGEIIPQKLFKAVAEVLAYVYRAK 348


>gi|302670739|ref|YP_003830699.1| flagellar biosynthetic protein FlhB [Butyrivibrio proteoclasticus
           B316]
 gi|302395212|gb|ADL34117.1| flagellar biosynthetic protein FlhB [Butyrivibrio proteoclasticus
           B316]
          Length = 383

 Score =  162 bits (410), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 102/368 (27%), Positives = 187/368 (50%), Gaps = 27/368 (7%)

Query: 2   SENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLF---FFSPGIYSV 58
           +E+     K+E P+SKK++DA  EG    S+E +   S+LA  + L F   F      ++
Sbjct: 24  AEDANGAEKSEEPTSKKLDDARKEGQVAKSQEVATAFSLLAFFLILRFGYGFMGENFEAI 83

Query: 59  TSDLH--VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIP 116
              ++  +   +        +++I   +    L+   +  P  +   +      L+Q   
Sbjct: 84  FGSVYNTIPFVARMYDGFLPVNYIYSTINKALLTVLLICAPFFIFGFLIAFLCDLVQVGF 143

Query: 117 VLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDF 176
                 ++P   +++   G+K+I+S   + + +KS +K++++G +I           + +
Sbjct: 144 KPTSKPLQPKLSKLNPISGMKKIFSTRKIFDLLKSILKLVIMGVVI-----------ISY 192

Query: 177 ISANPHSILYHAFFTVRKVLIMILLFIATLTV-----------LDIGWSYHQWYSKLKMS 225
            S    SI       +++ + ++  FI  L +            D+ +   +++  + M+
Sbjct: 193 FSNRQESIFLLYDIPLKQAIGLMGSFIIDLGIRIAAAYMIIAFADLIYQRRKFHKDMMMT 252

Query: 226 KQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTE 285
           KQE+KDE K + GNP +K+ QK       R +MM+   +A ++ITNPTHYA+A+RY   E
Sbjct: 253 KQEVKDEFKNTEGNPEVKSAQKRRMMQASRRRMMQELPKADVVITNPTHYAVAIRYDAEE 312

Query: 286 NDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQL 345
            DAP++VAKG + IA+K++++A E+N+ I E   LAR L+  V I   +PP  YKAVA++
Sbjct: 313 ADAPIVVAKGADYIAQKIKEVAKENNVEIVENKPLARMLYANVEIGEMVPPELYKAVAEV 372

Query: 346 IYKIYHKK 353
           +  +YH K
Sbjct: 373 LAYVYHLK 380


>gi|281178949|dbj|BAI55279.1| flagellar protein FlhB [Escherichia coli SE15]
          Length = 382

 Score =  162 bits (410), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 106/353 (30%), Positives = 194/353 (54%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G+ S+   L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVSVIWFGGV-SLARRLS 57

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++        + D + I+  +  L   A   ++P +   ++  I S ++    V + 
Sbjct: 58  GMLSAGLHFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVAIISPVMLGGLVFSG 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR +S       +K+ +K ILVG++    L  ++  M+  ++ +
Sbjct: 118 KSLQPKFSKLNPLPGIKRTFSAQTGAELLKAILKTILVGSVTGFFLWYHWPQMMRLMAES 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P
Sbjct: 178 PITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A
Sbjct: 238 HVKGRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 298 LRIREIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|296157469|ref|ZP_06840304.1| flagellar biosynthetic protein FlhB [Burkholderia sp. Ch1-1]
 gi|295892241|gb|EFG72024.1| flagellar biosynthetic protein FlhB [Burkholderia sp. Ch1-1]
          Length = 406

 Score =  162 bits (410), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 105/366 (28%), Positives = 186/366 (50%), Gaps = 32/366 (8%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   KTE+ + ++++ A  EG    SRE S F+     L+   FF   G++ ++ 
Sbjct: 1   MAE-DSDLEKTESATPRRLQKAREEGQIVRSRELSTFA-----LLAAGFF---GVWGMSG 51

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPG-----------LLLFMMFGIGS 109
            +           L+ +    F   H     +R ++ G           LL  + F   +
Sbjct: 52  SIG--------EHLQGMLRAAFTFDHAGAFETRRMLIGAGVASREGLYALLPILAFTGAA 103

Query: 110 YLIQRIPV----LNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITIS 165
            L   + +    L+   ++P F R++   G+ +++SIN  +    S VK ++VG I   +
Sbjct: 104 ALFAPMALGGWQLSSKGLEPKFDRLNPIAGLGKMFSINGPIQLGLSLVKTLVVGVIGGTA 163

Query: 166 LTENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMS 225
           +      +L   +      L +    +     M +  +  +  LD+ +   Q++ KL+MS
Sbjct: 164 IWNRREEILALATQPLQLALANTVHLIAVCCGMTVAGMFVVAALDVPYQLWQFHKKLRMS 223

Query: 226 KQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTE 285
           K+E+K E ++S G+P +K R +   R+  R +MM    +A +++TNPTH+A+AL+Y   E
Sbjct: 224 KEEVKREHRESEGDPHVKGRIRQQQRAIARRRMMTNVPKADVVVTNPTHFAVALQYTDGE 283

Query: 286 NDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQL 345
             AP +VAKG NL+A ++R+IA E+N+P+ E P LAR+L+  V +N  IP   Y AVA++
Sbjct: 284 MRAPKVVAKGVNLVAARIREIAAENNVPLLEAPPLARALYHNVELNREIPGPLYGAVAEV 343

Query: 346 IYKIYH 351
           +  +Y 
Sbjct: 344 LAWVYQ 349


>gi|320529415|ref|ZP_08030503.1| flagellar biosynthetic protein FlhB [Selenomonas artemidis F0399]
 gi|320138381|gb|EFW30275.1| flagellar biosynthetic protein FlhB [Selenomonas artemidis F0399]
          Length = 374

 Score =  162 bits (410), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 111/356 (31%), Positives = 183/356 (51%), Gaps = 19/356 (5%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A   KTE P++KK  DA  +G    S+E +         + L+ FFS  +  +   +++ 
Sbjct: 24  AGGEKTEEPTAKKRADARKKGQVGRSQELN------TAFVLLIGFFS--LKLLWDSIYLA 75

Query: 66  LASATQRKLE------DISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLN 119
           +AS T           D  +IV L   +    ++  +P +L  M+ G+     Q    LN
Sbjct: 76  IASYTTYVFANLNQPVDTENIVRLFIGIMEILAKTALPIMLFIMLIGLAVNFFQ--VGLN 133

Query: 120 LNHVKPSFKRVSLR--EGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFI 177
            N     FK   L    G  RI+S  +LV   KSF KI+++G  +   + E    M  F+
Sbjct: 134 FNTEAIEFKLDKLNPINGFGRIFSKRSLVELAKSFFKILVIGFFLYRFIHEQIIAMPQFM 193

Query: 178 SANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSY 237
             +  + L      + ++  +++  I  + V D G+   Q    LKM+KQE+KDE+KQ+ 
Sbjct: 194 FFDLTTSLALVAEIIFQMAFIVIGVIMIMAVADYGYQNWQTTQDLKMTKQEVKDEMKQTE 253

Query: 238 GNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQN 297
           G+P IK + +   R     +MM+   +A +IITNPTHYA+AL Y +    AP ++AKGQ+
Sbjct: 254 GDPQIKGKIRQKQRQMAMARMMKEVPKADVIITNPTHYAVALAY-EKGMVAPTVLAKGQD 312

Query: 298 LIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           L+A++++++  E  +PI E   LAR+L+  V +  A+P   Y+AVA+++  +Y  K
Sbjct: 313 LVAQRIKELGREARVPIVENKPLARTLYAAVQVGDAVPQELYQAVAEVLAYVYRLK 368


>gi|23099029|ref|NP_692495.1| flagellar biosynthesis protein FlhB [Oceanobacillus iheyensis
           HTE831]
 gi|22777257|dbj|BAC13530.1| flagella-associated protein [Oceanobacillus iheyensis HTE831]
          Length = 359

 Score =  162 bits (410), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 106/349 (30%), Positives = 184/349 (52%), Gaps = 13/349 (3%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE  + KK  D   +G    S++ +    +L C I L  F S  +  +T         
Sbjct: 13  EKTEKATPKKRLDERKKGRVAKSQDVNTALLLLGCFIALFVFGSYMLQYMTGFFEKSFTE 72

Query: 69  ATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFK 128
                L +  ++  +    SL A  ++ P +++ ++ G+ + L+Q   + +   +K   K
Sbjct: 73  YIHWDLTE-KNVQLMFNSASLDAGMMLAPIMIIAIITGMAANLVQVRFLFSTEPLKFDLK 131

Query: 129 RVSLREGIKRIYSINNLVNFMKSFVKIILVG--TIITISLTENYFTMLDFISANPHSILY 186
           ++   +G KRI+SI  LV F+KS +KI+ VG  T   I + ++   M  F+ A       
Sbjct: 132 KIDPIQGAKRIFSIRALVEFLKSMLKIVFVGIVTFYVIWIFKDDMLMTAFLDAKGA---L 188

Query: 187 HAFFTVRKVL----IMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPII 242
             F TV  ++    I++L+F+A   + D  +    +   ++MSKQ+IKDE K   G+P+I
Sbjct: 189 GFFATVTAIMGFAAIILLVFLA---LFDYWYQKFDFEKNIRMSKQDIKDEYKNVEGDPLI 245

Query: 243 KNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKK 302
           K++ K   R     +MM     A +IITNPTHYA+A++Y +++ +AP ++AKG + IA+K
Sbjct: 246 KSKIKEKQRQMATRRMMSEVPNADVIITNPTHYAVAIKYDESKANAPYILAKGTDQIAQK 305

Query: 303 MRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           +++IA  H++ + E   LAR L   V I   IP  +++AVA+++  +Y 
Sbjct: 306 IKEIAKNHDVIMVENRPLARGLHDAVEIGEIIPEAYFQAVAEVLAYVYR 354


>gi|197334476|ref|YP_002156665.1| flagellar biosynthetic protein FlhB [Vibrio fischeri MJ11]
 gi|197315966|gb|ACH65413.1| flagellar biosynthetic protein FlhB [Vibrio fischeri MJ11]
          Length = 376

 Score =  162 bits (410), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 107/361 (29%), Positives = 197/361 (54%), Gaps = 18/361 (4%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISRE-ASLFSSILACLIYLLFFFSPGIYSVT 59
           M+E+D  + +TE  +SK+++ A ++G    S+E AS+  S+L C    L +F   +    
Sbjct: 1   MAESDGQE-RTEDATSKRLQQAKDKGQVARSKELASV--SVLVCGAVALMWFGEDVARAL 57

Query: 60  SDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPG-LLLFMMFGIGSYLIQRIPVL 118
             +     S ++ ++ D + ++ ++    ++   LV P  L+L  +F         +  +
Sbjct: 58  FSVMERFFSISREEIYDTNKLLEIVGGALIA---LVFPVFLILITLFVAALAGAAGLGGI 114

Query: 119 NLNH--VKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTI---ITISLTENYFTM 173
           + +     P F +++   GIKR++ + + V  +KS +K+ LVG +   +     E+ F +
Sbjct: 115 SFSSEAAMPKFSKMNPMSGIKRMFGMQSWVELLKSILKVSLVGGMAFYLIEGSKEDLFQL 174

Query: 174 -LDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDE 232
            LD   AN    ++H+   +   +++I   +  +  +DI +   Q  ++LKM+KQE+KDE
Sbjct: 175 SLDTYPAN----IFHSLDILLNFILLISCTLLIVVAIDIPFQIWQHANQLKMTKQEVKDE 230

Query: 233 IKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLV 292
            K++ G P +K R + + R   + +MM     A +++TNP HY++ALRY Q+++ AP++V
Sbjct: 231 YKETEGKPEVKGRIRMLQREMTQRRMMADVPSADVVVTNPEHYSVALRYDQSKDAAPIVV 290

Query: 293 AKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
           AKG + +A K+R+IA EHNI I   P LAR+L+    +   IP   + AVAQ++  I+  
Sbjct: 291 AKGVDHVAMKIREIAREHNIYILPAPPLARALYHSTELEQQIPDGLFAAVAQILAYIFQM 350

Query: 353 K 353
           K
Sbjct: 351 K 351


>gi|215487092|ref|YP_002329523.1| flagellar biosynthesis protein FlhB [Escherichia coli O127:H6 str.
           E2348/69]
 gi|312967082|ref|ZP_07781300.1| flagellar biosynthetic protein FlhB [Escherichia coli 2362-75]
 gi|215265164|emb|CAS09552.1| predicted flagellar export pore protein FlhB [Escherichia coli
           O127:H6 str. E2348/69]
 gi|312288546|gb|EFR16448.1| flagellar biosynthetic protein FlhB [Escherichia coli 2362-75]
          Length = 382

 Score =  162 bits (410), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 105/353 (29%), Positives = 194/353 (54%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G+ S+   L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVSVIWFGGV-SLARRLS 57

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++        + D + I+  +  L   A   ++P +   ++  I S ++    V + 
Sbjct: 58  GMLSAGLHFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVAIISPVMLGGLVFSG 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +
Sbjct: 118 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAES 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQ  G+P
Sbjct: 178 PITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQREGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A
Sbjct: 238 HVKGRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 298 LRIREIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|292488559|ref|YP_003531443.1| flagellar biosynthetic protein FlhB [Erwinia amylovora CFBP1430]
 gi|292899731|ref|YP_003539100.1| flagellar biosynthetic protein FlhB [Erwinia amylovora ATCC 49946]
 gi|291199579|emb|CBJ46696.1| flagellar biosynthetic protein FlhB [Erwinia amylovora ATCC 49946]
 gi|291553990|emb|CBA21035.1| Flagellar biosynthetic protein FlhB [Erwinia amylovora CFBP1430]
 gi|312172704|emb|CBX80960.1| Flagellar biosynthetic protein FlhB [Erwinia amylovora ATCC
           BAA-2158]
          Length = 383

 Score =  162 bits (409), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 101/351 (28%), Positives = 191/351 (54%), Gaps = 7/351 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+ + KTE+P++ ++E A  EG  P SRE    +SIL  +  L   +  G + +   + 
Sbjct: 3   QDSDEEKTESPTAHRLEKAREEGQIPRSRE---LTSILMLITGLSILWVGGEW-MGRKMG 58

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            LLA         + D S ++ L+ ++ L A   V+P +   ++  I + ++    VL+ 
Sbjct: 59  ALLADGLVFNHSVVSDSSQMLRLVANMLLQAVMAVLPMMFGLVVVAIAAPMLLGGLVLSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K    +++  +G+ +++S  +    +K+ +K  LVG +  + +  ++  ML  ++ +
Sbjct: 119 KAIKFDPGKMNPVKGLAKLFSAQSASELLKAVLKATLVGIVCGLYIWHHWAGMLHLMAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   L  A   +    I+++L ++ +   D+ +    ++  L+MS Q+I+DE KQ  G+P
Sbjct: 179 PLIALAGAMNMIAMCCILVVLGLSPMVGFDVFFQLFSYFKNLRMSHQDIRDEHKQQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A +I+TNPTHY++AL+Y + +  AP ++AKG   IA
Sbjct: 239 HVKGRIRQQMRAAARRRMMADVPKADVIVTNPTHYSVALQYDEKKMSAPKVLAKGAGDIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            ++R++A E+ IPI E P LAR+L++   I   IP   Y AVA+++  ++ 
Sbjct: 299 LRIRELAAENRIPILEAPPLARALYRHSEIGQHIPGTLYAAVAEVLAWVWQ 349


>gi|183598609|ref|ZP_02960102.1| hypothetical protein PROSTU_02008 [Providencia stuartii ATCC 25827]
 gi|188020787|gb|EDU58827.1| hypothetical protein PROSTU_02008 [Providencia stuartii ATCC 25827]
          Length = 383

 Score =  162 bits (409), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 110/354 (31%), Positives = 185/354 (52%), Gaps = 12/354 (3%)

Query: 4   NDAPD-NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPG-----IYS 57
           +D  D  KTE P+  K + A ++G    S+E S    +LA +   L + S G     +  
Sbjct: 2   SDESDVEKTEEPTPHKKQKAKDDGQIVRSKELSSLMMMLAGVS--LLWLSGGHLADELRQ 59

Query: 58  VTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPV 117
           +     +      Q  L  +S+   ++   +L A   VI GL L    GI +  +    +
Sbjct: 60  IFRQGFIFDGHYIQNTLLMVSYFGRMVGE-ALFALLPVIGGLALV---GISASSLVGGLL 115

Query: 118 LNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFI 177
            N   +K   K+++   G+KRI+S+N L    K+ +K + VG    I L +N+ ++L  +
Sbjct: 116 FNSKLIKFDLKKLNPISGLKRIFSMNALSELFKAILKSLFVGLGAAIFLWQNWSSLLHLV 175

Query: 178 SANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSY 237
           + +P + L +A   V     +I+  +  +   D+ + +     KL+MS+QEIKDE KQ  
Sbjct: 176 TESPVTALGNAMHKVIFAGYLIVFLLIPMVAFDVFYQFRSHLKKLRMSRQEIKDEFKQQE 235

Query: 238 GNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQN 297
           G+P IK + +   R+  R++MM    +A +I+TNPTHYA+AL+Y      AP ++AKG  
Sbjct: 236 GDPQIKAKIRQQQRAIARNRMMADVPQADVIVTNPTHYAVALKYDDKRMGAPKVLAKGAG 295

Query: 298 LIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           +IA+++++I  EH I   E P LAR+L++   I  +IP   Y AVA+++  +Y 
Sbjct: 296 VIAQRIKEIGQEHRILQLEAPPLARALYRHAEIGQSIPVALYAAVAEVLAWVYQ 349


>gi|222053619|ref|YP_002535981.1| flagellar biosynthetic protein FlhB [Geobacter sp. FRC-32]
 gi|221562908|gb|ACM18880.1| flagellar biosynthetic protein FlhB [Geobacter sp. FRC-32]
          Length = 354

 Score =  162 bits (409), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 110/357 (30%), Positives = 194/357 (54%), Gaps = 10/357 (2%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREA----SLFSSILACLIYLLFFFSPGIY 56
           MSE D   +KTE P++KK+ +A  +GN P SR+     SL S I+A  +   F  S    
Sbjct: 1   MSEED-KHSKTEQPTNKKVSEAKEKGNIPRSRDLTSTLSLTSGIIALYVTGGFMAS---- 55

Query: 57  SVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIP 116
            + S    + AS + ++  + + I  L+  L L+ + ++ P LL+ ++  + + + Q   
Sbjct: 56  KLKSSSAEIFASLSTKEFTE-AGIYMLMLKLFLTMTLVLAPFLLIVIVASLAAEVSQGGI 114

Query: 117 VLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDF 176
             +   +     +++   GIKR+++ + +V  +KSF+KII+VG +    + +   +++  
Sbjct: 115 STSFEKIGFDLDKLNPVHGIKRLFNKDAVVEMLKSFLKIIIVGYMAYKVMRDEVDSVIYL 174

Query: 177 ISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQS 236
           +  +  +I         K++I     +  L VLD+ +   ++   LKM+KQE+KDE K +
Sbjct: 175 VDMDIPAIAEFVSHISFKLVIHTCGVLFILAVLDLAFVKWRFIENLKMTKQEVKDENKDA 234

Query: 237 YGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQ 296
            G+P IK + K     + R +M      A +++TNPTH+A+AL+Y + +  APV++AKG 
Sbjct: 235 EGDPHIKGKIKQKQYDQARRRMRLIIPTADVVVTNPTHFAVALKYDRQKMAAPVVLAKGA 294

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           + +A+K+++IA E NI + E   LAR LF QV     IP   Y AVA+++  +Y  K
Sbjct: 295 DFLAQKIKEIARESNITLVENRPLARELFAQVKEGEEIPEALYAAVAEILAYVYKLK 351


>gi|114777581|ref|ZP_01452562.1| flagellar biosynthesis protein [Mariprofundus ferrooxydans PV-1]
 gi|114552052|gb|EAU54569.1| flagellar biosynthesis protein [Mariprofundus ferrooxydans PV-1]
          Length = 355

 Score =  162 bits (409), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 104/356 (29%), Positives = 185/356 (51%), Gaps = 6/356 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++      +TE  + K+ EDA  +G    S+E S  ++I   +I L+     G +    
Sbjct: 1   MADEQDKSQQTEEATPKREEDARKKGQIATSKEPS--TAIAFTVISLIVITGLGSWFGEQ 58

Query: 61  DLHVL---LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPV 117
             H+L   L+ A   K         L++ ++   + +V+P  +  M+ G+    +   PV
Sbjct: 59  MQHMLTNYLSGAVHIKATGEGMQKLLISAVT-DMAMVVLPIAVPIMLLGLLVTFMVSGPV 117

Query: 118 LNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFI 177
                + P F+++S  +GIKR++S   L  F+KS +K++L+       ++  +  +L   
Sbjct: 118 FTFETMIPKFEKISPLKGIKRLFSTKALAEFIKSVLKLVLISVACATIVSGMFSEILHTA 177

Query: 178 SANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSY 237
             +P  I     F   K+  ++ +    + + D+ +   +    L+MSK+E +DE K S 
Sbjct: 178 LKDPADIAALTLFGSVKITTLVAVIFVVIALADVLYQRWEHAKSLRMSKKEQRDEHKDSE 237

Query: 238 GNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQN 297
           G+P +K + + I   + +++MM     A +IITNPTH ++AL Y      AP ++AKG+ 
Sbjct: 238 GDPQLKAKIRQIQMQQAQNRMMSDVPDADVIITNPTHISIALAYDPLSPGAPRVLAKGKG 297

Query: 298 LIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            +A K+R+IA EH+IP+ E   LARSLFKQV +   IP V ++A+A ++ +I+  K
Sbjct: 298 HLAAKIREIAREHHIPMRENKPLARSLFKQVKVGDEIPEVLFEAIAIILAEIFRLK 353


>gi|300935856|ref|ZP_07150814.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 21-1]
 gi|300458968|gb|EFK22461.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 21-1]
          Length = 382

 Score =  162 bits (409), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 105/353 (29%), Positives = 195/353 (55%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G+ ++   L 
Sbjct: 2   SDEIDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVSVIWFGGV-ALARRLS 57

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++        + D + I+  +  L   A   ++P +   ++  I S ++    V + 
Sbjct: 58  GMLSAGLHFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVAIISPVMLGGLVFSG 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +
Sbjct: 118 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAES 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P
Sbjct: 178 PITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A
Sbjct: 238 HVKGRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 298 LRIREIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|15615002|ref|NP_243305.1| flagellar biosynthesis protein FlhB [Bacillus halodurans C-125]
 gi|10175059|dbj|BAB06158.1| flagella-associated protein [Bacillus halodurans C-125]
          Length = 363

 Score =  162 bits (409), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 106/355 (29%), Positives = 198/355 (55%), Gaps = 20/355 (5%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHV---- 64
            KTE  + KK +D+  +G    S + +    +L   ++L  F  P +      L +    
Sbjct: 15  EKTEKATPKKRQDSRKKGQVAKSTDVNTAIILLCVFLFLWLFGGPLLGGTLEKLLIHTFE 74

Query: 65  --LLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNH 122
             LL   T+   E ++ ++F    +++ A+ +++P + + ++ G+ +  IQ  P+     
Sbjct: 75  SYLLMDVTE---ESVAELMF---EITMEAAIVLLPIMAIALIAGVLASYIQVGPLFTTEP 128

Query: 123 VKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPH 182
           +K    ++   +G KRI+S+  LV F+KS +KI+L G +   S+   +F++ D +  +  
Sbjct: 129 LKMKLSKIDPIKGAKRIFSVRALVEFLKSLLKIVLTG-LAAFSIV--WFSLEDVMLLSQK 185

Query: 183 SILYHAFFTVRKVLIMILLFIATLTVLDIGWSY-HQWYS---KLKMSKQEIKDEIKQSYG 238
           S+  ++F TV ++  ++ + IA L ++     Y +Q Y    +++MSKQ++KDE K   G
Sbjct: 186 SV-ENSFVTVAQLTALLGILIAILLLILSIPDYLYQRYDHEKQIRMSKQDVKDEHKNVEG 244

Query: 239 NPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL 298
           +P +K+++K         +MM+   +A ++ITNPTHYA+AL+Y Q++ DAPV+VAKG + 
Sbjct: 245 DPKVKSKRKQKQMEMAMQRMMQEVPKADVVITNPTHYAIALKYDQSKMDAPVIVAKGVDY 304

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +A K++ +A +HN+   E   LAR+L+ Q  I   +P   +KAVA+++  +Y  K
Sbjct: 305 VAFKIKSLAKQHNVVTVENKPLARALYDQADIGDQVPEQLFKAVAEVLAYVYRLK 359


>gi|253998503|ref|YP_003050566.1| flagellar biosynthetic protein FlhB [Methylovorus sp. SIP3-4]
 gi|253985182|gb|ACT50039.1| flagellar biosynthetic protein FlhB [Methylovorus sp. SIP3-4]
          Length = 384

 Score =  162 bits (409), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 118/368 (32%), Positives = 182/368 (49%), Gaps = 32/368 (8%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISRE----ASLFSSILACLIYLLFFFSPGIY 56
           M+E D+   KTE  + K++E A  EGN P SRE    A L +  +   +    F     +
Sbjct: 1   MAE-DSDLEKTEPATPKRLEKAREEGNVPRSREFVTCAMLLAGGMGIAMMSSQFGDALKH 59

Query: 57  SVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIP----GLLLFMMFGIGSYLI 112
           ++   LH   A A    L        LL  +S S   L+I       LLF+M      LI
Sbjct: 60  TMGGSLHFERALAYDSNL--------LLMKISDSIYSLLITFAPLAGLLFIMAIAAPTLI 111

Query: 113 QRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFT 172
               V N   V P F R++   G+  + S N LV  +K+  K ILVG++  + +  +  T
Sbjct: 112 GGWNVSNQAFV-PKFNRLNPVSGLGNMVSKNALVELLKAVGKTILVGSVAYVVVAHDVDT 170

Query: 173 MLDFIS-------ANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMS 225
           +L           A    +L  +FF +   L++I         +D+ +    + + LKM+
Sbjct: 171 ILSLALLPLHTSIAEVEDMLLKSFFFIVGALVLI-------AAIDVPYQLTTYANNLKMT 223

Query: 226 KQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTE 285
           K+E+K E K+S GNP IK R +   R   R +MM    +A ++ITNPTHYA+A++Y +  
Sbjct: 224 KEEVKQESKESEGNPQIKARIRQQQREIARRRMMSEIPKADVVITNPTHYAVAIQYKELG 283

Query: 286 NDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQL 345
             APV++AKG + +A K+R++A EH I   E P LAR+L+    +   IP   Y AVA++
Sbjct: 284 MRAPVVIAKGADAVALKIREVAAEHKIMTLESPKLARALYAHTELGDEIPQALYSAVAEI 343

Query: 346 IYKIYHKK 353
           I  ++  +
Sbjct: 344 IAYVFQMR 351


>gi|91785647|ref|YP_560853.1| flagellar biosynthesis protein FlhB [Burkholderia xenovorans LB400]
 gi|91689601|gb|ABE32801.1| Flagellar biosynthetic protein FlhB [Burkholderia xenovorans LB400]
          Length = 406

 Score =  162 bits (409), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 102/358 (28%), Positives = 181/358 (50%), Gaps = 31/358 (8%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE+ + ++++ A  EG    SRE S F+     L+   FF   G++ ++  +      
Sbjct: 8   EKTESATPRRLQKAREEGQIVRSRELSTFA-----LLAAGFF---GVWGMSGSIG----- 54

Query: 69  ATQRKLEDISHIVFLLTHLSLSASRLVIPG-----------LLLFMMFGIGSYLIQRIPV 117
                L+ +    F   H     +R ++ G           LL  + F   + L   + +
Sbjct: 55  ---EHLQGMLRAAFTFDHAGAFETRRMLIGAGVASREGLYALLPILAFTGAAALFAPMAL 111

Query: 118 ----LNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTM 173
               L+   ++P F R++   G+ +++SIN  +    S VK ++VG I   ++      +
Sbjct: 112 GGWQLSSKGLEPKFDRLNPIAGLGKMFSINGPIQLGLSLVKTLVVGVIGGTAIWNRREEI 171

Query: 174 LDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEI 233
           L   +      L +    +     M +  +  +  LD+ +   Q++ KL+MSK+E+K E 
Sbjct: 172 LALATQPLQLALANTVHLIAVCCGMTVAGMFVVAALDVPYQLWQFHKKLRMSKEEVKREH 231

Query: 234 KQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVA 293
           ++S G+P +K R +   R+  R +MM    +A +++TNPTH+A+AL+Y   E  AP +VA
Sbjct: 232 RESEGDPHVKGRIRQQQRAIARRRMMTNVPKADVVVTNPTHFAVALQYTDGEMRAPKVVA 291

Query: 294 KGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           KG NL+A ++R+IA E+N+P+ E P LAR+L+  V +N  IP   Y AVA+++  +Y 
Sbjct: 292 KGVNLVAARIREIAAENNVPLLEAPPLARALYHNVELNREIPGPLYGAVAEVLAWVYQ 349


>gi|328911742|gb|AEB63338.1| component of the flagellar export machinery [Bacillus
           amyloliquefaciens LL3]
          Length = 360

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 115/352 (32%), Positives = 189/352 (53%), Gaps = 15/352 (4%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE  + KK +D   +G    S + +   + ++ LI  L   + G Y     L  +   
Sbjct: 14  EKTEKATPKKRKDTRKKGQVAKSTDVN---TAVSLLIIFLSLIALGPYMRDRLLSFIKTF 70

Query: 69  ATQRKLEDIS----HIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVK 124
            T+    ++S    H +F+ T   +S   ++ P +L+ ++ GI S  +Q   + +   +K
Sbjct: 71  YTKSIALELSESNVHELFVDTVKDISL--ILAPIMLVALLAGIVSNYMQVGFLFSAEVLK 128

Query: 125 PSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSI 184
           P   ++S  +G KRIYS+  +V  +KS +KI +VG    + L  +Y  +L      P  +
Sbjct: 129 PDLNKLSPLKGFKRIYSMRAIVELVKSILKITVVGFAAFMVLWLHYGDILRLPLLTPAEV 188

Query: 185 LYHAFFTVRKVLIMILLFIATLTVL---DIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPI 241
           L    F  +  L M L     L +L   D  +    +   ++MSKQ+IKDE K+S G+PI
Sbjct: 189 LT---FVSKLTLWMGLAGSGALMLLAGLDYLYQRFDYEKNIRMSKQDIKDEYKKSEGDPI 245

Query: 242 IKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAK 301
           IK++ K   R     +MM+   +A +IITNPTHYA+AL+Y + + DAP +VAKG + +A 
Sbjct: 246 IKSKIKQKQREMAMRRMMQEVPKADVIITNPTHYAIALKYDEKKMDAPYIVAKGVDHLAL 305

Query: 302 KMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           K+R+IA EH++   E   LAR+L+ QV I+ A+P  F+K +A+++  +Y  K
Sbjct: 306 KIRQIAKEHDVMTIENRPLARALYDQVDIDQAVPEEFFKVIAEILAYVYKTK 357


>gi|308173601|ref|YP_003920306.1| flagellar export protein [Bacillus amyloliquefaciens DSM 7]
 gi|307606465|emb|CBI42836.1| component of the flagellar export machinery [Bacillus
           amyloliquefaciens DSM 7]
 gi|328553467|gb|AEB23959.1| flagellar biosynthesis protein FlhB [Bacillus amyloliquefaciens
           TA208]
          Length = 359

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 115/352 (32%), Positives = 189/352 (53%), Gaps = 15/352 (4%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE  + KK +D   +G    S + +   + ++ LI  L   + G Y     L  +   
Sbjct: 13  EKTEKATPKKRKDTRKKGQVAKSTDVN---TAVSLLIIFLSLIALGPYMRDRLLSFIKTF 69

Query: 69  ATQRKLEDIS----HIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVK 124
            T+    ++S    H +F+ T   +S   ++ P +L+ ++ GI S  +Q   + +   +K
Sbjct: 70  YTKSIALELSESNVHELFVDTVKDISL--ILAPIMLVALLAGIVSNYMQVGFLFSAEVLK 127

Query: 125 PSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSI 184
           P   ++S  +G KRIYS+  +V  +KS +KI +VG    + L  +Y  +L      P  +
Sbjct: 128 PDLNKLSPLKGFKRIYSMRAIVELVKSILKITVVGFAAFMVLWLHYGDILRLPLLTPAEV 187

Query: 185 LYHAFFTVRKVLIMILLFIATLTVL---DIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPI 241
           L    F  +  L M L     L +L   D  +    +   ++MSKQ+IKDE K+S G+PI
Sbjct: 188 LT---FVSKLTLWMGLAGSGALMLLAGLDYLYQRFDYEKNIRMSKQDIKDEYKKSEGDPI 244

Query: 242 IKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAK 301
           IK++ K   R     +MM+   +A +IITNPTHYA+AL+Y + + DAP +VAKG + +A 
Sbjct: 245 IKSKIKQKQREMAMRRMMQEVPKADVIITNPTHYAIALKYDEKKMDAPYIVAKGVDHLAL 304

Query: 302 KMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           K+R+IA EH++   E   LAR+L+ QV I+ A+P  F+K +A+++  +Y  K
Sbjct: 305 KIRQIAKEHDVMTIENRPLARALYDQVDIDQAVPEEFFKVIAEILAYVYKTK 356


>gi|313200589|ref|YP_004039247.1| flagellar biosynthetic protein flhb [Methylovorus sp. MP688]
 gi|312439905|gb|ADQ84011.1| flagellar biosynthetic protein FlhB [Methylovorus sp. MP688]
          Length = 384

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 118/368 (32%), Positives = 182/368 (49%), Gaps = 32/368 (8%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISRE----ASLFSSILACLIYLLFFFSPGIY 56
           M+E D+   KTE  + K++E A  EGN P SRE    A L +  +   +    F     +
Sbjct: 1   MAE-DSDLEKTEPATPKRLEKAREEGNVPRSREFVTCAMLLAGGMGIAMMSSQFGDALKH 59

Query: 57  SVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIP----GLLLFMMFGIGSYLI 112
           ++   LH   A A    L        LL  +S S   L+I       LLF+M      LI
Sbjct: 60  TMGGSLHFERALAYDSNL--------LLMKISDSIYSLLITFAPLAGLLFIMAIAAPTLI 111

Query: 113 QRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFT 172
               V N   V P F R++   G+  + S N LV  +K+  K ILVG++  + +  +  T
Sbjct: 112 GGWNVSNQAFV-PKFNRLNPVSGLGNMVSKNALVELLKAVGKTILVGSVAYVVVAHDVDT 170

Query: 173 MLDFIS-------ANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMS 225
           +L           A    +L  +FF +   L++I         +D+ +    + + LKM+
Sbjct: 171 ILSLALLPLHTSIAEVEDMLLKSFFFIVGALVLI-------AAIDVPYQLTTYANNLKMT 223

Query: 226 KQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTE 285
           K+E+K E K+S GNP IK R +   R   R +MM    +A ++ITNPTHYA+A++Y +  
Sbjct: 224 KEEVKQESKESEGNPQIKARIRQQQREIARRRMMSEIPKADVVITNPTHYAVAIQYKELG 283

Query: 286 NDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQL 345
             APV++AKG + +A K+R++A EH I   E P LAR+L+    +   IP   Y AVA++
Sbjct: 284 MRAPVVIAKGADAVALKIREVAAEHKIMTLESPKLARALYAHTELGDEIPQALYSAVAEI 343

Query: 346 IYKIYHKK 353
           I  ++  +
Sbjct: 344 IAYVFQMR 351


>gi|288553046|ref|YP_003424981.1| flagellar biosynthesis protein FlhB [Bacillus pseudofirmus OF4]
 gi|288544206|gb|ADC48089.1| flagellar biosynthesis protein FlhB [Bacillus pseudofirmus OF4]
          Length = 363

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 105/358 (29%), Positives = 197/358 (55%), Gaps = 24/358 (6%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPG--IYSVTSDL--H 63
           D KTE  + KK +D+  +G   +++   + ++I+  L++L  +F  G  I S   DL  H
Sbjct: 13  DEKTEKATPKKRQDSRKKGQ--VAKSTDVNTAIILLLVFLFLWFFGGAIIGSTLMDLMKH 70

Query: 64  V----LLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLN 119
           V    LL   T R  E       +   + + A+ +++P +L+ M+ G+ +  IQ  P+  
Sbjct: 71  VFQTYLLMDVTPRSFE------AMFKEIVMEAAVVLLPIMLVAMVAGVAASYIQVGPLFT 124

Query: 120 LNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISA 179
            + +K    ++   +G KRI+S+  +V  +KS +KI   G ++ + L   +F + D +  
Sbjct: 125 TDPLKMKLSKIDPIKGFKRIFSVRAIVELLKSLLKIAFAGVVVFVIL---WFNLEDVLLL 181

Query: 180 NPHSILYHAFFTVRKVLIMILLFIATL----TVLDIGWSYHQWYSKLKMSKQEIKDEIKQ 235
           +  ++    F+ + ++  ++ + +A L    ++ D  +  +    ++KMSK++IKDE K 
Sbjct: 182 SQKAVA-DGFYVIAQLTALMGVAVAVLLLFLSIPDYLYQKYDHEKQIKMSKKDIKDEHKN 240

Query: 236 SYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKG 295
             G+P IK+++K         +MM+    A ++ITNPTHYA+AL+Y + + DAP++VAKG
Sbjct: 241 MEGDPRIKSKRKQKQMEMAMQRMMQEVPNADVVITNPTHYAIALKYDEEKADAPIIVAKG 300

Query: 296 QNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            + +A+K++ IA EH++ + E   LAR+L+    I   +P   +KAVA+++  +Y  K
Sbjct: 301 VDYVAQKIKGIASEHDVVLVENKPLARALYANADIGEQVPEDMFKAVAEVLAYVYRLK 358


>gi|302185378|ref|ZP_07262051.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           syringae 642]
          Length = 378

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 103/351 (29%), Positives = 184/351 (52%), Gaps = 1/351 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+   +KTE P+ KK++DA  +G    S+E +    +L     LL F S  I  + S
Sbjct: 1   MAENENGQDKTEDPTEKKVKDARADGQIARSKELTTLVVMLMGAGGLLMFGS-DIALMMS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           +L     + ++  L D S++   L    + A  +V+P L+  ++  +   ++    +   
Sbjct: 60  ELMRDNFTISRETLMDQSYMGKALLSSGMHALIVVLPFLIAMLVAALVGPIMLGGWLFAT 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++   G+KR++S + LV  +KSF K +++  +  + L      ++      
Sbjct: 120 KSLMPKFSRMNPAAGLKRMFSPHALVELLKSFGKFLIILAVALVVLNNERKDLVAIAHEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V      +   +  +   D+ +  ++ + KL M+KQE++DE K S G+P
Sbjct: 180 LEQAMIHSLMVVGWSSFWMACGLIFIAAADVPFVLYEAHKKLLMTKQEVRDEHKNSEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R + + R   + +MM +   A +IITNPTH+A+AL+Y   +  AP+L+AKG +L+A
Sbjct: 240 EIKQRIRQLQREMSQRRMMASVPEADVIITNPTHFAVALKYDPEQGGAPMLLAKGTDLVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            K+R+I   + I I E  +LARS++    ++  IP   Y AVAQ++  +Y 
Sbjct: 300 LKIREIGAHNEILILESAALARSIYYSTELDQEIPAGLYLAVAQVLAYVYQ 350


>gi|254459117|ref|ZP_05072540.1| flagellar biosynthetic protein FlhB [Campylobacterales bacterium GD
           1]
 gi|207084388|gb|EDZ61677.1| flagellar biosynthetic protein FlhB [Campylobacterales bacterium GD
           1]
          Length = 349

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 117/354 (33%), Positives = 187/354 (52%), Gaps = 19/354 (5%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREAS----LFSSILACLIYLLFFFSPGIYSVT 59
           +DA   KTE P+ KKIEDA  EGN P S++ S    LF +ILA L  +LF +      + 
Sbjct: 3   DDA--EKTEEPTPKKIEDARKEGNVPKSQDTSGVITLFVAILATL--MLFPYMSNHMLLL 58

Query: 60  SDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLN 119
              +  L      KL  I   +  +    L    +++P  +   + G+ + L Q   +  
Sbjct: 59  FKYYFSLIGTPLDKLFMIDIAIVTIKEFLL----IIMPLAIAVAISGVIAALAQFGFLFT 114

Query: 120 LNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISA 179
              + P FK++   +G K ++S+  L+  +K   K     T + I     +  +L+  + 
Sbjct: 115 TKAIMPDFKKIDPIKGTKNLFSMKKLIESVKITFKSF---TTLGIGFVFFFLYILELPTV 171

Query: 180 NPHSILYHAFFTVRKVLIM---ILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQS 236
              S+     +   K +I+   +LL I    ++DI     Q++  LKMSKQEIKDE+K  
Sbjct: 172 ALFSLGEQLVWLKDKAIILAFVMLLIIFVFAMIDIVIVRKQYFDGLKMSKQEIKDEMKNM 231

Query: 237 YGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQ 296
            G+P+IK + + I     R +MM     A +IITNPTHYA+AL+Y +++  AP +VAKG 
Sbjct: 232 EGDPLIKGKIRQIQMQASRKRMMAEVPNADVIITNPTHYAVALKYEESKR-APYVVAKGM 290

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           + IA++++KIA E+N+ I + P LARSL+  V I+  IP   + AVA+++  +Y
Sbjct: 291 DNIAQQIKKIARENNVHIVQNPPLARSLYADVEIDKPIPEELFAAVAEVLAYVY 344


>gi|114332395|ref|YP_748617.1| flagellar biosynthesis protein FlhB [Nitrosomonas eutropha C91]
 gi|114309409|gb|ABI60652.1| flagellar biosynthetic protein FlhB [Nitrosomonas eutropha C91]
          Length = 376

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 104/352 (29%), Positives = 182/352 (51%), Gaps = 10/352 (2%)

Query: 6   APDN---KTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDL 62
           A DN   +TE  S +++E +  EG    S+E + F+ ++A    L    S     +   L
Sbjct: 2   ADDNDLERTEPASPRRLEKSREEGQVARSQELTTFTMLMAASGSLWVIGS----LIIQKL 57

Query: 63  HVLLASATQRKLEDISHIVFLLT---HLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLN 119
             LL S  Q + E   +   LL     L+L     + P L   ++  + S ++    + +
Sbjct: 58  SALLESGLQIEREVAFNPALLLPRLFQLALDGLLAIAPLLGWLVIVALVSPMLLSGWLFS 117

Query: 120 LNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISA 179
              + P FKR++   G KRI+S + L+  +K+  K  ++G +    +  +   +LD I  
Sbjct: 118 SKALFPDFKRLNPVNGFKRIFSSHGLIELVKAIAKAAVIGGVAAGIIWSHKQDVLDLIGM 177

Query: 180 NPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
              + L      +    ++I+  +  L V+D+ +       +L+MSK++++ E K+  G+
Sbjct: 178 PLDTGLTSMGRLIGLTFMLIVGAMLLLVVIDVPFQLWNHARQLRMSKEDLRKEAKEDEGD 237

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLI 299
           P +K R +S+ R   R +MM    RA +++TNPTHYA+AL+Y      AP +VAKG  LI
Sbjct: 238 PQVKARIRSMQREMARRRMMAEVPRADVVVTNPTHYAVALKYQDHSMRAPKVVAKGSQLI 297

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           A ++R++A EH+IP+ E P LAR+L+  V +++ IP   Y AVA ++  ++ 
Sbjct: 298 AARIRELADEHHIPVLEVPPLARALYHHVELDTEIPETLYTAVAHVLAYVFQ 349


>gi|331269330|ref|YP_004395822.1| flagellar biosynthetic protein FlhB [Clostridium botulinum
           BKT015925]
 gi|329125880|gb|AEB75825.1| flagellar biosynthetic protein FlhB [Clostridium botulinum
           BKT015925]
          Length = 594

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 104/351 (29%), Positives = 186/351 (52%), Gaps = 4/351 (1%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A D+KTE  +  K+ +A  +G  P S+E S    +L   I LL        S   D+   
Sbjct: 245 ASDDKTEEATPHKLSEARKKGQVPKSKEVSSAIILLTSTIILLTLGEYVANSFKKDIIEF 304

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
             +    +L ++S ++ ++  +      + +P ++  M+ GIG+ L+Q   + +   +KP
Sbjct: 305 FTNYLNIEL-NVSSLISIIVTILWRFMIVFLPVVVPLMVMGIGANLLQTGYINSKEPLKP 363

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
              +++   G K+++S+  ++  +K    I ++G +    L  N+  +L   +     I+
Sbjct: 364 QLSKINPISGFKKMFSMRTVMELLKDIAVITIIGFVGYGFLKSNFRKVLSMTTLRFPVII 423

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
                    +   + L +  + + D  +   Q+   +KMSKQE+K+E KQ  G+P +K +
Sbjct: 424 TSFLKLTTNIFFRVSLVMIAIALTDFIYQKFQFKRDMKMSKQEVKEEFKQMEGDPQVKGK 483

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
            K   R     +MM+    A+++ITNPTH A+AL+Y   E++AP+LVAKG + IA K+++
Sbjct: 484 IKQKQREMAMGRMMQNVPDASVVITNPTHIAVALKYEDGEDNAPMLVAKGSDYIAIKIKQ 543

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQ---LIYKIYHKK 353
           IA E+++PI E   LAR +FK+V I + IP   Y+AVA+   L+YK+  +K
Sbjct: 544 IAKENDVPIIENKPLARLIFKEVEIENEIPSDMYQAVAEILALVYKLKRQK 594


>gi|312135835|ref|YP_004003173.1| flagellar biosynthetic protein flhb [Caldicellulosiruptor
           owensensis OL]
 gi|311775886|gb|ADQ05373.1| flagellar biosynthetic protein FlhB [Caldicellulosiruptor
           owensensis OL]
          Length = 366

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 112/356 (31%), Positives = 195/356 (54%), Gaps = 23/356 (6%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL--- 65
            KTE  + +K ++A   G    SRE +   ++L  +++L F +S     +T  L      
Sbjct: 15  TKTEKATPRKRQEARKRGMVAKSREVTSAFALLMSILFLKFGYSL----ITQPLQAFSTY 70

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMM------FGIGSYLIQRIPVLN 119
                   +E++     LL  +  ++ ++V+P  L  M       +  GS+LI       
Sbjct: 71  FFGNLDYNIENVRDASRLLGLIVTTSLKIVLPFCLAVMFVATIVEWAQGSFLI------T 124

Query: 120 LNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFT-MLDFIS 178
              +K SF++++  EG KRI+SIN++V  +KS +K++++G     S T+++   +L+   
Sbjct: 125 AESLKISFQKINPIEGFKRIFSINSVVELIKSILKVLVIG-YTGYSYTKSFAKKLLEMYE 183

Query: 179 ANPHSILYHAFFT-VRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSY 237
            N  +I+  +F + V  +L M ++F   + ++D  +   Q+  KL M+K+E+K+E KQ+ 
Sbjct: 184 MNVLTIVKFSFDSAVNLILWMSVMFFG-IAIIDFTFQRWQYEKKLMMTKEEVKEEFKQTE 242

Query: 238 GNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQN 297
           GNP IK+R +   R     +M +   RA ++ITNPTHYA+AL Y   + DAP ++AKG++
Sbjct: 243 GNPQIKSRIRERQRRISLQRMFQQLPRADVVITNPTHYAVALLYEPEKFDAPRVIAKGKD 302

Query: 298 LIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            IA K+++ A ++NI I E   LAR+L+    I   IPP  Y+AVA+++  +Y  K
Sbjct: 303 YIALKIKQEAMKYNIEIVENKELARALYNICEIGDFIPPELYQAVAEVLAYVYSLK 358


>gi|256750759|ref|ZP_05491644.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|256750342|gb|EEU63361.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter ethanolicus
           CCSD1]
          Length = 363

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 108/347 (31%), Positives = 182/347 (52%), Gaps = 2/347 (0%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA- 67
            KTE  + K+ +DA  +G    SRE +    I+A  + +     P +  + +    LL  
Sbjct: 15  EKTEPATPKRRQDARKKGQVFQSREITSALVIVAGFLAVNILTMPSLEKMMALTKYLLYT 74

Query: 68  -SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
            S     + ++  I  L T++   A  +++P +LL  +  + S  +Q   V     +   
Sbjct: 75  YSGANDDVFNVVGIRNLFTYVLQQAISIIMPIILLIFVVSLASTYLQVGFVFTTEPLAFK 134

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
           F+R++  EG KRI+S   LV   KS  K+ ++  I+   L   Y  +   +  +   IL 
Sbjct: 135 FERLNPVEGFKRIFSKRALVELAKSIAKVAVLFYIMYSFLASQYKGIPMLLDMSVQDILK 194

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
           +A   +  + I I + +  L  LD  + + ++ + LKMSK++IK+E K++ GNP IK   
Sbjct: 195 YALNILLGITIRIGIVLIVLGALDYFFQWREYETSLKMSKEDIKEEFKETEGNPQIKAEI 254

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           +   R     +MM+   +A ++ITNPTH A+AL Y    NDAPV++AKGQ++IA +M++ 
Sbjct: 255 RRKQRQVSMRRMMQDLKKADVVITNPTHLAVALMYDSNVNDAPVVIAKGQDMIALRMKEE 314

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A + NIPI E   LA++L++   I   IP   Y+AVA+++  +Y  K
Sbjct: 315 AKKLNIPIVENKPLAQALYRSTEIGDMIPSELYQAVAEVLAYVYSLK 361


>gi|258592485|emb|CBE68794.1| Flagellar biosynthetic protein FlhB [NC10 bacterium 'Dutch
           sediment']
          Length = 359

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 105/355 (29%), Positives = 189/355 (53%), Gaps = 9/355 (2%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M  +DA D +TE+ +SK+ ++A   G   ++R   L +++L     L F+   G  S+ +
Sbjct: 1   MPSDDAKD-RTESATSKRRQEARGRGQ--VARSQDLNAALLMLSGILTFYVLGG--SLVA 55

Query: 61  DLHVLLASATQRKLED---ISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPV 117
           DL  L+     + L     +  +   +   SL  + ++ P +   ++    S + Q   +
Sbjct: 56  DLVGLMRFYFGQGLGGELTVPRVQQTMFSASLRMATMLAPLMGTLVVVAYVSSVAQVGFL 115

Query: 118 LNLNHVKPSFKRVSLREGIKRIYSIN-NLVNFMKSFVKIILVGTIITISLTENYFTMLDF 176
            N + +   ++R++   G KR+++    L+  +KS +K  LVG ++  +L+ +   +   
Sbjct: 116 TNSSALSLKWERLNPATGFKRLFAPGRTLIETIKSILKFALVGFLVYRTLSGHLSEIPLL 175

Query: 177 ISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQS 236
           +   P   L        ++ + + L   TL  LD GW   Q+   ++M+K+E+K+E+KQ+
Sbjct: 176 MDMTPMQTLTWLGQICFQLALRVGLAFLTLAALDYGWQRWQFEKSIRMTKEEVKEEMKQT 235

Query: 237 YGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQ 296
            G+P +K R K + R    H+MM    +A ++I NP H+A+A+RY  T  +AP +VAKG 
Sbjct: 236 EGDPAVKGRIKGLQRQAAMHRMMTDVPKADVVIVNPIHFAVAMRYDSTSMEAPTVVAKGA 295

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            L+A+++  +A  H IPI E+P LAR+L+K V I   IP   YKAVA+++  +Y 
Sbjct: 296 RLVAERIVAMAKAHGIPIVEDPPLARALYKAVSIGRPIPIHLYKAVAEILAYVYQ 350


>gi|330964680|gb|EGH64940.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 369

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 101/351 (28%), Positives = 185/351 (52%), Gaps = 1/351 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+   +KTE P+ KK++D+  EG    S+E +    +L     LL F   GI  + S
Sbjct: 1   MAENENGQDKTEDPTEKKVKDSRAEGQIARSKELTTLVVMLMGAGGLLMF-GAGIAQMMS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           +L     + ++  + D S++   L    L A  +++P L+  +   +   ++    + + 
Sbjct: 60  ELMRDNFTISRETIMDQSYMGKALLSSGLHALVVMLPFLIAMLAAALVGPILLGGWLFST 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++    +KR++S + LV  +KSF K +++  +  + L++    ++      
Sbjct: 120 KSLMPKFSRMNPAARLKRMFSPHALVELLKSFGKFLIILAVALVVLSKERNDLVAIAHEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V      +   +  +   D+ +  ++ + KL M+KQE++DE K S G+P
Sbjct: 180 LEQAMIHSLLVVGWSSFWMACGLMFIAAADVPFVLYEAHKKLLMTKQEVRDEHKNSEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R + + R   + +MM +   A +IITNPTH+A+AL+Y   +  AP+L+AKG +L+A
Sbjct: 240 EIKQRIRQLQREMSQRRMMASIPEADVIITNPTHFAVALKYDPEQGGAPMLLAKGTDLVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            K+R+I   + I I E  +LARS++    ++  IP   Y AVAQ++  +Y 
Sbjct: 300 LKIREIGAHNQILILESAALARSIYYSTELDQEIPAGLYLAVAQVLAYVYQ 350


>gi|192360845|ref|YP_001982207.1| flagellar biosynthesis protein FlhB [Cellvibrio japonicus Ueda107]
 gi|190687010|gb|ACE84688.1| flagellar biosynthetic protein FlhB [Cellvibrio japonicus Ueda107]
          Length = 379

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 115/363 (31%), Positives = 193/363 (53%), Gaps = 24/363 (6%)

Query: 1   MSE-NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFF--FSPG-IY 56
           M+E +D+   KTE PS++++E A  EG  P SR+ +  + +L   I L  F  F  G + 
Sbjct: 1   MAEGDDSSQEKTEEPSARRLEKAREEGQIPRSRDLTTTAVLLLAAIGLWVFAEFMGGKLL 60

Query: 57  SVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFG---IGSYLIQ 113
            +T +  ++  +        ISH+V  +    LS + L++  LL+  + G   +G +L  
Sbjct: 61  GITRENFIISRTDIFDTNAMISHLVRAIYQGMLSMAPLMVL-LLIASIVGPIALGGWL-- 117

Query: 114 RIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVK--IILVGTIITISL-TENY 170
               ++   + P   R+    G+KRI+S+ +L+   K+ +K  IIL+ TI  + L  ++ 
Sbjct: 118 ----MSSKAMMPKLSRMDPIAGLKRIFSLKSLIELFKALLKVSIILLTTIWLLFLYAQDM 173

Query: 171 FTMLDFISANP--HSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQE 228
           F + D    N   HS+    + T+      I++       +DI    ++   KLKMS+Q+
Sbjct: 174 FRISDEAVGNAIVHSLEISIYATIALAATTIVI-----AAVDIPLQLYEHNKKLKMSRQD 228

Query: 229 IKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDA 288
           +KDE K + G P +K R + + R   + +MM     A ++ITNPTH+A+AL+Y     D 
Sbjct: 229 LKDEAKDTDGKPEVKGRIRQLQREMAQRRMMANVPMADVVITNPTHFAVALKYDPETMDT 288

Query: 289 PVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYK 348
           P+++AKG + IA K+R+IA  HNI   E P LAR+++    I+ AIP   Y AVAQ++  
Sbjct: 289 PIMLAKGGDNIALKIREIAKAHNIETIESPPLARAIYYTTEIDQAIPSGLYLAVAQVLAY 348

Query: 349 IYH 351
           ++ 
Sbjct: 349 VFQ 351


>gi|156933534|ref|YP_001437450.1| hypothetical protein ESA_01354 [Cronobacter sakazakii ATCC BAA-894]
 gi|156531788|gb|ABU76614.1| hypothetical protein ESA_01354 [Cronobacter sakazakii ATCC BAA-894]
          Length = 348

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 78/219 (35%), Positives = 129/219 (58%)

Query: 135 GIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAFFTVRK 194
           GIKRI+S  +L   +K+ +K +LVG +  + L  N+  ++  IS +P + + +A   V  
Sbjct: 98  GIKRIFSSQSLAELLKAILKSVLVGIVTGVFLWYNWPDIMRLISESPIAAMRNALNLVAL 157

Query: 195 VLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSRI 254
             I+I++ +  +   D+ W       KL+MS+Q+I+DE K   G+P +K R +   R   
Sbjct: 158 CCILIVMGLVPMVGFDVFWQIVSHTKKLRMSRQDIRDEFKNQEGDPHVKGRIRQQQREAA 217

Query: 255 RHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIPI 314
           R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++R+I  EH IP+
Sbjct: 218 RRRMMADIPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRIREIGNEHRIPM 277

Query: 315 FEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 278 LEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 316


>gi|187925774|ref|YP_001897416.1| flagellar biosynthesis protein FlhB [Burkholderia phytofirmans
           PsJN]
 gi|187716968|gb|ACD18192.1| flagellar biosynthetic protein FlhB [Burkholderia phytofirmans
           PsJN]
          Length = 403

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 105/369 (28%), Positives = 189/369 (51%), Gaps = 38/369 (10%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   KTE+ + ++++ A  EG    SRE S F+ +LA   + ++  S    S+  
Sbjct: 1   MAE-DSDLEKTESATPRRLQKAREEGQIVRSRELSTFA-LLAAGFFGVWGMS---GSIGE 55

Query: 61  DLHVLLASA----------TQRKL--------EDISHIVFLLTHLSLSASRLVIPGLLLF 102
            L  +L +A          T+R +        E +  ++ +L    ++A         LF
Sbjct: 56  HLQGMLRAAFSFDHAGAFETRRMMIGAGVASREGLYALLPILAFTGVAA---------LF 106

Query: 103 MMFGIGSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTII 162
               +G +       L+   ++P F R++   G+ +++SIN  +    S  K ++VG I 
Sbjct: 107 APMALGGWQ------LSAKGLEPKFDRLNPIAGLGKMFSINGPIQLGMSLAKTLVVGVIG 160

Query: 163 TISLTENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKL 222
             ++      +L       H  L +    +     M +  +  +  +D+ +   Q++ KL
Sbjct: 161 GTAIWNRREEILALAMQPLHLALANTVHLIAVCCGMTVAGMFVVAAMDVPYQLWQFHKKL 220

Query: 223 KMSKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYI 282
           +M+K+E+K E ++S G+P +K R +   R+  R +MM    +A +++TNPTH+A+AL+Y 
Sbjct: 221 RMTKEEVKREHRESEGDPHVKGRIRQQQRAIARRRMMTNVPKADVVVTNPTHFAVALQYT 280

Query: 283 QTENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAV 342
             E  AP +VAKG NL+A ++R+IA E+N+P+ E P LAR+L+  V +N  IP   Y AV
Sbjct: 281 DGEMRAPKVVAKGVNLVAARIREIAAENNVPLLEAPPLARALYHNVELNREIPGPLYGAV 340

Query: 343 AQLIYKIYH 351
           A+++  +Y 
Sbjct: 341 AEVLAWVYQ 349


>gi|90406806|ref|ZP_01214998.1| flagellar biosynthesis protein [Psychromonas sp. CNPT3]
 gi|90312043|gb|EAS40136.1| flagellar biosynthesis protein [Psychromonas sp. CNPT3]
          Length = 379

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 102/356 (28%), Positives = 191/356 (53%), Gaps = 11/356 (3%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+    ++E  + ++I  +  +G    S+E +  S +++  I ++ F     Y    
Sbjct: 1   MAENENGTERSEEATPERIRKSKEKGQVARSKELATASVLISAAIAMMTFGGRLAY---- 56

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPG-LLLFMMFGI---GSYLIQRIP 116
           +L +++  +   +   +    ++  HLS S   L  P  ++LFM+F I   GS L+  + 
Sbjct: 57  ELSIMMKRSFTFERSVLFSPEYIWLHLSTSFYGLAWPMFIILFMLFVISILGSSLLGGM- 115

Query: 117 VLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDF 176
           + +   + P + R+S + G+KR+  +   V  +KS +K+++V       L   +  +L  
Sbjct: 116 LFSTKALMPKWNRLSPKAGLKRMLGMQAWVELLKSILKVLVVVGAAWWILGATFEHILHL 175

Query: 177 -ISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQ 235
            +S+ P S+ Y A   +  + +M+   +  +  +D+ +  ++   +LKM+KQEIKDE + 
Sbjct: 176 SVSSLPGSV-YEALDMLLWMFLMLCCSLLIIVAIDVPYQIYKHKEELKMTKQEIKDEYRN 234

Query: 236 SYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKG 295
           S G P +K R + +     + KMME    A +I+TNPTHY++AL+Y Q    AP +VAKG
Sbjct: 235 SEGKPEVKQRIRQLQYEASQRKMMEDVPDADVIVTNPTHYSVALKYEQNGERAPYVVAKG 294

Query: 296 QNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            + +A K+R++A ++ IP+ E P L R+++    IN  +P   + A+AQ++  IY 
Sbjct: 295 VDFMALKIREVARDNEIPVMESPPLCRAIYHTTEINEEVPEELFIAIAQILAYIYQ 350


>gi|237799251|ref|ZP_04587712.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331022106|gb|EGI02163.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 378

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 102/351 (29%), Positives = 183/351 (52%), Gaps = 1/351 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+   +KTE P+ KK++DA  +G    S+E +    +L     LL F S  I ++ S
Sbjct: 1   MAENENGQDKTEDPTEKKVKDARADGQIARSKELTTLVVMLMGAGGLLMFGS-DIAAMMS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           +L     + T+  L D S++   L    L A  +++P L+  ++  +   ++    +   
Sbjct: 60  ELMRDNFTITRETLMDQSYMGKALLSSGLHALVVILPFLIAMLVAALVGPIMLGGWLFTT 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++   G+KR++S + LV  +KS  K +++  +    L      ++      
Sbjct: 120 KSLMPKFSRMNPAAGLKRMFSPHALVELLKSLGKFLIILAVALAVLNSERKDLVAIAHEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V      +   +  +   D+ +  ++ + KL M+KQE++DE K S G+P
Sbjct: 180 LEQAMIHSLMVVGWSSFWMACGLMFIAAADVPFVLYEAHKKLLMTKQEVRDEHKNSEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM +   A +IITNPTH+A+AL+Y   +  AP+L+AKG +L+A
Sbjct: 240 EVKQRIRQLQREMSQRRMMASIPEADVIITNPTHFAVALKYDPEKGGAPMLLAKGTDLVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            K+R+I   + I I E  +LARS++    ++  IP   Y AVAQ++  +Y 
Sbjct: 300 LKIREIGAHNQILILESAALARSIYYSTDLDQEIPAGLYLAVAQVLAYVYQ 350


>gi|325288792|ref|YP_004264973.1| flagellar biosynthetic protein FlhB [Syntrophobotulus glycolicus
           DSM 8271]
 gi|324964193|gb|ADY54972.1| flagellar biosynthetic protein FlhB [Syntrophobotulus glycolicus
           DSM 8271]
          Length = 355

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 111/346 (32%), Positives = 187/346 (54%), Gaps = 11/346 (3%)

Query: 5   DAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSI-LACLIYLLFFFSPGIYSVTSDLH 63
           DA   K    + K+ ++A  +G    S+E  L SSI L  +I +L F+ P +    +DL 
Sbjct: 2   DAIAEKRFPATPKRKQEARKKGQVLKSQE--LTSSIMLLAMIGVLRFWLPSVLERFADLM 59

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             + S    +  +IS +  L+ +++  A++++ P LL  +   +    IQ   + +   +
Sbjct: 60  KYVYSLPT-EWSNIS-VASLMLNMTWQAAQILAPVLLTTVAVAVAVNYIQVGSLFSTEAI 117

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTEN--YFTMLDFISANP 181
            P   R+SL EG KR++ +   +   KS +K+I +G  +   + ++   F  L  I+A  
Sbjct: 118 MPKLSRLSLIEGAKRMFGVRAWIQLAKSLLKVIAIGYFLYAVIRDHLEMFPALQQINALQ 177

Query: 182 HSI-LYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            ++ L    F +   +    L I+ L  L   W Y +    L+MS +EIK+E KQ+ G+P
Sbjct: 178 ATMFLGEILFELAWKIATAFLLISILDFLYQWWEYEK---NLRMSHEEIKEEYKQNEGDP 234

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +KN  K   R+    +MME   +A ++ITNPTHYA+AL+Y   + DAP +VAKGQ+ +A
Sbjct: 235 QLKNEMKKRQRAVAMRRMMEDLKKADVVITNPTHYAVALKYDPQKFDAPYVVAKGQDQVA 294

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
            ++++ A E+ I + E   LAR+L+ QV I  A+P   YKAVA+++
Sbjct: 295 LRIKETARENRIIMMENKPLARTLYTQVEIGQAVPAELYKAVAEVL 340


>gi|261855327|ref|YP_003262610.1| flagellar biosynthetic protein FlhB [Halothiobacillus neapolitanus
           c2]
 gi|261835796|gb|ACX95563.1| flagellar biosynthetic protein FlhB [Halothiobacillus neapolitanus
           c2]
          Length = 379

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 109/360 (30%), Positives = 189/360 (52%), Gaps = 15/360 (4%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISRE-ASLFSSILACLIYLLFFFSPGIYSVT 59
           M+EN+    KTE PS K++ +A  +G    SRE  SL  +  + +++L+     G + + 
Sbjct: 1   MAENENGQEKTEEPSEKRLREAREKGQVARSRELGSLALTAGSAIVFLVM----GGH-ML 55

Query: 60  SDLHVLLASATQRKLEDISHIVFLLTHLSLSASR---LVIPGLLLFMMFGIGSYLIQRIP 116
           S L  +   A      +I     +   L+LS S     ++P  L  ++  + S L+    
Sbjct: 56  SRLEQMFRHAFTLSRAEIMDPATMFHRLALSFSEGFLALLPFFLAAVVLAVSSTLLVGGW 115

Query: 117 VLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISL---TENYFTM 173
             +   + P F R++   G KR++S+ +LV  +K+  K  L+  I  I L    E  F  
Sbjct: 116 NFSTQALAPQFNRLNPLSGFKRMFSMKSLVELLKTLAKFFLIAAI-AIGLFEAMEKDFVG 174

Query: 174 LDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEI 233
           L  +     + L  A   +    + + L +  + ++D+ +  +++   L+M++QE+ DE 
Sbjct: 175 LGLMGL--EAGLARAGTLLSWSFLGLSLGLLVVAMIDVPFQMYEYKKGLRMTRQEMIDEY 232

Query: 234 KQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVA 293
           K+  G P +K + + + R   + +MMEA   A +IITNPTH+++AL+Y    + AP++VA
Sbjct: 233 KEVEGKPEVKQKIRQLQRQMAQRRMMEAVPTADVIITNPTHFSVALKYQPNSDAAPMVVA 292

Query: 294 KGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           KG + +A  +RKIA  +++P+FE P LARSLF  V +  AIP   Y AVAQ++  ++  K
Sbjct: 293 KGADEMAMTIRKIANANHVPLFESPQLARSLFAHVEVGDAIPSGLYVAVAQVLAYVFQMK 352


>gi|152983829|ref|YP_001349232.1| flagellar biosynthesis protein FlhB [Pseudomonas aeruginosa PA7]
 gi|150958987|gb|ABR81012.1| flagellar biosynthetic protein FlhB [Pseudomonas aeruginosa PA7]
          Length = 378

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 106/360 (29%), Positives = 197/360 (54%), Gaps = 15/360 (4%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+++  +KTE P+ K+  +A  +G  P SRE +  + ++A    LL + +     + +
Sbjct: 1   MAESESGQDKTEEPTEKRRREAREKGQLPRSRELNTLAILMAGAGGLLIYGA----DLAA 56

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLS---ASRLVIPGLLLFMMFGIGSYLIQRIPV 117
            +  L+ S+ +   E + +   +L  L  S   A++ + P LL+ ++  I   +     +
Sbjct: 57  AMLRLMRSSFELSRETVLNTESMLQLLGASGYLAAQGLWPILLMLLVAAIVGPIALGGWL 116

Query: 118 LNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFI 177
            +++ ++P F R++   G+KR++S  +L+   K+ +K ++V  +  + L+ +   +L  +
Sbjct: 117 FSMDALQPKFSRLNPLSGLKRMFSAKSLLELSKALIKFLVVLAVALLVLSADRDALL-AL 175

Query: 178 SANP--HSILYHAFFTVRKVLIMI--LLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEI 233
           +  P   +IL+ A         M   LL IA + V    W   Q   KL M+KQE++DE 
Sbjct: 176 AHQPLEQAILHSAQVVGWSAFWMACSLLLIAAVDVPYQIWDNRQ---KLMMTKQEVRDEY 232

Query: 234 KQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVA 293
           K S G P +K++ + + R   + +MM A   A ++ITNPTH+A+AL+Y      AP+L+A
Sbjct: 233 KDSEGKPEVKSKIRQMQREMAQRRMMAAVPEADVVITNPTHFAVALKYDPAGGGAPLLLA 292

Query: 294 KGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           KG + +A K+R++A EH + + E P+LAR+++    ++  IP   Y AVAQ++  +Y  K
Sbjct: 293 KGNDFLALKIREVAREHKVMVMESPALARAVYYSTELDQEIPAGLYLAVAQVLAYVYQLK 352


>gi|221635443|ref|YP_002523319.1| flagellar biosynthetic protein FlhB [Thermomicrobium roseum DSM
           5159]
 gi|221157327|gb|ACM06445.1| flagellar biosynthetic protein FlhB [Thermomicrobium roseum DSM
           5159]
          Length = 363

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 99/345 (28%), Positives = 172/345 (49%), Gaps = 5/345 (1%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSI--LACLIYLLFFFSPGIYSVTSDLHVLL 66
            +TE  + ++ ++A   G  P  R A L S++  LA   +L ++      ++   L    
Sbjct: 4   ERTERATPRRRQEARKRGQVP--RSADLTSALVLLAGAFFLPWYAGAAGQTLWDYLERAF 61

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
           +    R L     IV L      +  +L +P L LF   G+ S L+Q   V     +KP 
Sbjct: 62  SGPLPRDLTG-PDIVALAWASGATVLKLALPILGLFAAVGVASTLVQAGFVFAPAVLKPD 120

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
           ++R+    G +R++S   L    K+ +KI +V  +    +  +     D   A P +I  
Sbjct: 121 WRRIDPIAGFQRLFSRRGLFETGKALLKIAIVLAVTYPLIQRDLPRYADLTGAEPAAIAQ 180

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
               ++R + + +      L +LD G+       +L+M++ E+K+E++Q+ G+P IK R 
Sbjct: 181 AIGQSMRDLAVRVGAAYLALAILDYGFQRWDLEQRLRMTRHELKEELRQTEGDPEIKARI 240

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           + + R     +MM    +AT+++TNPTH A+ALRY      APV+VAKG   +A+++  I
Sbjct: 241 RRLQRQMAMRRMMAQVPKATVVVTNPTHLAVALRYEPRSMRAPVVVAKGAGAVAERITAI 300

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           A +H IP+     LA++L++ V +   IP   Y+AVA +I  +Y 
Sbjct: 301 ARQHTIPVLRNQPLAQALYRTVEVGQEIPITLYEAVADIIAYVYR 345


>gi|157164760|ref|YP_001466322.1| flagellar biosynthesis protein FlhB [Campylobacter concisus 13826]
 gi|112800831|gb|EAT98175.1| flagellar biosynthetic protein FlhB [Campylobacter concisus 13826]
          Length = 357

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 98/352 (27%), Positives = 194/352 (55%), Gaps = 22/352 (6%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSI---LACLIYLLFFFSPGIYSVTSDLHVL 65
            KTE  + KKIEDA  +GN P S++ S F ++   +  L+ +L F    + S    L++ 
Sbjct: 7   EKTEEATPKKIEDAKKDGNVPKSQDLSGFVTLVIAIGVLLAMLNFMKDQVIS----LYIY 62

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
            +    + L  +  +  ++ +    A  +++P  +   + GI + ++Q   +     + P
Sbjct: 63  YSKFIGQPLT-LPTVKMIVVNTFGRALLMILPVCICVAVAGIIANVMQFGFIFTTKPITP 121

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
           +F +++  +G+K ++S       MK  ++ + +   ++I     ++  L FI   PH++ 
Sbjct: 122 NFGKINPLKGLKNLFS-------MKKAIESVKIVVKVSIVFGVGFYFFLQFIKELPHTLF 174

Query: 186 YHAFFTVRK------VLIMILLFIA-TLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYG 238
           +  F  +        +L+ ++LFI   + + D+     Q++  L+MSKQEIKDE KQ  G
Sbjct: 175 FSMFDQLAWLKEKLIILVSVMLFILFVIGLADLLIVRFQYFKDLRMSKQEIKDEYKQMEG 234

Query: 239 NPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL 298
           +P +K R +       + +MM+   +A ++ITNPTHYA+A+RY ++ ++AP+++AKG + 
Sbjct: 235 DPQVKGRIRQAQMRAAKRRMMQNIPQADVVITNPTHYAVAIRYDKSRDEAPIILAKGVDF 294

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           +A +++K+A E+ + I+E P LAR L++   ++  IP   ++AVA+++  +Y
Sbjct: 295 LALQIKKVAVENGVQIYENPPLARELYRVCEVDDTIPAHLFRAVAEVLSFVY 346


>gi|323210683|gb|EFZ95561.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
          Length = 338

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 76/231 (32%), Positives = 136/231 (58%)

Query: 123 VKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPH 182
           ++P F +++   GIKR++S       +K+ +K  LVG +    L  N+  M+  ++ +P 
Sbjct: 76  LQPKFSKLNPLPGIKRMFSAQTGAELLKAVLKSTLVGCVTGFYLWHNWPQMMRLMAESPI 135

Query: 183 SILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPII 242
             + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE K+S G+P +
Sbjct: 136 VAMGNALDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKESEGDPHV 195

Query: 243 KNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKK 302
           K + + + R+  + +MME   +A +I+TNPTHY++AL+Y + +  AP +VAKG  LIA +
Sbjct: 196 KGKIRQMQRAAAQRRMMEDVPKADVIVTNPTHYSVALQYDENKMSAPKVVAKGAGLIALR 255

Query: 303 MRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +R+I  EH +P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 256 IREIGAEHRVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 306


>gi|333004498|gb|EGK24027.1| flagellar biosynthetic protein FlhB [Shigella flexneri K-272]
 gi|333017872|gb|EGK37178.1| flagellar biosynthetic protein FlhB [Shigella flexneri K-227]
          Length = 397

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 104/353 (29%), Positives = 193/353 (54%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G+ S+   L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVSVIWFGGV-SLARRLS 57

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++        ++D + I+  +  L   A   ++P +   ++  + S ++    V + 
Sbjct: 58  GMLSAGLHFDHSIIKDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSG 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKRI+S       +K+ +K ILVG++    L  ++  M+  ++ +
Sbjct: 118 KSLQPKFSKLNPLPGIKRIFSAQTSAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAES 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P
Sbjct: 178 PITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R   + R+  R +MM    +A +I+ NP HY++AL+Y + +  AP +VAKG  L+ 
Sbjct: 238 HVKGRICQMQRAAARRRMMADVPKADVIVNNPNHYSVALQYDENKMSAPKVVAKGAGLVV 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 298 LRIREIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|118133499|gb|ABK60543.1| flagellar biosynthetic protein FlhB [Clostridium novyi NT]
          Length = 575

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 106/351 (30%), Positives = 183/351 (52%), Gaps = 4/351 (1%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A D+KTE  +  K+ +A  +G    S+E +    +L   I LL        S+  D+   
Sbjct: 226 ASDDKTEEATPHKLSEARKKGQVAKSKEVNSAIILLTSTIILLTLGEYVANSLKKDIIEF 285

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
             +     L   S    ++T ++   + + +P +L  M+ G+G+ L+Q   + +   +KP
Sbjct: 286 FTNYLNMNLNSGSLQSIIVT-IAWRFAVVFLPVVLPLMIMGVGANLLQTGYINSKETLKP 344

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
              +++   G K+I+S+  ++  +K    I ++G +    L  N+  +L   S     I+
Sbjct: 345 QLSKINPINGFKKIFSMRTVMELLKDIAVIFVIGYVGYGFLKSNFNKVLSMTSLRFPVII 404

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
                    +   + L +  + ++D  +   Q+   ++MSKQEIK+E KQ  G+P IK +
Sbjct: 405 TSFLKLTTTIFFRVSLVMIAIALIDFMYQKFQFKKDMRMSKQEIKEEFKQMEGDPQIKGK 464

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
            K   R     +MM++   A+++ITNPTH A+AL+Y   ++ AP LVAKG + IA K+++
Sbjct: 465 IKQKQREMAMGRMMQSVPDASVVITNPTHIAVALKYEDGKDSAPTLVAKGSDYIAIKIKE 524

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQ---LIYKIYHKK 353
           IA E+ +PI E   LAR +FK+V + S IP   Y+AVA+   L+YK+  KK
Sbjct: 525 IAKENEVPIIENKPLARLIFKEVELESEIPSEMYQAVAEILALVYKLKRKK 575


>gi|256022455|ref|ZP_05436320.1| flagellar biosynthesis protein FlhB [Escherichia sp. 4_1_40B]
          Length = 382

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 104/353 (29%), Positives = 194/353 (54%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G+ S+   L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVSVIWFGGV-SLARRLS 57

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L++        + D + I+  +  L   A   ++P +   ++  + S ++    V + 
Sbjct: 58  GMLSAGLHFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSG 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P   +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +
Sbjct: 118 KSLQPKCSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAES 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P
Sbjct: 178 PITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A
Sbjct: 238 HVKGRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 298 LRIREIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|71906378|ref|YP_283965.1| flagellar biosynthesis protein FlhB [Dechloromonas aromatica RCB]
 gi|71845999|gb|AAZ45495.1| Flagellar biosynthetic protein FlhB [Dechloromonas aromatica RCB]
          Length = 379

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 108/350 (30%), Positives = 182/350 (52%), Gaps = 6/350 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+   KTE P+ ++IE A  +G  P SRE + F   L   +    F+  G + +   L 
Sbjct: 5   EDSDLEKTEEPTGRRIEQAREQGQVPHSRELATF---LVLAVAGATFWMMGSWFMQRSLV 61

Query: 64  VLLAS--ATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLN 121
           ++        R + D   ++  L  +S  A  +  P L L ++  I         V +  
Sbjct: 62  IMQKGFFVESRYMRDPDLMLPRLAEISGDALFVFSPLLGLLLLAAILPPFFLNAWVFSPK 121

Query: 122 HVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANP 181
            + P   R++   G  R++S N+L+   K+ +K +LVG +  + + +    +   +    
Sbjct: 122 ALVPDLNRLNPLSGFGRMFSWNSLMELAKAVLKAVLVGGVAAMLIWKERDEIFGLLGEPL 181

Query: 182 HSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPI 241
              L HA   V    ++++  +  + V D+ +   Q++ KLKMSK+E+K E+K+  G+P 
Sbjct: 182 EVGLAHAGHLVSFSFLILVATLVLVVVADVPFQLWQYFDKLKMSKEEVKQEMKEMMGDPH 241

Query: 242 IKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAK 301
           +K R +S+     R +MM A  +A +++TNPTHYA+AL Y QT   AP +VAKG   +A 
Sbjct: 242 VKGRIRSLQMQAARKRMMSAVPKANVVVTNPTHYAVALAY-QTGMGAPKVVAKGVGAVAL 300

Query: 302 KMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           K+++IA EH +PI E P LAR+L+K   +++ IP   Y AVA+++  IY 
Sbjct: 301 KIKEIANEHAVPIMEAPPLARALYKHSELDTEIPSALYNAVAEVLAYIYQ 350


>gi|310659024|ref|YP_003936745.1| flagellar export pore protein [Clostridium sticklandii DSM 519]
 gi|308825802|emb|CBH21840.1| flagellar export pore protein [Clostridium sticklandii]
          Length = 363

 Score =  160 bits (404), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 110/355 (30%), Positives = 189/355 (53%), Gaps = 18/355 (5%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISRE----ASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           + KTE  S KK +D+  +G    SRE    A+L +S+LA      F F     +      
Sbjct: 15  EEKTEKASPKKKQDSRKKGQVMQSREINTAAALMASVLALKYSGGFMFRTITEATYFFRD 74

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLN-- 121
           +L        +     +++++ +++ +   ++        +  + +++  +I V NL   
Sbjct: 75  LLYTDILNESIGGYKILIYMIMYVTKAVVIVI-------GVGFVAAFITSKIQVGNLFTT 127

Query: 122 ---HVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFIS 178
               +KP  +R++  EG KR++S+ + V  +KS +KI +VG +    L +N   +L    
Sbjct: 128 ETLKIKP--ERLNPIEGFKRMFSMRSFVELVKSLLKIGVVGFVGYSYLAKNIGLVLKSQQ 185

Query: 179 ANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYG 238
             P    Y  F     + I +   I  + +LD  +  + +   LKMSKQEIK+E KQS G
Sbjct: 186 LKPIQFSYMIFELSINLAIRMTFAITVIAILDFFYQRYDYEKNLKMSKQEIKEEYKQSEG 245

Query: 239 NPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL 298
           +P IK++ K   R     +MM+   +A +IITNPTH+A+A++Y + + +AP +VAKG+NL
Sbjct: 246 DPQIKSKIKEKQRQAAMRRMMQEIPKADVIITNPTHFAVAIKYDEDKFEAPYVVAKGKNL 305

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           IA+ +++ A E NIP+ E   LA++L+K+V I   I P  Y+AVA+++  +Y  K
Sbjct: 306 IAQNIKQKAREVNIPVVENKPLAQALYKEVEIGQMISPQLYEAVAEILAYVYSLK 360


>gi|171321732|ref|ZP_02910646.1| flagellar biosynthetic protein FlhB [Burkholderia ambifaria MEX-5]
 gi|171092980|gb|EDT38217.1| flagellar biosynthetic protein FlhB [Burkholderia ambifaria MEX-5]
          Length = 399

 Score =  160 bits (404), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 103/357 (28%), Positives = 180/357 (50%), Gaps = 29/357 (8%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSP----------GIYSV 58
           ++TEA + ++ E A  EG    SRE + F+ + A         +P          G ++ 
Sbjct: 8   DRTEAATPRRREKAREEGQVARSRELASFALLAAGFYGAWLLAAPSGAHLQAMLRGAFAF 67

Query: 59  TS----DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQR 114
                 D H +L++A    +E ++ ++ +L    L+A               +G +LI +
Sbjct: 68  DRATAFDTHRMLSAAGSASIEGLAALLPILALTGLAAL---------LAPMALGGWLISQ 118

Query: 115 IPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTML 174
                    +  F R++   G+ RI+SI   +  + S  K ++VG I  I++  +   +L
Sbjct: 119 ------KTFELKFDRLNPISGLGRIFSIQGPIQLLMSLAKTLVVGGIGGIAIWRSKDELL 172

Query: 175 DFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIK 234
              +    S L  A   V       +  +  +  LD+ +   Q+  KL+M+K+E+K E +
Sbjct: 173 GLATQPLGSALADAMHLVAVCCGTTVAGMLVVAALDVPYQIWQYNKKLRMTKEEVKREHR 232

Query: 235 QSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAK 294
           ++ G+P +K R +   R+  R +MM A  +A +++TNPTH+A+AL+Y   E  AP +VAK
Sbjct: 233 ENEGDPHVKGRIRQQQRAIARRRMMAAVPKADVVVTNPTHFAVALQYTDGEMRAPKVVAK 292

Query: 295 GQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           G NL+A ++R++A EHN+P+ E P LAR+L+  V I   IP   Y AVA+++  +Y 
Sbjct: 293 GVNLVAARIRELAAEHNVPLLEAPPLARALYHNVEIEREIPGSLYSAVAEVLAWVYQ 349


>gi|209522058|ref|ZP_03270713.1| flagellar biosynthetic protein FlhB [Burkholderia sp. H160]
 gi|209497504|gb|EDZ97704.1| flagellar biosynthetic protein FlhB [Burkholderia sp. H160]
          Length = 411

 Score =  160 bits (404), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 104/350 (29%), Positives = 185/350 (52%), Gaps = 5/350 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+   KTE+ + ++++ A  EG    SRE S F+ +LA   Y ++  S  I     ++ 
Sbjct: 3   GDSDLEKTESATPRRLQKAREEGQVARSRELSTFA-LLAAGFYGVWGMSGSIGDHFQNM- 60

Query: 64  VLLASAT--QRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLN 121
            L AS T       D S ++      S      ++P L L  +  + + +     +L+  
Sbjct: 61  -LRASLTFNHASTFDTSRMLIGAGAASREGLYALLPILALTGLAALLAPMALGGWLLSTK 119

Query: 122 HVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANP 181
            ++P F R++  EG+ R++SIN  +    S  K ++VG I   ++   +   L   +   
Sbjct: 120 ALEPKFSRLNPIEGLSRMFSINGPIQLGMSLAKTLVVGLIGGTAIWNRHEQFLALATQPL 179

Query: 182 HSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPI 241
           +  L ++   +     M +  +  L  LD+ +    ++ KL+M+K+E+K E ++S G+P 
Sbjct: 180 NLALANSVHLIAVCCGMTVAGMFVLAALDVPYQLWTFHKKLRMTKEEVKREHRESEGDPH 239

Query: 242 IKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAK 301
           IK + +   R+  R +MM    +A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A 
Sbjct: 240 IKGKIRQQQRAIARRRMMAQVPKADVVVTNPTHFAVALQYTDGEMRAPKVVAKGVNLVAA 299

Query: 302 KMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           ++R++A E+N+P+ E P LAR+L+  V +N  IP   Y AVA+++  +Y 
Sbjct: 300 RIRELAAENNVPLLEAPPLARALYHNVDLNREIPGPLYGAVAEVLAWVYQ 349


>gi|162139705|ref|YP_877991.2| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           novyi NT]
          Length = 610

 Score =  159 bits (403), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 106/351 (30%), Positives = 183/351 (52%), Gaps = 4/351 (1%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A D+KTE  +  K+ +A  +G    S+E +    +L   I LL        S+  D+   
Sbjct: 261 ASDDKTEEATPHKLSEARKKGQVAKSKEVNSAIILLTSTIILLTLGEYVANSLKKDIIEF 320

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
             +     L   S    ++T ++   + + +P +L  M+ G+G+ L+Q   + +   +KP
Sbjct: 321 FTNYLNMNLNSGSLQSIIVT-IAWRFAVVFLPVVLPLMIMGVGANLLQTGYINSKETLKP 379

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
              +++   G K+I+S+  ++  +K    I ++G +    L  N+  +L   S     I+
Sbjct: 380 QLSKINPINGFKKIFSMRTVMELLKDIAVIFVIGYVGYGFLKSNFNKVLSMTSLRFPVII 439

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
                    +   + L +  + ++D  +   Q+   ++MSKQEIK+E KQ  G+P IK +
Sbjct: 440 TSFLKLTTTIFFRVSLVMIAIALIDFMYQKFQFKKDMRMSKQEIKEEFKQMEGDPQIKGK 499

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
            K   R     +MM++   A+++ITNPTH A+AL+Y   ++ AP LVAKG + IA K+++
Sbjct: 500 IKQKQREMAMGRMMQSVPDASVVITNPTHIAVALKYEDGKDSAPTLVAKGSDYIAIKIKE 559

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQ---LIYKIYHKK 353
           IA E+ +PI E   LAR +FK+V + S IP   Y+AVA+   L+YK+  KK
Sbjct: 560 IAKENEVPIIENKPLARLIFKEVELESEIPSEMYQAVAEILALVYKLKRKK 610


>gi|123442794|ref|YP_001006771.1| flagellar biosynthesis protein FlhB [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|332161312|ref|YP_004297889.1| flagellar biosynthesis protein FlhB [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|122089755|emb|CAL12608.1| flagellar biosynthetic protein FlhB [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|318605230|emb|CBY26728.1| flagellar biosynthesis protein FlhB [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325665542|gb|ADZ42186.1| flagellar biosynthesis protein FlhB [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330860618|emb|CBX70915.1| flagellar biosynthetic protein flhB [Yersinia enterocolitica
           W22703]
          Length = 383

 Score =  159 bits (403), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 108/356 (30%), Positives = 185/356 (51%), Gaps = 13/356 (3%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+  +K+E P++ K+E A  +G  P SRE    +S+L     L   +  G  S+   L 
Sbjct: 3   EDSDADKSEEPTAHKLEKAREKGQIPRSRE---LTSMLMLGAGLAILWVSG-ESMARQLA 58

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVL----- 118
            ++A         IS    +L  + +   + +I  + +F    I   +   +P+L     
Sbjct: 59  AMIAQGLHFDHGLISDDKQMLRQIGMLLRQTLIALIPIFAGLVI---VAMAVPMLLGGVL 115

Query: 119 -NLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFI 177
            +   +K   KR+S   G+KR++S   L   +K+ +K  LVG +  I L  N+  M+  +
Sbjct: 116 FSGESIKFDLKRMSPIAGLKRMFSSQALAELLKAILKATLVGWVTGIFLWHNWPDMMRLM 175

Query: 178 SANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSY 237
           +A P + L  A   +    ++++L +  +   D+ +       KL+M+KQEI+DE K   
Sbjct: 176 AAPPVAALGDALHLIIFCGLVVVLGLTPMVGFDVFFQITSHIKKLRMTKQEIRDEFKDQE 235

Query: 238 GNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQN 297
           G+P +K R +   R+  R +MM    +A +I+TNPTHYA+AL+Y +T+  AP ++AKG  
Sbjct: 236 GDPHVKGRIRQQQRAMARRRMMADVHKADVIVTNPTHYAVALQYNETKMSAPKVLAKGAG 295

Query: 298 LIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            +A ++R++  EH IP+ E P LAR+LF+   +   IP   Y AVA+++  +Y  K
Sbjct: 296 AVALRIRELGAEHRIPLLEAPPLARALFRHSEVGQHIPATLYAAVAEVLAWVYQLK 351


>gi|172057870|ref|YP_001814330.1| flagellar biosynthesis protein FlhB [Exiguobacterium sibiricum
           255-15]
 gi|171990391|gb|ACB61313.1| flagellar biosynthetic protein FlhB [Exiguobacterium sibiricum
           255-15]
          Length = 363

 Score =  159 bits (403), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 106/356 (29%), Positives = 192/356 (53%), Gaps = 22/356 (6%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYL-LFFFSP--G---IYSVTSDL 62
            KTE  S +K +D+  +G   +++ A L SS++   ++L LFFF P  G   +  + + L
Sbjct: 16  EKTEKASPRKRDDSRKKGQ--VAKSADLTSSLMLFGMFLILFFFGPFLGKRFVMVLENGL 73

Query: 63  --HVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
               +L +  + +++++  ++ +L  + +    LV P  +  ++ GI    +Q   +L+ 
Sbjct: 74  SAQTVLVAVEEGRIQEV--MIEMLVQMGI----LVAPFFVTAVVIGILGNFVQIGALLST 127

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFIS-- 178
             ++P   R++  +GIKRI S+  L+ F+KS  K++++G      L  N   +    S  
Sbjct: 128 ESIQPKLDRINPLQGIKRIVSMKALIEFLKSVFKLLVIGATSGTVLWNNKVEISRLTSEP 187

Query: 179 -ANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSY 237
             +  +I+ H  F +    I + + +  L VLD  +    +   ++MSKQ++KDE K + 
Sbjct: 188 IGDALAIIGHLTFLLG---ISVSIALIVLAVLDFAYQKFDFEKSIRMSKQDLKDEHKNTE 244

Query: 238 GNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQN 297
           G+P IK + K   R     +MM+    A ++ITNPTHYA+A++Y   ++ AP++VAKG +
Sbjct: 245 GDPQIKGKIKQQQREMAMRRMMQEIPNADVVITNPTHYAVAIQYDDGKHAAPIVVAKGVD 304

Query: 298 LIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            +A ++R+ A    IPI E   LAR+LF +  I  A+   FY+A+A+ +  +Y  K
Sbjct: 305 AVAFRIREKATAAEIPIIENRPLARALFAKSEIGMAVDESFYQALAETLAFVYQMK 360


>gi|268678882|ref|YP_003303313.1| flagellar biosynthetic protein FlhB [Sulfurospirillum deleyianum
           DSM 6946]
 gi|268616913|gb|ACZ11278.1| flagellar biosynthetic protein FlhB [Sulfurospirillum deleyianum
           DSM 6946]
          Length = 353

 Score =  159 bits (402), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 116/354 (32%), Positives = 191/354 (53%), Gaps = 26/354 (7%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSIL----ACLIYLLFFFSPGIYSVTSDLHV 64
            KTE  +SKKIEDA  EGN P S++ S F +++    A L +L F  S  IY +      
Sbjct: 6   EKTEEATSKKIEDARKEGNVPKSQDMSAFVTLVVALGAFLAWLSFIESRIIY-LYHYYQS 64

Query: 65  LLASATQRKLEDISHIVFLLTHLSL-SASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
           L+ +      E    + F ++ +SL     +VIP  L   + GI + ++Q   +     +
Sbjct: 65  LIGT------EITKEVTFQISLISLREVVFMVIPLALAVAIAGILANVMQTGFLFTTKPL 118

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
            P+F ++   +G K ++S+  L+  +K+ +K+ +V  I       +YF +  F    P  
Sbjct: 119 MPNFGKLDPIKGFKNLFSLKKLIETVKTLLKVSVVMGI-------SYFFLWSFTKELPTV 171

Query: 184 ILY-----HAFFTVR--KVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQS 236
           I +      A+   +   +  +IL+ +  L + D+      ++ +L+MSKQE+KDE KQ 
Sbjct: 172 IYFPLPDQMAWLKEKMLILAAVILIILLVLALADLMLVRFNYFKELRMSKQEVKDEYKQM 231

Query: 237 YGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQ 296
            G+P IK + + I     R +MM+    A ++ITNPTHYA+A+RY Q +  AP ++AKG 
Sbjct: 232 EGDPKIKAKIRQIQMQMTRKRMMQEIPGADVVITNPTHYAVAIRYHQDKEAAPKVIAKGT 291

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           +L+A ++++IA  H+I I E P LAR L+K+  I   IP   YKAVA+++  +Y
Sbjct: 292 DLVALRIKEIALNHHIQIVENPPLARELYKKCNIGELIPENLYKAVAEVLAFVY 345


>gi|188991600|ref|YP_001903610.1| flagellar biosynthesis protein FlhB [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167733360|emb|CAP51561.1| unnamed protein product [Xanthomonas campestris pv. campestris]
          Length = 376

 Score =  159 bits (402), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 92/351 (26%), Positives = 177/351 (50%), Gaps = 1/351 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE++    +TE P+ K++ +A  +GN P SRE S  +++    ++ L   + GI    S
Sbjct: 1   MSESEDGGERTELPTEKRLREAREQGNIPQSRELST-AAVFGTGVFALMLMARGIGDGAS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
                  S   +  E+   +      L L    +++P + + +  G+   L+      + 
Sbjct: 60  VWMKTALSPDPKMRENPMALFGHFGDLLLQLLWVMVPLIGICLAAGLVGPLLMSGLHFSG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   +++   GIKR++  N+L   +KS ++++ VG   ++ +++    +   ++  
Sbjct: 120 KAIMPDLNKLNPMNGIKRMWGSNSLAELVKSILRLLFVGLAASLCISKGLHGLRSLVNQP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + +     + +L      +  L   D  +    W  KLKM+++EIK E+K+S G+P
Sbjct: 180 LEQAVGNGLDFTKSLLFYTAGALVLLAAFDAPYQKWNWLRKLKMTREEIKREMKESEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + +     + +MMEA   A +++ NPTHYA+AL+Y   +  APV+VAKG + +A
Sbjct: 240 EVKGRIRQMQMQMSQRRMMEALPTADVVLMNPTHYAVALKYEGGKMRAPVVVAKGVDEMA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            ++R+   +H + I   P LAR+L+++  +   IP   Y  VAQ++  +Y 
Sbjct: 300 FRIREACEQHRVAIVTAPPLARALYREAQLGKEIPVRLYSVVAQVLSYVYQ 350


>gi|212709483|ref|ZP_03317611.1| hypothetical protein PROVALCAL_00525 [Providencia alcalifaciens DSM
           30120]
 gi|212687821|gb|EEB47349.1| hypothetical protein PROVALCAL_00525 [Providencia alcalifaciens DSM
           30120]
          Length = 383

 Score =  159 bits (402), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 111/366 (30%), Positives = 180/366 (49%), Gaps = 36/366 (9%)

Query: 4   NDAPD-NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLL-------------- 48
           +D  D  KTE P+  K + A ++G    S+E S    +LA +  L               
Sbjct: 2   SDESDVEKTEEPTPHKKQKAKDDGQIVRSKELSSLMMMLAGVSLLWLSGGHLATQLRQIM 61

Query: 49  ---FFFSPGIYSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMF 105
              F F       T  +   L       L  +  I+  L  + +SAS LV  G LLF   
Sbjct: 62  RQGFIFDGHYLQNTGLMLSYLGRVVSEALFALLPIIGGLALVGISASSLV--GGLLF--- 116

Query: 106 GIGSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITIS 165
                        N   +K   K+++  +G+KRI+S+N L    K+ +K + VG   +I 
Sbjct: 117 -------------NSKLIKFDLKKLNPIKGLKRIFSMNALSELFKAILKCVFVGLGASIF 163

Query: 166 LTENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMS 225
           L +++ ++L  +   P + L +A   V     +I+  +  +   D+ + +     KL+MS
Sbjct: 164 LWQSWPSLLHLVMEPPTTALANALEKVIFAGYLIVFLLIPMVAFDVFYQFRSHLKKLRMS 223

Query: 226 KQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTE 285
           +QEIKDE KQ  G+P IK + +   R+  R++MM     A +I+TNPTHYA+AL+Y   +
Sbjct: 224 RQEIKDEFKQQEGDPHIKAKIRQQQRAIARNRMMADVPSADVIVTNPTHYAVALKYDDKK 283

Query: 286 NDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQL 345
             AP ++AKG  +IA+++++I  EH I   E P LAR+L++   I  +IP   Y AVA++
Sbjct: 284 MGAPKVLAKGAGVIAQRIKEIGAEHRILQLEAPPLARALYRHAEIGQSIPVALYAAVAEV 343

Query: 346 IYKIYH 351
           +  +Y 
Sbjct: 344 LAWVYQ 349


>gi|2494575|sp|Q56886|FLHB_YEREN RecName: Full=Flagellar biosynthetic protein flhB
 gi|793892|emb|CAA88185.1| flhB [Yersinia enterocolitica]
          Length = 383

 Score =  159 bits (402), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 108/356 (30%), Positives = 185/356 (51%), Gaps = 13/356 (3%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+  +K+E P++ K+E A  +G  P SRE    +S+L     L   +  G  S+   L 
Sbjct: 3   EDSDADKSEEPTAHKLEKAREKGQIPRSRE---LTSMLMLGAGLAILWVSG-ESMARQLA 58

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVL----- 118
            ++A         IS    +L  + +   + +I  + +F    I   +   +P+L     
Sbjct: 59  AMIAQGLHFDHGLISDDKQMLRQIGMLLRQTLIGLIPIFAGLVI---VAMAVPMLLGGVL 115

Query: 119 -NLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFI 177
            +   +K   KR+S   G+KR++S   L   +K+ +K  LVG +  I L  N+  M+  +
Sbjct: 116 FSGESIKFDLKRMSPIAGLKRMFSSQALAELLKAILKATLVGWVTGIFLWHNWPDMMRLM 175

Query: 178 SANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSY 237
           +A P + L  A   +    ++++L +  +   D+ +       KL+M+KQEI+DE K   
Sbjct: 176 AAPPVAALGDALHLIIFCGLVVVLGLTPMVGFDVFFQITSHIKKLRMTKQEIRDEFKDQE 235

Query: 238 GNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQN 297
           G+P +K R +   R+  R +MM    +A +I+TNPTHYA+AL+Y +T+  AP ++AKG  
Sbjct: 236 GDPHVKGRIRQQQRAMARRRMMADVHKADVIVTNPTHYAVALQYNETKMSAPKVLAKGAG 295

Query: 298 LIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            +A ++R++  EH IP+ E P LAR+LF+   +   IP   Y AVA+++  +Y  K
Sbjct: 296 AVALRIRELGAEHRIPLLEAPPLARALFRHSEVGQHIPATLYAAVAEVLAWVYQLK 351


>gi|158320532|ref|YP_001513039.1| flagellar biosynthetic protein FlhB [Alkaliphilus oremlandii
           OhILAs]
 gi|158140731|gb|ABW19043.1| flagellar biosynthetic protein FlhB [Alkaliphilus oremlandii
           OhILAs]
          Length = 362

 Score =  159 bits (402), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 110/361 (30%), Positives = 189/361 (52%), Gaps = 33/361 (9%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIY---LLFFFSPGIYSVTSDLHV 64
           + KTE  + KKI+DA  +GN   S+E +    +LA  I       F    + ++T  ++ 
Sbjct: 12  EEKTEQATPKKIKDAREKGNVLQSKEVNSALILLAIFIIINAFATFIGVSLLNMTRAVYT 71

Query: 65  LLASATQRKLEDISHIVFLLTHLSLSASRLVI-------PGLLLFMMFG-------IGSY 110
              SA         +I F + +L + + +L+I       P  L  ++ G       +G  
Sbjct: 72  EFLSA---------NIAFSVKNLQILSIKLMIYFFIAVGPIALTSLVVGLISSYAQVGVL 122

Query: 111 LIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENY 170
           L  +  + +LN + P        EG K+++S+ ++V  +K+F+++ ++G I    +    
Sbjct: 123 LTSKPLMFDLNKINPI-------EGFKKMFSMRSVVELLKAFIRLGVIGYISYDYVKGQV 175

Query: 171 FTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIK 230
             +L+    +  SIL         + I   + +  L VLD  +  +++   LKMSKQEIK
Sbjct: 176 GVILETTGMDISSILKAIMSMTVDIGIKAGIALIALAVLDYYYQRYEYNKNLKMSKQEIK 235

Query: 231 DEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPV 290
           +E KQ+ GNP IK++ K   R     +MM+    A +IITNPTH+A+ ++Y   E DAP 
Sbjct: 236 EEYKQTEGNPQIKSKIKEKQRQMAMRRMMQDVPSADVIITNPTHFAIGIKYDLNEFDAPK 295

Query: 291 LVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           ++AKGQ+LIA+ ++KIA E+N+ + E   LAR+L+  V +   +PP  Y+AVA+++  +Y
Sbjct: 296 VIAKGQDLIAQNIKKIALENNVTVVENKPLARALYDSVEVGQFVPPDLYQAVAEVLAYVY 355

Query: 351 H 351
            
Sbjct: 356 R 356


>gi|21231358|ref|NP_637275.1| flagellar biosynthesis protein FlhB [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66768589|ref|YP_243351.1| flagellar biosynthesis protein FlhB [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|21113019|gb|AAM41199.1| flagellar protein [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66573921|gb|AAY49331.1| flagellar protein [Xanthomonas campestris pv. campestris str. 8004]
          Length = 376

 Score =  159 bits (402), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 92/351 (26%), Positives = 177/351 (50%), Gaps = 1/351 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE++    +TE P+ K++ +A  +GN P SRE S  +++    ++ L   + GI    S
Sbjct: 1   MSESEDGGERTELPTEKRLREAREQGNIPQSRELST-AAVFGTGVFALMLMARGIGDGAS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
                  S   +  E+   +      L L    +++P + + +  G+   L+      + 
Sbjct: 60  VWMKTALSPDPKMRENPMALFGHFGDLLLQLLWVMVPLIGICLAAGLVGPLLMSGLHFSG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   +++   GIKR++  N+L   +KS ++++ VG   ++ +++    +   ++  
Sbjct: 120 KAIMPDLNKLNPMNGIKRMWGSNSLAELVKSILRLLFVGLAASLCISKGLHGLRSLVNRP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + +     + +L      +  L   D  +    W  KLKM+++EIK E+K+S G+P
Sbjct: 180 LEQAVGNGLDFTKSLLFYTAGALVLLAAFDAPYQKWNWLRKLKMTREEIKREMKESEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + +     + +MMEA   A +++ NPTHYA+AL+Y   +  APV+VAKG + +A
Sbjct: 240 EVKGRIRQMQMQMSQRRMMEALPTADVVLMNPTHYAVALKYEGGKMRAPVVVAKGVDEMA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            ++R+   +H + I   P LAR+L+++  +   IP   Y  VAQ++  +Y 
Sbjct: 300 FRIREACEQHRVAIVTAPPLARALYREAQLGKEIPVRLYSVVAQVLSYVYQ 350


>gi|220903612|ref|YP_002478924.1| flagellar biosynthesis protein FlhB [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
 gi|219867911|gb|ACL48246.1| flagellar biosynthetic protein FlhB [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
          Length = 359

 Score =  159 bits (401), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 112/354 (31%), Positives = 186/354 (52%), Gaps = 18/354 (5%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
           +KTE  + K+I     EGN P S+E     S+L  +  L  +  P   ++       L+ 
Sbjct: 9   SKTEEATPKRIRKQRGEGNVPKSQELGKAVSLLGGMSILYAWIGPMSEAIKKLFRHFLSH 68

Query: 69  ATQRKLEDISHIVFLLT-HLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVK--- 124
           A +   +     V+ LT  L +   ++++P LL      + S L QR+ V  L   K   
Sbjct: 69  AWE--FDPNPENVYSLTLELMIEVCKIIMPILL---TLAVLSMLAQRLQVGKLWTTKVFK 123

Query: 125 PSFKRVSLREGIKR-IYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           P  +R ++ +GIK+ ++S   ++  +KS +  +++ TI    + + Y   L    A    
Sbjct: 124 PKLQRFNIFKGIKQMLFSPQTILRTIKSLLFSLILSTIPAWIIYKEYQNFLPMYYATTEG 183

Query: 184 I----LYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
           +    L  AF  V   LI IL+  A     D+  S + +   +KM+K E+KDE KQ+ G+
Sbjct: 184 VAVYMLQMAFKLVSYALIPILIIAA----FDVWQSRYSYKENMKMTKDEVKDEHKQADGD 239

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLI 299
           P++K++Q+      +  +M++   +A ++ITNPTH A+ALRY  TE  APV++AKG + +
Sbjct: 240 PVVKSQQRKKMMEAMSKRMLQDVPKADVVITNPTHIAVALRYNATEAPAPVVLAKGADHL 299

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A+K+++ A EHN+PI E   LAR+L+K   +   IP   YKAVA ++  I+  K
Sbjct: 300 AEKIKQAAREHNVPIRENVPLARALYKSAEVGDMIPEELYKAVATVLAAIWKLK 353


>gi|187478176|ref|YP_786200.1| flagellar biosynthesis protein FlhB [Bordetella avium 197N]
 gi|115422762|emb|CAJ49290.1| flagellar biosynthetic protein [Bordetella avium 197N]
          Length = 380

 Score =  159 bits (401), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 107/354 (30%), Positives = 184/354 (51%), Gaps = 13/354 (3%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D+   KTEA S +++E A  EG    SRE + F  +LA  +  L+   P +Y   S + 
Sbjct: 3   DDSDLEKTEAASPRRLEKAREEGQIARSRELTTFL-MLAAGVGGLWLVGPSLYRGLSGVM 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIP--GLLLFMMFGIGSYLIQRIPVLNLN 121
                   R   D + +V         A   ++P  G+L+     +GS ++  + V +  
Sbjct: 62  RDGMGFDPRITHDTTAMVNQAVIGFGQAIWAILPVFGILVVAAL-LGSVMLGGL-VFSGK 119

Query: 122 HVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANP 181
            ++    +++   G+KRI+S   LV  +K+  K +LVG +    +   +  ML  +   P
Sbjct: 120 PLEFKASKLNPLSGLKRIFSSQTLVELIKASAKALLVGGVAGWVIWRYHDEMLGLMHVPP 179

Query: 182 HSILYHAFFTVRKVLIMILLFIAT----LTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSY 237
            + L  A     K++++   FI +    + ++D+ W       KL+MSK++++ E K+S 
Sbjct: 180 PAALASAL----KLVVLCCAFIVSSLMLVVLIDVPWQIWSHLKKLRMSKEDVRQEHKESE 235

Query: 238 GNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQN 297
           G+P IK R +   R+  R +MM    RA +++TNPTHYA+AL Y ++   AP ++AKG  
Sbjct: 236 GDPHIKARIRQQQRAAARRRMMSQVPRADVVVTNPTHYAVALSYDESGGGAPTVIAKGTG 295

Query: 298 LIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           L+A ++R++A EH IP  E P LAR+L + V +   IP   Y AVA+++  ++ 
Sbjct: 296 LVAARIRELAAEHRIPTLEAPPLARALHQHVELGHEIPAALYTAVAEVLAWVFQ 349


>gi|15596646|ref|NP_250140.1| flagellar biosynthesis protein FlhB [Pseudomonas aeruginosa PAO1]
 gi|107100883|ref|ZP_01364801.1| hypothetical protein PaerPA_01001913 [Pseudomonas aeruginosa PACS2]
 gi|116049394|ref|YP_791803.1| flagellar biosynthesis protein FlhB [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218892678|ref|YP_002441547.1| flagellar biosynthesis protein FlhB [Pseudomonas aeruginosa LESB58]
 gi|254234548|ref|ZP_04927871.1| flagellar biosynthetic protein FlhB [Pseudomonas aeruginosa C3719]
 gi|254239799|ref|ZP_04933121.1| flagellar biosynthetic protein FlhB [Pseudomonas aeruginosa 2192]
 gi|296390184|ref|ZP_06879659.1| flagellar biosynthesis protein FlhB [Pseudomonas aeruginosa PAb1]
 gi|313106448|ref|ZP_07792679.1| flagellar biosynthetic protein FlhB [Pseudomonas aeruginosa 39016]
 gi|9947400|gb|AAG04838.1|AE004574_9 flagellar biosynthetic protein FlhB [Pseudomonas aeruginosa PAO1]
 gi|115584615|gb|ABJ10630.1| flagellar biosynthetic protein FlhB [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126166479|gb|EAZ51990.1| flagellar biosynthetic protein FlhB [Pseudomonas aeruginosa C3719]
 gi|126193177|gb|EAZ57240.1| flagellar biosynthetic protein FlhB [Pseudomonas aeruginosa 2192]
 gi|218772906|emb|CAW28718.1| flagellar biosynthetic protein FlhB [Pseudomonas aeruginosa LESB58]
 gi|310879181|gb|EFQ37775.1| flagellar biosynthetic protein FlhB [Pseudomonas aeruginosa 39016]
          Length = 378

 Score =  159 bits (401), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 109/363 (30%), Positives = 194/363 (53%), Gaps = 21/363 (5%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+++  +KTE P+ K+  +A  +G  P SRE +  + ++A    LL + +     +  
Sbjct: 1   MAESESGQDKTEEPTEKRRREAREKGQLPRSRELNTLAILMAGAGGLLIYGA----DLAG 56

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSA---SRLVIPGLLLFMMFGIGSYLIQRIPV 117
            L  L+ S  +   E   +   +L  L  SA   ++ + P LL+ ++  I   +     +
Sbjct: 57  ALLRLMRSNFELSRETAMNTESMLQLLGASAYLAAQGLWPILLMLLVAAIVGPIALGGWL 116

Query: 118 LNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFI 177
            +++ ++P F R++   G+KR++S  +L+   K+ +K ++V  +  + L+ +     D +
Sbjct: 117 FSMDALQPKFSRLNPLSGLKRMFSAKSLLELSKALIKFLVVLAVALLVLSADR----DAL 172

Query: 178 SANPHSILYHAFF-TVRKV------LIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIK 230
            A  H  L  A   +VR V      +   LL IA + V    W   Q   KL M+KQE++
Sbjct: 173 LALAHQPLEQAILHSVRVVGWSAFWMACSLLLIAAVDVPYQIWDNRQ---KLLMTKQEVR 229

Query: 231 DEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPV 290
           DE K S G P +K++ + + R   + +MM A   A ++ITNPTH+A+AL+Y      AP+
Sbjct: 230 DEYKDSEGKPEVKSKIRQMQREMAQRRMMAAVPEADVVITNPTHFAVALKYDPAGGGAPL 289

Query: 291 LVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           L+AKG + +A K+R++A EH + + E P+LAR+++    ++  IP   Y AVAQ++  +Y
Sbjct: 290 LLAKGNDFLALKIREVAQEHKVMVMESPALARAVYYSTELDQEIPAGLYLAVAQVLAYVY 349

Query: 351 HKK 353
             K
Sbjct: 350 QLK 352


>gi|320116065|ref|YP_004186224.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
 gi|319929156|gb|ADV79841.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
          Length = 363

 Score =  159 bits (401), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 106/348 (30%), Positives = 182/348 (52%), Gaps = 2/348 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
           + KTE  + K+ +DA  +G    SRE +    I+A  + +     P +  + +    LL 
Sbjct: 14  EEKTEPATPKRRQDARKKGQVFQSREITSALVIVAGFLAVNILTMPSLEKMMALTKYLLY 73

Query: 68  --SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
             S     + ++  I  L T++   A  +++P +LL  +  + S  +Q   V     +  
Sbjct: 74  TYSGANDDVFNVVGIRNLFTYVLQQAISIIMPIILLIFVVSLASTYLQVGFVFTTEPLAF 133

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
             +R++  EG KRI+S   LV   KS  K+ ++  I+   L   Y  +   +  +   IL
Sbjct: 134 KLERLNPVEGFKRIFSKRALVELAKSIAKVAVLFYIMYSFLASQYKGIPMLLDMSVQDIL 193

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
            +A   +  + I I + +  L  LD  + + ++ + LKMSK++IK+E K++ GNP IK  
Sbjct: 194 KYALNILLGITIRIGIVLIVLGALDYFFQWREYETSLKMSKEDIKEEFKETEGNPQIKAE 253

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
            +   R     +MM+   +A ++ITNPTH A+AL Y    NDAPV++AKGQ++IA ++++
Sbjct: 254 IRRKQRQVSMRRMMQDLKKADVVITNPTHLAVALMYDSNVNDAPVVIAKGQDMIALRIKE 313

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            A +  IPI E   LA++L++   I   IPP  Y+AVA+++  +Y  K
Sbjct: 314 EAKKLTIPIVENKPLAQALYRSTEIGDMIPPELYQAVAEVLAYVYSLK 361


>gi|88800470|ref|ZP_01116034.1| Flagellar biosynthesis pathway, component FlhB [Reinekea sp.
           MED297]
 gi|88776800|gb|EAR08011.1| Flagellar biosynthesis pathway, component FlhB [Reinekea sp.
           MED297]
          Length = 378

 Score =  159 bits (401), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 106/362 (29%), Positives = 185/362 (51%), Gaps = 23/362 (6%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D    KTE P+ +K+E A  +G+   S+E +  + ++   I  L F   G    T+
Sbjct: 1   MAEQDTSQEKTEEPTPRKLEKAKEDGDIARSKELNTSAILIVSAICFLVF---GRMMGTT 57

Query: 61  DLHVL--LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMM------FGIGSYLI 112
            + ++    S   R   D+      ++ ++  A   ++P     ++       G+G +  
Sbjct: 58  MMRIMEFCFSFDPRASWDVIVAGEYVSVVAGEALLSIVPLFGFLLLAALFAPIGLGGW-- 115

Query: 113 QRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGT---IITISLTEN 169
                 +   + P   R++   GIKR++S+N+LV  +K + K+I+V T   ++ ISL   
Sbjct: 116 ----NFSTKALAPKGSRMNPLSGIKRMFSMNSLVELLKGWGKVIVVATAAILVLISLKNE 171

Query: 170 YFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEI 229
           + +M   +     S + HA   +    +++      + ++DI +  +    KL+M+ QEI
Sbjct: 172 FLSM---VFQPTESAITHAVEVIAWSFLLLAASTVLIAIVDIPFQIYSHTKKLRMTMQEI 228

Query: 230 KDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAP 289
           K+E K + G P +K + K + R     +MM     A +IITNPTHYA+AL+Y      AP
Sbjct: 229 KEEYKNTEGKPEVKAKIKQLQREMANRRMMSDVPEADVIITNPTHYAVALKYDPNAMPAP 288

Query: 290 VLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKI 349
           ++VAKG + +A K+R+I  E+++P+ E P+LARS++    I   IP   Y AVAQ++  I
Sbjct: 289 LMVAKGVDEVAFKIREIGQEYDVPVLEMPALARSIYHHTRIGDEIPEGLYVAVAQVLAYI 348

Query: 350 YH 351
           Y 
Sbjct: 349 YQ 350


>gi|300854222|ref|YP_003779206.1| bifunctional flagellar biosynthesis proteins FliR/FlhB [Clostridium
           ljungdahlii DSM 13528]
 gi|300434337|gb|ADK14104.1| fusion of flagellar biosynthesis proteins FliR and FlhB
           [Clostridium ljungdahlii DSM 13528]
          Length = 606

 Score =  159 bits (401), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 102/354 (28%), Positives = 192/354 (54%), Gaps = 14/354 (3%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A D+KTE  + KK  D+  +G    S+E  L  ++LA  + +      G Y  TS    +
Sbjct: 261 AKDDKTEEATPKKKSDSRKKGQIARSKEIGLTMTLLASTLVIAVL---GGYVGTSLGSTM 317

Query: 66  LASA-----TQRKLEDISHIVFL-LTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLN 119
           +A       T      ++ I+F+ +  +++    + +P L +    G+ + ++Q   ++ 
Sbjct: 318 VAFLNDYINTSLNYSSVNKIMFITIWRIAIVFLPIAVPILAI----GVLANMVQTRGLIT 373

Query: 120 LNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISA 179
              +KP F +++   G KR++S  +++  +K    + +VG +    + +NY  +L+    
Sbjct: 374 FETLKPDFSKLNPISGFKRMFSARSVMELLKDTAIVSIVGYVGYKFIKDNYMYILNLGQL 433

Query: 180 NPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
           +  ++          +   I L +  + +LD  +  +Q+   L+MSKQEIK+E KQ  G+
Sbjct: 434 DSRAVAKAIGSLAVGIFFRITLIMLIIAILDYMFQRYQYNKDLRMSKQEIKEEFKQDEGD 493

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLI 299
           P IK +++   R     +MM+   +AT+++TNPTH A+AL+Y + +N APVLVAKG + +
Sbjct: 494 PQIKGKRRQKQRELAMRRMMQEVPKATVVVTNPTHVAVALKYEEGQN-APVLVAKGLDAV 552

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A K+++IA ++++PI E   LAR ++K+V I+  IP   Y+AVA+++  +Y  +
Sbjct: 553 ALKIKEIAKDNDVPIIENRPLARLIYKEVEIDMEIPAEMYQAVAEILALVYKMR 606


>gi|167037650|ref|YP_001665228.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|166856484|gb|ABY94892.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
          Length = 360

 Score =  159 bits (401), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 106/348 (30%), Positives = 182/348 (52%), Gaps = 2/348 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
           + KTE  + K+ +DA  +G    SRE +    I+A  + +     P +  + +    LL 
Sbjct: 11  EEKTEPATPKRRQDARKKGQVFQSREITSALVIVAGFLAVNILTMPSLEKMMALTKYLLY 70

Query: 68  --SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
             S     + ++  I  L T++   A  +++P +LL  +  + S  +Q   V     +  
Sbjct: 71  TYSGANDDVFNVVGIRNLFTYVLQQAISIIMPIILLIFVVSLASTYLQVGFVFTTEPLAF 130

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
             +R++  EG KRI+S   LV   KS  K+ ++  I+   L   Y  +   +  +   IL
Sbjct: 131 KLERLNPVEGFKRIFSKRALVELAKSIAKVAVLFYIMYSFLASQYKGIPMLLDMSVQDIL 190

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
            +A   +  + I I + +  L  LD  + + ++ + LKMSK++IK+E K++ GNP IK  
Sbjct: 191 KYALNILLGITIRIGIVLIVLGALDYFFQWREYETSLKMSKEDIKEEFKETEGNPQIKAE 250

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
            +   R     +MM+   +A ++ITNPTH A+AL Y    NDAPV++AKGQ++IA ++++
Sbjct: 251 IRRKQRQVSMRRMMQDLKKADVVITNPTHLAVALMYDSNVNDAPVVIAKGQDMIALRIKE 310

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            A +  IPI E   LA++L++   I   IPP  Y+AVA+++  +Y  K
Sbjct: 311 EAKKLTIPIVENKPLAQALYRSTEIGDMIPPELYQAVAEVLAYVYSLK 358


>gi|229918645|ref|YP_002887291.1| flagellar biosynthesis protein FlhB [Exiguobacterium sp. AT1b]
 gi|229470074|gb|ACQ71846.1| flagellar biosynthetic protein FlhB [Exiguobacterium sp. AT1b]
          Length = 364

 Score =  158 bits (400), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 107/354 (30%), Positives = 189/354 (53%), Gaps = 19/354 (5%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSI-LACLIYLLFFFSPGI----YSVTSDL- 62
            KTE  + +K ED+  +G   +++ A L  +  L  +  +L FF P I     ++ SDL 
Sbjct: 18  EKTEKATPRKREDSRKKGQ--VAKSADLTGAFALFAMFLMLSFFGPVIGQQLLTLISDLL 75

Query: 63  --HVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
               LL + T         +  ++  L L    ++ P  ++ ++FGI    +Q   + +L
Sbjct: 76  SPEYLLFNVT-------GGMSDMVVDLMLRVGLILAPFFIVAVVFGILINYLQIGTLFSL 128

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDF-ISA 179
             ++P  +R+   +G+KRI S+  +V F+KS  K++++ T     L +N   +    +  
Sbjct: 129 EAIQPKLERIDPIKGVKRIVSMKAVVEFLKSLFKLLIILTTAVAVLWKNQKELSRMAVEQ 188

Query: 180 NPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
              SI+  A  T+   L + +  +A L  LD  +    +   ++MSKQ+IKDE K + G+
Sbjct: 189 VRESIVALASITIELGLWVSVALLA-LAFLDFFYQRFDFEKSIRMSKQDIKDEYKNTEGD 247

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLI 299
           P+IK++ K   R     +MM+    A ++ITNPTHYA+ +RY  T++ AP++VAKG + +
Sbjct: 248 PLIKSKIKQQQREMAMRRMMQEIPNADVVITNPTHYAVVIRYDDTKDFAPLVVAKGVDRV 307

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A  +R +A EH++ I E   LAR+L+ Q+ I   +   FY+A+A+++  +Y  K
Sbjct: 308 AFHIRDVAKEHDVAIVENKPLARALYAQIDIGEVVDESFYQAIAEVLAFVYQMK 361


>gi|170702808|ref|ZP_02893660.1| flagellar biosynthetic protein FlhB [Burkholderia ambifaria
           IOP40-10]
 gi|170132277|gb|EDT00753.1| flagellar biosynthetic protein FlhB [Burkholderia ambifaria
           IOP40-10]
          Length = 399

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 103/357 (28%), Positives = 179/357 (50%), Gaps = 29/357 (8%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSP----------GIYSV 58
           ++TEA + ++ E A  EG    SRE + F+ + A         +P          G ++ 
Sbjct: 8   DRTEAATPRRREKAREEGQVARSRELASFALLAAGFYGAWLLAAPSGAHLQAMLRGAFAF 67

Query: 59  TS----DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQR 114
                 D H +L++A    +E ++ ++ +L    L+A               +G +LI +
Sbjct: 68  DRATAFDTHRMLSAAGSASIEGLAALLPILALTGLAAL---------LAPMALGGWLISQ 118

Query: 115 IPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTML 174
                    +  F R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L
Sbjct: 119 ------KTFELKFDRLNPISGLGRIFSIQGPIQLGMSLAKTLVVGGIGGIAIWRSKDELL 172

Query: 175 DFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIK 234
              +    S L  A   V       +  +  +  LD+ +   Q+  KL+M+K+E+K E +
Sbjct: 173 GLATQPLGSALADAMHLVAVCCGTTVAGMLVVAALDVPYQIWQYNKKLRMTKEEVKREHR 232

Query: 235 QSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAK 294
           ++ G+P +K R +   R+  R +MM A  +A +++TNPTH+A+AL+Y   E  AP +VAK
Sbjct: 233 ENEGDPHVKGRIRQQQRAIARRRMMAAVPKADVVVTNPTHFAVALQYTDGEMRAPKVVAK 292

Query: 295 GQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           G NL+A ++R++A EHN+P+ E P LAR+L+  V I   IP   Y AVA+++  +Y 
Sbjct: 293 GVNLVAARIRELAAEHNVPLLEAPPLARALYHNVEIEREIPGSLYSAVAEVLAWVYQ 349


>gi|168704083|ref|ZP_02736360.1| flagellar biosynthesis protein FlhB [Gemmata obscuriglobus UQM
           2246]
          Length = 355

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 94/346 (27%), Positives = 177/346 (51%), Gaps = 2/346 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+   ++KTE P+ ++ E+A  +G  P S E  + S +L   +  L +  P +++   
Sbjct: 1   MAEDVDQESKTEDPTPRRREEARRQGQVPFSAEL-VGSLVLVAGVLGLRYLGPDLWATMI 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +         R+    +    LL   +L     ++P   L +  G+G+ + Q    LN 
Sbjct: 60  TVFRADLPRVGREEFGTAEAAELLGRTALRMIGAMLPFFGLLLAVGVGASVAQVGFQLNT 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P+  +++   G+ R++S+ ++V  + +  K++ +  +    L      +       
Sbjct: 120 EKLEPNLDKLNPVGGLGRLFSLGSVVRGLLTVAKVLALAGVAYYVLNGRGGLIASIGMGR 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
                  A+  V ++ + +   +A + V D  +  +++   L M+K+E+K E+KQ  G+P
Sbjct: 180 IGEAAPVAWALVMRLALYLAGAVALVAVFDYAYQRYKFEQSLMMTKEELKQELKQEEGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + IAR R + KM+    +AT+++TNPTHYA+ALRY    + APV+VAKG+   A
Sbjct: 240 HVKARVRQIARERTKRKMLSEVPKATVVVTNPTHYAVALRYDSNRDSAPVVVAKGKGAFA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
            ++ K A E  +P+ E P LAR+L   V     IP   ++AVA+++
Sbjct: 300 LRIAKRARESGVPVLERPPLARALH-SVREGQQIPSALFRAVAEVL 344


>gi|330953765|gb|EGH54025.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae Cit 7]
          Length = 378

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 101/351 (28%), Positives = 183/351 (52%), Gaps = 1/351 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+   +KTE P+ KK++D+  +G    S+E +    +L     LL F S  I  + S
Sbjct: 1   MAENENGQDKTEDPTEKKVKDSRADGQIARSKELTTLVVMLMGAGGLLMFGS-DIALMMS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           +L     + ++  L D S++   L    + A  +V+P L+  ++  +   ++    +   
Sbjct: 60  ELMRDNFTISRETLMDQSYMGKALLSSGMHALIVVLPFLIAMLVAALVGPIMLGGWLFAT 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++   G+KR++S + LV  +KSF K ++   +  + L      ++      
Sbjct: 120 KSLMPKFSRMNPAAGLKRMFSPHALVELLKSFGKFLITLAVALVVLNNERKDLVAIAHEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V      +   +  +   D+ +  ++ + KL M+KQE++DE K S G+P
Sbjct: 180 LEQAMIHSLMVVGWSSFWMACGLIFIAAADVPFVLYEAHKKLLMTKQEVRDEHKNSEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM +   A +IITNPTH+A+AL+Y   +  AP+L+AKG +L+A
Sbjct: 240 EVKQRIRQLQREMSQRRMMASVPEADVIITNPTHFAVALKYDPEQGGAPMLLAKGTDLVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            K+R+I   + I I E  +LARS++    ++  IP   Y AVAQ++  +Y 
Sbjct: 300 LKIREIGAHNEILILESAALARSIYYSTELDQEIPAGLYLAVAQVLAYVYQ 350


>gi|66046670|ref|YP_236511.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           syringae B728a]
 gi|63257377|gb|AAY38473.1| Flagellar biosynthetic protein FlhB [Pseudomonas syringae pv.
           syringae B728a]
 gi|330899444|gb|EGH30863.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           japonica str. M301072PT]
          Length = 378

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 101/351 (28%), Positives = 183/351 (52%), Gaps = 1/351 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+   +KTE P+ KK++D+  +G    S+E +    +L     LL F S  I  + S
Sbjct: 1   MAENENGQDKTEDPTEKKVKDSRADGQIARSKELTTLVVMLMGAGGLLMFGS-DIALMMS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           +L     + ++  L D S++   L    + A  +V+P L+  ++  +   ++    +   
Sbjct: 60  ELMRDNFTISRETLMDQSYMGKALLSSGMHALVVVLPFLIAMLVAALVGPIMLGGWLFAT 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++   G+KR++S + LV  +KSF K ++   +  + L      ++      
Sbjct: 120 KSLMPKFSRMNPAAGLKRMFSPHALVELLKSFGKFLITLAVALVVLNNERKDLVAIAHEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V      +   +  +   D+ +  ++ + KL M+KQE++DE K S G+P
Sbjct: 180 LEQAMIHSLVVVGWSSFWMACGLIFIAAADVPFVLYEAHKKLLMTKQEVRDEHKNSEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM +   A +IITNPTH+A+AL+Y   +  AP+L+AKG +L+A
Sbjct: 240 EVKQRIRQLQREMSQRRMMASVPEADVIITNPTHFAVALKYDPEQGGAPMLLAKGTDLVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            K+R+I   + I I E  +LARS++    ++  IP   Y AVAQ++  +Y 
Sbjct: 300 LKIREIGAHNEILILESAALARSIYYSTELDQEIPAGLYLAVAQVLAYVYQ 350


>gi|268589991|ref|ZP_06124212.1| flagellar biosynthetic protein FlhB [Providencia rettgeri DSM 1131]
 gi|291314710|gb|EFE55163.1| flagellar biosynthetic protein FlhB [Providencia rettgeri DSM 1131]
          Length = 383

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 110/354 (31%), Positives = 187/354 (52%), Gaps = 12/354 (3%)

Query: 4   NDAPD-NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPG-----IYS 57
           +D  D  KTE P+  K + A ++G    S+E S    +LA +   L + S G     +  
Sbjct: 2   SDESDVEKTEEPTPHKKQKAKDDGQIVRSKELSSLMMMLAGVS--LLWLSGGHLAAQLRQ 59

Query: 58  VTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPV 117
           +T    +      Q     IS++  +++  +L A   VI GL L    GI +  +    V
Sbjct: 60  ITRQGFIFDGHYLQNTGLMISYLGRVVSE-ALFALLPVIGGLALV---GISASSLVGGLV 115

Query: 118 LNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFI 177
            N   +K   K+++  +G+KRI+S+N L    K+ +K + VG    I L +++ ++L  +
Sbjct: 116 FNSKLIKFDLKKLNPIKGLKRIFSMNALSELFKAVLKSLFVGLGAFIFLWQSWPSLLHLV 175

Query: 178 SANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSY 237
             +P + L +A   V     +I+  +  +   D+ + +     KL+MS+QEIKDE KQ  
Sbjct: 176 MESPVTALSNALQKVIFAGYLIVFLLIPMVAFDVFYQFRSHLKKLRMSRQEIKDEFKQQE 235

Query: 238 GNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQN 297
           G+P IK + +   R+  R++MM     A +I+TNPTHYA+AL+Y   +  AP ++AKG  
Sbjct: 236 GDPQIKAKIRQQQRAIARNRMMADVPNADVIVTNPTHYAVALKYDDKKMGAPKVLAKGAG 295

Query: 298 LIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           ++A+++++I  EH I   E P LAR+L++   I  +IP   Y AVA+++  +Y 
Sbjct: 296 VLAQRIKEIGEEHRILQLEAPPLARALYRHAEIGQSIPVALYAAVAEVLAWVYQ 349


>gi|150020741|ref|YP_001306095.1| flagellar biosynthetic protein FlhB [Thermosipho melanesiensis
           BI429]
 gi|149793262|gb|ABR30710.1| flagellar biosynthetic protein FlhB [Thermosipho melanesiensis
           BI429]
          Length = 377

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 111/356 (31%), Positives = 193/356 (54%), Gaps = 17/356 (4%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A  +KTE  + ++ + A  EG  PISRE +   + LA ++   F     I  + S +   
Sbjct: 29  ADPDKTEKATPRRRQKAREEGQVPISRELTSGFTFLAAVLGFAFLGRGIILGLESAVAFF 88

Query: 66  --LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLF----MMFGIGSYLIQRIPVLN 119
             L S     + D+    F       +A + +I  L++F    M+ GI    +Q   +  
Sbjct: 89  AELPSYDTININDLGIYAF-------NAFKGLIIDLVIFVGIIMVTGIAVGSLQTKFLFT 141

Query: 120 LNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFI-- 177
              +K  F +++   G+KR++S+ +L   +KS +K+++VG +  + +  N+  ML  I  
Sbjct: 142 FKSLKLDFSKINPINGLKRMFSLRSLFELLKSILKLVIVGYVGYLVIKSNWNKMLLAIDK 201

Query: 178 SANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSY 237
           S    S+L         +   I LFI  +++ D  +S +++   ++M+KQE+K+E K+  
Sbjct: 202 SVKDGSLLIWDITFELLIKCGIALFI--VSIADYFFSRYEYEKNIRMTKQEVKEEFKEVE 259

Query: 238 GNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQN 297
           GNP IK +Q+ I      H+MM+    AT++ITNPTH+A+A++Y   E + P++VAKG +
Sbjct: 260 GNPEIKRKQREIMMQYSMHRMMQEVPEATVVITNPTHFAVAIKYEVDEMEVPIVVAKGMD 319

Query: 298 LIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            +A+K++K+A E+N+PI   P LAR L+  V +   IP  FY+AVA+++  +Y  K
Sbjct: 320 NLAEKIKKVARENNVPILRNPKLARELYFNVDVGDEIPEKFYRAVAEVLAYVYSLK 375


>gi|161523355|ref|YP_001578367.1| flagellar biosynthesis protein FlhB [Burkholderia multivorans ATCC
           17616]
 gi|189351872|ref|YP_001947500.1| flagellar biosynthesis protein FlhB [Burkholderia multivorans ATCC
           17616]
 gi|160340784|gb|ABX13870.1| flagellar biosynthetic protein FlhB [Burkholderia multivorans ATCC
           17616]
 gi|189335894|dbj|BAG44964.1| flagellar biosynthetic protein [Burkholderia multivorans ATCC
           17616]
          Length = 399

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 101/359 (28%), Positives = 179/359 (49%), Gaps = 29/359 (8%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSP----------GIYSV 58
           ++TEA + ++ E A  EG    SRE + F+ + A         +P          G ++ 
Sbjct: 8   DRTEAATPRRREKAREEGQVARSRELASFALLAAGFYGAWLLAAPSGAHLQAMLRGAFAF 67

Query: 59  TS----DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQR 114
                 D H +L++A    LE ++ ++ +L     +A               +G +LI  
Sbjct: 68  DRATAFDTHRMLSAAGSASLEGLAALLPILALTGAAAL---------LAPMALGGWLI-- 116

Query: 115 IPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTML 174
               +    +  F R++   G+ RI+SI   +    S  K ++VG I  +++  +   +L
Sbjct: 117 ----SPKTFELKFDRLNPVAGLGRIFSIQGPIQLGMSIAKTLVVGGIGGVAIWRSKDELL 172

Query: 175 DFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIK 234
              +    + L  A   V       +  +  +  LD+ +   Q+  KL+M+K+E+K E +
Sbjct: 173 GLATQPLDTALVDALHLVAVCCGTTVAGMLVVAALDVPYQLWQYNKKLRMTKEEVKREHR 232

Query: 235 QSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAK 294
           ++ G+P +K R +   R+  R +MM A  +A +++TNPTH+A+AL+Y   E  AP +VAK
Sbjct: 233 ENEGDPHVKGRIRQQQRAIARRRMMAAVPKADVVVTNPTHFAVALQYADGEMRAPKVVAK 292

Query: 295 GQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           G NL+A ++R++A EHN+P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 293 GVNLVAARIRELAAEHNVPLLEAPPLARALYHNVELEREIPGALYSAVAEVLAWVYQLK 351


>gi|311105926|ref|YP_003978779.1| flagellar biosynthetic protein FlhB [Achromobacter xylosoxidans A8]
 gi|310760615|gb|ADP16064.1| flagellar biosynthetic protein FlhB [Achromobacter xylosoxidans A8]
          Length = 384

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 102/343 (29%), Positives = 177/343 (51%), Gaps = 1/343 (0%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTEA S +++E A  EG    SRE   F  +LA  +  ++     +Y   + +      
Sbjct: 8   EKTEAASPRRLEKAREEGQIARSRELGTFM-MLAAGVGAIWAGGSSLYRTLTGVLRNGLG 66

Query: 69  ATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFK 128
             QR + D   +V         A  +++P   L  +  + S ++    V++   ++ +F 
Sbjct: 67  FDQRIVADPGVMVERAVEGFGQALLVLLPIFGLLAVIAVLSSVLLGGLVISGKPLQFNFS 126

Query: 129 RVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHA 188
           ++S   G+KR++S   +V  +K+  K +LVG +    +   +  ML  +   P + L  A
Sbjct: 127 KLSPISGVKRMFSSQTVVELIKALAKALLVGGVAVWVIWRYHDDMLSLMHVAPSAALVKA 186

Query: 189 FFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKS 248
              V      I+  +  + +LD+ W       KL+MSK++++ E K+S G+P +K R + 
Sbjct: 187 LTLVAMCCAFIVASLIVIVMLDVPWQIWSHLKKLRMSKEDVRQEHKESEGDPHVKARIRQ 246

Query: 249 IARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAY 308
             R   R +MM    +A +++TNPTHYA+AL+Y + ++ AP ++AKG  LIA K+R++A 
Sbjct: 247 QQRQAARRRMMSEVPKADVVVTNPTHYAVALKYDEEKSGAPRVLAKGTGLIAAKIRELAA 306

Query: 309 EHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           E+ IP  E P LAR+L + V I   IP   Y AVA+++  ++ 
Sbjct: 307 ENRIPTLEAPPLARALHQHVEIGQEIPAELYTAVAEVLAWVFQ 349


>gi|330502779|ref|YP_004379648.1| flagellar biosynthesis protein FlhB [Pseudomonas mendocina NK-01]
 gi|328917065|gb|AEB57896.1| flagellar biosynthesis protein FlhB [Pseudomonas mendocina NK-01]
          Length = 378

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 102/362 (28%), Positives = 193/362 (53%), Gaps = 23/362 (6%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+++  +K+E P+ K++E++  +G    S+E +  +  L   + L+ F   G Y    
Sbjct: 1   MAESESGADKSEEPTGKRLEESRKKGQIARSKELNTLAVTLTGTVALIIF---GAYMGNV 57

Query: 61  DLHVLLASATQRK---LEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPV 117
            + ++  + +  +   + + S  ++LL      A   V P LL  ++  +   +     +
Sbjct: 58  LMDIMRGNFSLPREVLMSERSMALYLLAS-GKEALLAVQPFLLALLIASVAGPIALGGWL 116

Query: 118 LNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVK--IILVGTIITISLTENYFTMLD 175
            +   ++P   R++   G+KR++S+  LV  +K+  K  +IL   ++ +++ ++    + 
Sbjct: 117 FSAEALQPKASRMNPLAGLKRMFSVQALVELVKALAKFLVILAVALVVLAIDQDDLLAIA 176

Query: 176 FISANP---HS---ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEI 229
                P   HS   + + AF+     L   L+ IA + V    WS+ Q   KL M+KQE+
Sbjct: 177 NEPVEPAILHSLRVVGWSAFW-----LSCGLILIAAVDVPFQLWSHKQ---KLMMTKQEV 228

Query: 230 KDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAP 289
           +DE K + G P +K R + + R     +MM+A  +A ++ITNPTH+A+AL+Y   +  AP
Sbjct: 229 RDEYKDTEGKPEVKGRIRQLQREMAERRMMQAVPQADVVITNPTHFAVALKYDPEKGGAP 288

Query: 290 VLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKI 349
           +L+AKG + +A K+R+IA EH + + E P+LAR+++    ++  IP   Y AVAQ++  +
Sbjct: 289 MLLAKGGDFLALKIREIAQEHQVMVLESPALARAVYYSTELDQEIPAGLYLAVAQVLAYV 348

Query: 350 YH 351
           Y 
Sbjct: 349 YQ 350


>gi|269138573|ref|YP_003295273.1| flagellar biosynthetic protein [Edwardsiella tarda EIB202]
 gi|267984233|gb|ACY84062.1| flagellar biosynthetic protein [Edwardsiella tarda EIB202]
 gi|304558582|gb|ADM41246.1| Flagellar biosynthesis protein FlhB [Edwardsiella tarda FL6-60]
          Length = 440

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 111/350 (31%), Positives = 177/350 (50%), Gaps = 11/350 (3%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE P+  +IE A  +G  P SRE    +SIL     L      G Y +   L V++A 
Sbjct: 60  EKTEDPTPHRIEKAREKGQIPRSRE---LTSILMLATGLAILLLGGEY-LARALAVMIAQ 115

Query: 69  ATQRK---LEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
                   L +   ++  L  L   A   ++P LL  M+ G  + ++    + + + +K 
Sbjct: 116 GLHFDHLLLSNDRQMLIQLGMLLQQAVAALMPVLLGLMLVGWCAPMLIGGFLFSPSSIKC 175

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
              R++   G KR++S   L   +K  +K  LVG +    L   +  ML  I+      +
Sbjct: 176 DLNRLNPLSGFKRMFSSQVLAELLKGILKATLVGWVCGWFLLHYWPRMLRLITEPTLDAM 235

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQW--YSKLKMSKQEIKDEIKQSYGNPIIK 243
             A   V    ++++L +  +   D+   Y  W   SKL+M+KQEIKDE K+  G+P +K
Sbjct: 236 GDALHLVGMCGLLVVLGLLPMVGFDV--FYQVWSNLSKLRMTKQEIKDEFKEQEGDPHVK 293

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R +   R+  R +MM    +A +I+TNPTHYA+AL+Y + +  AP ++AKG   IA+++
Sbjct: 294 GRIRQQQRAAARRRMMSDVPKADVIVTNPTHYAVALQYQENKMSAPKVLAKGAGEIAQRI 353

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           + +  EH IP  E P LAR+L++   I  AIP   Y AVA+++  +Y  K
Sbjct: 354 KALGAEHRIPQLEAPPLARALYRHSEIGQAIPATLYAAVAEVLAWVYQLK 403


>gi|221202387|ref|ZP_03575420.1| flagellar biosynthetic protein FlhB [Burkholderia multivorans
           CGD2M]
 gi|221208974|ref|ZP_03581970.1| flagellar biosynthetic protein FlhB [Burkholderia multivorans CGD2]
 gi|221171096|gb|EEE03547.1| flagellar biosynthetic protein FlhB [Burkholderia multivorans CGD2]
 gi|221177801|gb|EEE10215.1| flagellar biosynthetic protein FlhB [Burkholderia multivorans
           CGD2M]
          Length = 399

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 101/359 (28%), Positives = 178/359 (49%), Gaps = 29/359 (8%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSP----------GIYSV 58
           ++TEA + ++ E A  EG    SRE + F+ + A          P          G ++ 
Sbjct: 8   DRTEAATPRRREKAREEGQVARSRELASFALLAAGFYGAWLLAGPAGAHLQAMLRGAFAF 67

Query: 59  TS----DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQR 114
                 D H +L++A    LE ++ ++ +L     +A               +G +LI  
Sbjct: 68  DRATAFDTHRMLSAAGSASLEGLAALLPILALTGAAAL---------LAPMALGGWLI-- 116

Query: 115 IPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTML 174
               +    +  F R++   G+ RI+SI   +    S  K ++VG I  +++  +   +L
Sbjct: 117 ----SPKTFELKFDRLNPVAGLGRIFSIQGPIQLGMSIAKTLVVGGIGGVAIWRSKDELL 172

Query: 175 DFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIK 234
              +    + L  A   V       +  +  +  LD+ +   Q+  KL+M+K+E+K E +
Sbjct: 173 GLATQPLDTALVDALHLVAVCCGTTVAGMLVVAALDVPYQLWQYNKKLRMTKEEVKREHR 232

Query: 235 QSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAK 294
           ++ G+P +K R +   R+  R +MM A  +A +++TNPTH+A+AL+Y   E  AP +VAK
Sbjct: 233 ENEGDPHVKGRIRQQQRAIARRRMMAAVPKADVVVTNPTHFAVALQYADGEMRAPKVVAK 292

Query: 295 GQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           G NL+A ++R++A EHN+P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 293 GVNLVAARIRELAAEHNVPLLEAPPLARALYHNVELEREIPGALYSAVAEVLAWVYQLK 351


>gi|188533614|ref|YP_001907411.1| Flagellar biosynthesis protein FlhB [Erwinia tasmaniensis Et1/99]
 gi|188028656|emb|CAO96518.1| Flagellar biosynthesis protein FlhB [Erwinia tasmaniensis Et1/99]
          Length = 383

 Score =  158 bits (399), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 99/351 (28%), Positives = 186/351 (52%), Gaps = 7/351 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+   KTE+P++ ++E A  EG  P SRE    +SIL  +  L   +  G + +   L 
Sbjct: 3   QDSDQEKTESPTAHRLEKAREEGQIPRSRE---LTSILMLIAGLSILWGGGEW-MGRKLG 58

Query: 64  VLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            LLA         + D S ++  + +L   A   V+P +   ++  I + ++    VL+ 
Sbjct: 59  ALLADGLVFNHSMVSDTSQMLRQIANLLQQAVLAVLPMMFGLVVVAIAAPMLLGGLVLSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K    +++  +G+ ++ S  +    +K+ +K  LV  +  + +  ++  ML  ++ +
Sbjct: 119 KAIKFDLGKMNPIKGLAKLVSAQSAAELLKAVLKATLVSIVCGLYIWHHWAEMLRLMAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + L  A   +    I+++L ++ +   D+ +    ++  L+MS Q+I+DE KQ  G+P
Sbjct: 179 PITALAGAMNMIAMCCILVVLGLSPMVGFDVFFQLFSYFKNLRMSHQDIRDEHKQQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A +I+TNPTHY++AL+Y + +  AP ++AKG   IA
Sbjct: 239 HVKGRIRQQMRAAARRRMMADVPKADVIVTNPTHYSVALQYDENKMSAPKVLAKGAGEIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            ++R++  E+ IPI E P LAR+L++   I   IP   Y AVA+++  ++ 
Sbjct: 299 LRIRELGAENRIPILEAPPLARALYRHSEIGQHIPGTLYAAVAEVLAWVWQ 349


>gi|330445379|ref|ZP_08309031.1| flagellar biosynthetic protein FlhB [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328489570|dbj|GAA03528.1| flagellar biosynthetic protein FlhB [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 376

 Score =  158 bits (399), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 100/359 (27%), Positives = 196/359 (54%), Gaps = 14/359 (3%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS++D  + +TE  + +++E A  +G  P SRE +  + +++  + L++F   G+     
Sbjct: 1   MSDSDGQE-RTEDATPRRLEQAREKGQVPRSRELASVAVLVSGAVGLMWF-GEGLSKALG 58

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFG--IGSYLIQRIPVL 118
            +   + S T+  + D+  + F++   ++    L +  +L+F+ F   IG+  +  +   
Sbjct: 59  QIMTAMFSLTREDIFDLDRL-FVIIFDAIVHILLPLALVLIFLFFAAFIGAAGVGGVR-F 116

Query: 119 NLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTI---ITISLTENYFTM-L 174
           +     P F +++   GIKR++ + + V  +KS +K+ LVG++   +  S  E++F + +
Sbjct: 117 SPQAAMPKFSKMNPISGIKRMFGMQSWVELIKSILKVGLVGSVACYLIYSSLEDFFQLSI 176

Query: 175 DFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIK 234
           +   AN     +HA   +   +++I   +  +  +D+ +    +  +LKM+KQEIKDE K
Sbjct: 177 EVFPAN----YFHALDILLNFVLLICCSLLIVVAIDVPFQIWNFNQQLKMTKQEIKDEYK 232

Query: 235 QSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAK 294
            S G P +K R + + R   + +MM    +A ++ITNP H+++ALRY    + APV++AK
Sbjct: 233 DSEGKPEVKGRIRMLQREMAQRRMMADVPQADVVITNPEHFSVALRYDPKLDSAPVVIAK 292

Query: 295 GQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           G + +A K+R++A +HNI I     LAR+++    +   IP   + AVAQ++  ++  K
Sbjct: 293 GGDHLALKIREVANKHNIDIVPAAPLARAIYYTTELEQQIPDGLFVAVAQVLAYVFQLK 351


>gi|307720616|ref|YP_003891756.1| flagellar biosynthetic protein FlhB [Sulfurimonas autotrophica DSM
           16294]
 gi|306978709|gb|ADN08744.1| flagellar biosynthetic protein FlhB [Sulfurimonas autotrophica DSM
           16294]
          Length = 350

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 113/356 (31%), Positives = 189/356 (53%), Gaps = 30/356 (8%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREAS----LFSSILACLIYLLFFFSPGIYSVTSDLHV 64
            KTE P+ KKIEDA  EGN P S++AS    LF +IL  L+   F     I+       +
Sbjct: 6   EKTEEPTPKKIEDARKEGNVPKSQDASGVLTLFVAILGVLMLFPFMAEHMIHLFRYYFSL 65

Query: 65  LLASATQRKLEDISHIV---FLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLN 121
           +     +    DI+ +    FLL  L L A+ + I G++        + L Q   +    
Sbjct: 66  IGMPVDKLFAMDIAIVTIKEFLLMVLPL-ATAVAISGVI--------AALAQFGFLFTTK 116

Query: 122 HVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANP 181
            + P FK++   +G K ++S+  L+  +K  +K     +  T+ +   +F    FI   P
Sbjct: 117 AIMPDFKKIDPIKGTKNLFSLKKLIEGVKVTLK-----SFTTLGVGFIFF--FYFIQELP 169

Query: 182 HSILY--HAFFTVRKVLIMILLFIATLTVLDIGWSY-----HQWYSKLKMSKQEIKDEIK 234
              L+  H      K  ++I+ F+    +             Q++  LKMSKQEIKDE+K
Sbjct: 170 TVALFGLHDQLMWLKDKMIIIAFVMLFIIFIFAIIDVIIVRKQYFDGLKMSKQEIKDEMK 229

Query: 235 QSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAK 294
              G+P+IK++ + I     + +MM     A ++ITNPTHYA+A++Y ++++ AP++VAK
Sbjct: 230 NMEGDPLIKSKIRQIQMEASKKRMMAEVPNADVVITNPTHYAVAIKYDESKSHAPLVVAK 289

Query: 295 GQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           G + IA++++KIA E+++ I + P LARSL+K+V ++  IP   + AVA+++  +Y
Sbjct: 290 GMDNIAQQIKKIARENSVHIVQNPPLARSLYKEVDVDKPIPEALFSAVAEVLAYVY 345


>gi|109899339|ref|YP_662594.1| flagellar biosynthetic protein FlhB [Pseudoalteromonas atlantica
           T6c]
 gi|109701620|gb|ABG41540.1| flagellar biosynthetic protein FlhB [Pseudoalteromonas atlantica
           T6c]
          Length = 374

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 108/362 (29%), Positives = 180/362 (49%), Gaps = 33/362 (9%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREAS-----LFSSILACLIYLLFFFSPGIYSVTSDL 62
           + KTE P+SKKI D+  +G    S+E S     +FS+  A  I +    +  IY VT   
Sbjct: 5   NEKTEDPTSKKITDSRKKGQVARSKELSTALVLVFSA--AAFIMMGGQIAKAIYLVTQRT 62

Query: 63  HVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLN- 121
             L    ++ +  D +H+         SA   V   ++L+M+    + +   I +   N 
Sbjct: 63  FTL----SRDETYDFTHMF----QAWGSAIETVATPVMLYMVIITAAGIYGNIALGGYNF 114

Query: 122 ---HVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFIS 178
                 P   +++   G KR++ +N LV  +K+  K+I+V       +   Y  ML F  
Sbjct: 115 TWQGAAPKANKLNPLAGFKRMFGMNGLVELLKAIAKVIVV-------MGMAYVAMLVFKD 167

Query: 179 ANPH-------SILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKD 231
              H         L+HA   +    +M+   +  +   D+ +  ++   ++KMSKQE+KD
Sbjct: 168 EALHLDLELYPQNLFHAMDLISWAFLMMCCALIPIAAFDVPYQSYKHNKEMKMSKQEVKD 227

Query: 232 EIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVL 291
           E K + G+P +KNR + +      ++MM+    A +++TNPTHY++AL+Y Q    APVL
Sbjct: 228 ENKNAEGDPQVKNRIRRLQFQAAANRMMQEVPTADVVVTNPTHYSIALKYDQQGTRAPVL 287

Query: 292 VAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           VAKG + +A  +RKIA  H +PI   P LAR+++    + S IP   + AVAQ++  ++ 
Sbjct: 288 VAKGVDEMAMHIRKIADAHEVPIVASPMLARAIYYSTEVESEIPAKLFMAVAQILAYVFQ 347

Query: 352 KK 353
            K
Sbjct: 348 LK 349


>gi|332305672|ref|YP_004433523.1| flagellar biosynthetic protein FlhB [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332173001|gb|AEE22255.1| flagellar biosynthetic protein FlhB [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 374

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 108/362 (29%), Positives = 180/362 (49%), Gaps = 33/362 (9%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREAS-----LFSSILACLIYLLFFFSPGIYSVTSDL 62
           + KTE P+SKKI D+  +G    S+E S     +FS+  A  I +    +  IY VT   
Sbjct: 5   NEKTEDPTSKKITDSRKKGQVARSKELSTALVLVFSA--AAFIMMGGQIAKAIYLVTQRT 62

Query: 63  HVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLN- 121
             L    ++ +  D +H+         SA   V   ++L+M+    + +   I +   N 
Sbjct: 63  FTL----SRDETYDFTHMF----QAWGSAIETVAGPVMLYMVIITAAGIYGNIALGGYNF 114

Query: 122 ---HVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFIS 178
                 P   +++   G KR++ +N LV  +K+  K+I+V       +   Y  ML F  
Sbjct: 115 TWQGAAPKANKLNPLAGFKRMFGMNGLVELLKAIAKVIVV-------MGMAYIAMLVFKD 167

Query: 179 ANPH-------SILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKD 231
              H         L+HA   +    +M+   +  +   D+ +  ++   ++KMSKQE+KD
Sbjct: 168 EALHLDLELYPQNLFHAMDLISWAFLMMCCALIPIAAFDVPYQSYKHNKEMKMSKQEVKD 227

Query: 232 EIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVL 291
           E K + G+P +KNR + +      ++MM+    A +++TNPTHY++AL+Y Q    APVL
Sbjct: 228 ENKNAEGDPQVKNRIRRLQFQAAANRMMQEVPTADVVVTNPTHYSIALKYDQQGTRAPVL 287

Query: 292 VAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           VAKG + +A  +RKIA  H +PI   P LAR+++    + S IP   + AVAQ++  ++ 
Sbjct: 288 VAKGVDEMAMHIRKIADAHEVPIVASPMLARAIYYSTEVESEIPTQLFMAVAQILAYVFQ 347

Query: 352 KK 353
            K
Sbjct: 348 LK 349


>gi|115350237|ref|YP_772076.1| flagellar biosynthesis protein FlhB [Burkholderia ambifaria AMMD]
 gi|115280225|gb|ABI85742.1| flagellar biosynthetic protein FlhB [Burkholderia ambifaria AMMD]
          Length = 399

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 102/357 (28%), Positives = 179/357 (50%), Gaps = 29/357 (8%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSP----------GIYSV 58
           ++TEA + ++ E A  EG    SRE + F+ + A         +P          G ++ 
Sbjct: 8   DRTEAATPRRREKAREEGQVARSRELASFALLAAGFYGAWLLAAPSGAHLQAMLRGAFAF 67

Query: 59  TS----DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQR 114
                 D H +L++A    +E ++ ++ +L    L+A               +G +LI +
Sbjct: 68  DRATAFDTHRMLSAAGSASIEGLAALLPILALTGLAAL---------LAPMALGGWLISQ 118

Query: 115 IPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTML 174
                    +  F R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L
Sbjct: 119 ------KTFELKFDRLNPISGLGRIFSIQGPIQLAMSLAKTLVVGGIGGIAIWRSKDELL 172

Query: 175 DFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIK 234
              +    S +  A   V       +  +  +  LD+ +   Q+  KL+M+K+E+K E +
Sbjct: 173 GLATQPLGSAVADAMHLVAVCCGTTVAGMLVVAALDVPYQIWQYNKKLRMTKEEVKREHR 232

Query: 235 QSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAK 294
           ++ G+P +K R +   R+  R +MM A  +A +++TNPTH+A+AL+Y   E  AP +VAK
Sbjct: 233 ENEGDPHVKGRIRQQQRAIARRRMMAAVPKADVVVTNPTHFAVALQYTDGEMRAPKVVAK 292

Query: 295 GQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           G NL+A ++R++A EHN+P+ E P LAR+L+  V I   IP   Y AVA+++  +Y 
Sbjct: 293 GVNLVAARIRELAAEHNVPLLEAPPLARALYHNVEIEREIPGSLYSAVAEVLAWVYQ 349


>gi|134294343|ref|YP_001118078.1| flagellar biosynthesis protein FlhB [Burkholderia vietnamiensis G4]
 gi|134137500|gb|ABO53243.1| flagellar biosynthetic protein FlhB [Burkholderia vietnamiensis G4]
          Length = 399

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 103/360 (28%), Positives = 180/360 (50%), Gaps = 31/360 (8%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSP--GIY---------- 56
           ++TEA + ++ E A  EG    SRE + F+ +LA   Y  +  S   G +          
Sbjct: 8   DRTEAATPRRREKAREEGQVARSRELASFA-LLAAGFYGTWLVSGPSGAHLQTMLRSAFT 66

Query: 57  ---SVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQ 113
              +   D H +L++A     E ++ ++ +L    L+A               +G +LI 
Sbjct: 67  FDRATAFDTHRMLSAAGTASAEGLAAVLPILALTGLAAL---------LAPMALGGWLIS 117

Query: 114 RIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTM 173
           +         +  F R+    G+ R++SI   +    S  K ++VG I  +++  +   +
Sbjct: 118 Q------KTFELKFDRLDPIAGLGRMFSIQGPIQLAMSVAKTMVVGGIGGVAIWRSKDEL 171

Query: 174 LDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEI 233
           L   +    + L  A   V       +  +  L  LD+ +   Q+  KL+M+K+E+K E 
Sbjct: 172 LGLATQPLGAALADALHLVAVCCGTTVAGMLVLAGLDVPYQLWQYNKKLRMTKEEVKREH 231

Query: 234 KQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVA 293
           +++ G+P +K R +   R+  R +MM A  +A +++TNPTH+A+AL+Y   E  AP +VA
Sbjct: 232 RENEGDPHVKGRIRQQQRAIARRRMMAAVPKADVVVTNPTHFAVALQYTDGEMRAPKVVA 291

Query: 294 KGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           KG NL+A ++R++A EHN+P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 292 KGVNLVAARIRELAAEHNVPLLEAPPLARALYHNVELEREIPGSLYSAVAEVLAWVYQLK 351


>gi|90579940|ref|ZP_01235748.1| flagellar biosynthesis protein [Vibrio angustum S14]
 gi|90438825|gb|EAS64008.1| flagellar biosynthesis protein [Vibrio angustum S14]
          Length = 376

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 102/358 (28%), Positives = 194/358 (54%), Gaps = 12/358 (3%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS++D  + +TE  + +++E A  +G  P SRE +  + +++  + L++F   G+    S
Sbjct: 1   MSDSDGQE-RTEDATPRRLEQAREKGQVPRSRELASVAVLVSGAVGLMWF-GEGLSKALS 58

Query: 61  DLHVLLASATQRKLEDISHI-VFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLN 119
            +   + S T+  + D+  + V +L  +    + L +  + LF+   IG+  +  +   +
Sbjct: 59  HIMTAMFSLTRDDIFDLDRLFVIILDAIVYVLAPLFLVLIFLFVAAFIGAAGVGGVR-FS 117

Query: 120 LNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTI---ITISLTENYFTMLDF 176
                P   +++   GIKR++ + + V  +KS +K+ LVG+I   +  S  E++F + + 
Sbjct: 118 TQAAMPKLSKMNPLSGIKRMFGMQSWVELIKSILKVGLVGSIACYLIFSSLEDFFQLSNE 177

Query: 177 I-SANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQ 235
           +  AN     +HA   +   +++I   +  +  +D+ +    +  +LKM+KQEIKDE K 
Sbjct: 178 VFPAN----YFHAIDILLNFVLLICCSLLIVVAIDVPFQIWNFNQQLKMTKQEIKDEYKD 233

Query: 236 SYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKG 295
           S G P +K R + + R   + +MM    +A ++ITNP H+++ALRY    + APV++AKG
Sbjct: 234 SEGKPEVKGRIRMLQREMAQRRMMADVPQADVVITNPEHFSVALRYDPKLDSAPVVIAKG 293

Query: 296 QNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            + +A K+R+IA +HNI I     LAR+++    +   IP   + AVAQ++  ++  K
Sbjct: 294 GDHLALKIREIANKHNIDIVPAAPLARAIYYTTELEQQIPDGLFVAVAQILAYVFQLK 351


>gi|330940692|gb|EGH43704.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 378

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 101/351 (28%), Positives = 183/351 (52%), Gaps = 1/351 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+   +KTE P+ KK++D+  +G    S+E +    +L     LL F S  I  + S
Sbjct: 1   MAENENGQDKTEDPTEKKVKDSRADGQIARSKELTTLVVMLMGAGGLLVFGS-DIALMMS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           +L     + ++  L D S++   L    + A  +V+P L+  ++  +   ++    +   
Sbjct: 60  ELMRDNFTISRETLMDQSYMGKALLSSGMHALIVVLPFLIAMLVAALVGPIMLGGWLFAT 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++   G+KR++S + LV  +KSF K ++   +  + L      ++      
Sbjct: 120 KSLMPKFSRMNPAAGLKRMFSPHALVELLKSFGKFLITLAVALVVLNNERKDLVAIAHEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V      +   +  +   D+ +  ++ + KL M+KQE++DE K S G+P
Sbjct: 180 LEQAMIHSLVVVGWSSFWMACGLIFIAAADVPFVLYEAHKKLLMTKQEVRDEHKNSEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM +   A +IITNPTH+A+AL+Y   +  AP+L+AKG +L+A
Sbjct: 240 EVKQRIRQLQREMSQRRMMASVPEADVIITNPTHFAVALKYDPEQGGAPMLLAKGTDLVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            K+R+I   + I I E  +LARS++    ++  IP   Y AVAQ++  +Y 
Sbjct: 300 LKIREIGAHNEILILESAALARSIYYSTELDQEIPAGLYLAVAQVLAYVYQ 350


>gi|262276382|ref|ZP_06054191.1| flagellar biosynthesis protein FlhB [Grimontia hollisae CIP 101886]
 gi|262220190|gb|EEY71506.1| flagellar biosynthesis protein FlhB [Grimontia hollisae CIP 101886]
          Length = 377

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 112/375 (29%), Positives = 186/375 (49%), Gaps = 46/375 (12%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISRE------------------ASLFSSILA 42
           M+END    +TE  + ++ + A  +G  P SRE                   SL ++++A
Sbjct: 1   MAENDG-QERTEDATPRRQQQAREKGQVPRSRELASVAVLVVGAVALMWFGESLGNALMA 59

Query: 43  CLIYLLFFFSPGIYSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLF 102
            +  L       I+ VTS L ++   A       I HI + +T + L    L I GL+  
Sbjct: 60  MMRKLFTLTREEIFDVTS-LGLIGYGA-------IFHIFWPITFILLM---LFIAGLIGA 108

Query: 103 MMFGIGSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTI- 161
              G  S+        +    +P   ++S  +GIKR++   + V  +KS +K+ LV  + 
Sbjct: 109 SALGGVSF--------SWEAARPKLSKMSPLQGIKRMFGKQSWVELIKSILKVALVSGVA 160

Query: 162 ---ITISLTENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQW 218
              +  SL + Y   ++    N    LYHA   +   +++I   +  +  +D+ +   Q 
Sbjct: 161 FYLMWASLNDFYQLSIETFPTN----LYHALDILLNFVLLICCSLLVVVAIDVPFQIWQH 216

Query: 219 YSKLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALA 278
             +LKM+KQEIKDE K++ G P +K R + + R   + +MM     A ++ITNP HY++A
Sbjct: 217 NEQLKMTKQEIKDEYKETEGKPEVKGRIRMLQREMAQRRMMAEVPSADVVITNPEHYSVA 276

Query: 279 LRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVF 338
           LRY    + APV+VAKG + +A K+R+IA EH+I I   P LAR+++    +   IP   
Sbjct: 277 LRYDSKMDKAPVVVAKGSDFLALKIREIAAEHDITIVPAPPLARAVYYSTELEQQIPDGL 336

Query: 339 YKAVAQLIYKIYHKK 353
           + A+AQL+  ++  K
Sbjct: 337 FTAIAQLLAYVFQLK 351


>gi|119503678|ref|ZP_01625761.1| flagellar biosynthetic protein FlhB [marine gamma proteobacterium
           HTCC2080]
 gi|119460740|gb|EAW41832.1| flagellar biosynthetic protein FlhB [marine gamma proteobacterium
           HTCC2080]
          Length = 384

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 99/353 (28%), Positives = 179/353 (50%), Gaps = 5/353 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E      +TE P++K+++ A  +G    SRE +    +L C + L       + +VT 
Sbjct: 1   MAEEQTGQERTEEPTAKRLQQAREKGQVARSRELNTLLMLLPCAVALWLTGEFAMDAVTR 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
                L   ++  ++  S +   L    +S   +++P L L +   +    +    + +L
Sbjct: 61  LFTGALTPPSE-AMKVTSEVAPFLGATLMSGLEMIVPFLALTVFVALLGPSVMGGLIFSL 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   ++   +G  RI+S  +L+  +KS +K  LV  +  + L      ++  IS  
Sbjct: 120 KSMSPGLDKIDPIKGFGRIFSRKSLLELVKSLLKFFLVSGVAVLVLLSFEREVMGLISLP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQW--YSKLKMSKQEIKDEIKQSYG 238
               +  A   +  +L +I L  + + V+ I   +  W    KL+M+KQE+KDE+K++ G
Sbjct: 180 VGEGIAQAGRMI--MLTLIFLSASLILVVAIDVPFQLWDHTRKLRMTKQEVKDEMKETDG 237

Query: 239 NPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL 298
           NP +K + +   R     +M+     A ++ITNPTH+++AL+Y Q  N AP ++AKG + 
Sbjct: 238 NPEMKGKIRQKQREIADRRMLADVPTADVVITNPTHFSVALKYDQEGNTAPRVLAKGADH 297

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           +A ++R IA  H+I I+EEP LAR+LF        IP   + AVA+++  ++H
Sbjct: 298 MAMQIRHIARAHDIVIYEEPPLARALFASTEAGDEIPGNLFLAVARVLAYVFH 350


>gi|238919250|ref|YP_002932765.1| flagellar biosynthetic protein FlhB, [Edwardsiella ictaluri 93-146]
 gi|238868819|gb|ACR68530.1| flagellar biosynthetic protein FlhB, putative [Edwardsiella
           ictaluri 93-146]
          Length = 388

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 109/350 (31%), Positives = 176/350 (50%), Gaps = 11/350 (3%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE P+  +IE A  +G  P SRE    +SIL     L      G Y +   L  ++A 
Sbjct: 8   EKTEDPTPHRIEKAREKGQIPRSRE---LTSILMLAAGLAIMLLGGEY-LAHSLAEMIAQ 63

Query: 69  A---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
                QR L +   ++  L  L   A   ++P L   M+ G  + ++    + + + +K 
Sbjct: 64  GLNFDQRLLSNDKQMLIQLGMLLQQAVAALMPVLFGLMLVGWCAPMLIGGFLFSPSSIKC 123

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
              R++   G KR++S   L   +K  +K  LVG +    L   +  ML  ++      +
Sbjct: 124 DLNRLNPLSGFKRMFSSQVLAELLKGILKAALVGWVCGWFLLHYWSRMLRLVTEPTLDAM 183

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQW--YSKLKMSKQEIKDEIKQSYGNPIIK 243
             A   V    ++++L +  +   D+   Y  W   SKL+M+KQEIKDE K+  G+P +K
Sbjct: 184 GDALHLVGMCGLLVVLGLLPMVGFDV--FYQVWSNLSKLRMTKQEIKDEFKEQEGDPHVK 241

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R +   R+  R +MM     A +I+TNPTHYA+AL+Y + +  AP ++AKG   +A+++
Sbjct: 242 GRIRQQQRAAARRRMMSDVPGADVIVTNPTHYAVALQYQENKMSAPKVLAKGAGEVAQRI 301

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           + +  EH IP  E P LAR+L++   I  AIP   Y AVA+++  +Y  K
Sbjct: 302 KALGAEHRIPQLEAPPLARALYRHSEIGQAIPATLYAAVAEVLAWVYQLK 351


>gi|197285519|ref|YP_002151391.1| flagellar biosynthesis protein FlhB [Proteus mirabilis HI4320]
 gi|227356013|ref|ZP_03840404.1| flagellar biosynthetic protein [Proteus mirabilis ATCC 29906]
 gi|194683006|emb|CAR43467.1| flagellar biosynthetic protein [Proteus mirabilis HI4320]
 gi|227163790|gb|EEI48698.1| flagellar biosynthetic protein [Proteus mirabilis ATCC 29906]
          Length = 382

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 115/358 (32%), Positives = 180/358 (50%), Gaps = 17/358 (4%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   KTE P+  K E A  +G    S+E    SS+L  L  +   +  G + +T 
Sbjct: 1   MAE-DSDLEKTEEPTPHKREKAKKDGQIVRSKE---LSSVLMILGGVSLLWMSGRF-ITR 55

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVI---PGLLLFMMFGIGSYLIQRIPV 117
           +L+ +L          I +   L+   +    + V    P  L  ++  IG   +     
Sbjct: 56  ELYAMLTEGFTFNHHIIGNENLLIPRFASLMKQAVFALSPVFLGLVLVAIGGSAVLGGIN 115

Query: 118 LNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFI 177
            +   +K   K+ +   G+KRI+S+N L    K+ +K + VG   T+ L  N+  +L  I
Sbjct: 116 FSSKSIKFDPKKWNPISGLKRIFSMNALAELFKAILKSLFVGLAATVFLWHNWNDILHLI 175

Query: 178 SANPHSILYHAF-FTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQS 236
           +  P S L +A    +  V I + + I  +   DI +       KL+M++QEIKDE KQ 
Sbjct: 176 TLPPLSALANAMQLLIFAVYIAVFMLI-PMVAFDIIFQIRSHLKKLRMTRQEIKDEFKQQ 234

Query: 237 YGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEND---APVLVA 293
            G+P +K R +       R +MM    +A +I+TNPTHYA+AL+Y    ND   AP ++A
Sbjct: 235 EGDPQLKARIRQQQHEMSRRRMMADVPKADVIVTNPTHYAVALQY----NDKMVAPKVLA 290

Query: 294 KGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           KG   IA K+++I  EH IP+ E P LAR+L++   I  AIP   Y AVA+++  +Y 
Sbjct: 291 KGAGAIALKIKEIGAEHRIPLLEAPPLARALYRHSEIGQAIPATLYAAVAEVLAWVYQ 348


>gi|253996636|ref|YP_003048700.1| flagellar biosynthetic protein FlhB [Methylotenera mobilis JLW8]
 gi|253983315|gb|ACT48173.1| flagellar biosynthetic protein FlhB [Methylotenera mobilis JLW8]
          Length = 387

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 108/356 (30%), Positives = 180/356 (50%), Gaps = 21/356 (5%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE  S K++E A  EG+ P SRE +  + +LA  + +L         +   L   ++S
Sbjct: 8   EKTEDASPKRLEQAREEGDVPRSRELATVTVLLAAGLAMLMMGG----QLADALKTSMSS 63

Query: 69  ATQRKLEDISHIVFLLTHLSLSASRLVI---PGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
               +       + LL  +S +   L++   P  L+     I S  +    V +   + P
Sbjct: 64  GLSFQRAYAYDPMLLLMKISDNIYNLLLAFSPLALILFFVAIASPALIGGWVFSEKALIP 123

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENY-------FTMLDFIS 178
            F +++   G   ++S N+L   +KS  K ILVG +  + ++ +           LD   
Sbjct: 124 KFGKLNPITGFSNMFSKNSLAELIKSIAKAILVGFVSYVVISHDMESILSLSLLPLDQSI 183

Query: 179 ANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYG 238
           A  + +L  +F  +  VL++I         +D+ +  +Q+  KLKM+K+E+K E K+S G
Sbjct: 184 AELNHLLLTSFLAIVSVLVLI-------AAIDVPFQLYQYADKLKMTKEEVKRESKESDG 236

Query: 239 NPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL 298
           NP IK+R +   R   R +MM     A ++ITNPTHYA+A++Y +    APV+VAKG + 
Sbjct: 237 NPEIKSRIRQQQREMARRRMMAEIPNADVVITNPTHYAVAIKYKEGGMLAPVVVAKGADA 296

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKKI 354
           IA K+R+ A EH + I E P LAR+++    +   IP   Y AVA+++  ++  +I
Sbjct: 297 IALKIREAAEEHKVLIVEAPKLARAIYTHTELTHEIPEALYTAVAEVLAYVFQMRI 352


>gi|27885003|gb|AAD56298.2| FlhB [Pseudomonas putida]
          Length = 380

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 103/357 (28%), Positives = 186/357 (52%), Gaps = 12/357 (3%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+++  +KTE P+ K+  DA  +G    S+E +     L     LL F      ++ +
Sbjct: 1   MAESESGQDKTEDPTDKRKRDAREKGEIARSKELNTVVLTLGGAGALLTFGGHLAETLLT 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLT--HLSLSASRLVIPGLLLFMMFG---IGSYLIQRI 115
            + +  +      +++ +   FLL    +++ A + V+  L +  + G   +G +L    
Sbjct: 61  LMRMNFSLTRDVIVDERAMGAFLLASGKMAIWAVQPVLGLLFVLALIGPVALGGFL---- 116

Query: 116 PVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLD 175
              + + ++P F R+S   GIKR++S+N++   +K+  K  ++  +  + L+ +   +L 
Sbjct: 117 --FSGSLLQPKFSRMSPLSGIKRMFSLNSVTELLKAVAKFFVILVVALVVLSHDRQALLA 174

Query: 176 FISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQ 235
             +      + HA   V    + +   +  +  +D+ +   Q   KLKM+KQE++DE K 
Sbjct: 175 IANEPLEQAIIHAVQVVGWSALWMAAGLLLIAAVDVPFQLWQTQQKLKMTKQEVRDEYKD 234

Query: 236 SYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEND-APVLVAK 294
           S G P +K R + + R   + +MM A   A +IITNPTHYA+AL+Y   +   AP+L+AK
Sbjct: 235 SEGKPEVKQRIRQLQREASQRRMMAAVPDADVIITNPTHYAVALQYDPEKGGVAPLLLAK 294

Query: 295 GQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           G + IA K+R+I  EH + I E P+LAR+++    I   IP   Y AVAQ++  ++ 
Sbjct: 295 GTDFIALKIREIGVEHKVQILESPALARAIYYSTEIEQEIPAGLYLAVAQVLAYVFQ 351


>gi|330972452|gb|EGH72518.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 378

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 100/351 (28%), Positives = 183/351 (52%), Gaps = 1/351 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+   +KTE P+ KK++D+  +G    S+E +    +L     LL F S  I  + S
Sbjct: 1   MAENENGQDKTEDPTEKKVKDSRADGQIARSKELTTLVVMLMGAGGLLVFGS-DIALMMS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           +L     + ++  L D S++   L    + A  +V+P L+  ++  +   ++    +   
Sbjct: 60  ELMRDNFTISRETLMDQSYMGKALLSSGMHALVVVLPFLIAMLVAALVGPIMLGGWLFAT 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++   G+KR++S + LV  +KS  K +++  +  + L      ++      
Sbjct: 120 KSLMPKFSRMNPAAGLKRMFSPHALVELLKSLGKFLIILAVALVVLNNERKDLVAIAHEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V      +   +  +   D+ +  ++ + KL M+KQE++DE K S G+P
Sbjct: 180 LEQAMIHSLLVVGWSSFWMACGLIFVAAADVPFVLYEAHKKLLMTKQEVRDEHKNSEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM +   A +IITNPTH+A+AL+Y   +  AP+L+AKG +L+A
Sbjct: 240 EVKQRIRQLQREMSQRRMMASVPEADVIITNPTHFAVALKYDPEQGGAPMLLAKGTDLVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            K+R+I   + I I E  +LARS++    ++  IP   Y AVAQ++  +Y 
Sbjct: 300 LKIREIGAHNEILILESAALARSIYYSTELDQEIPAGLYLAVAQVLAYVYQ 350


>gi|296330853|ref|ZP_06873328.1| flagellar biosynthesis protein FlhB [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305674371|ref|YP_003866043.1| flagellar export machinery protein [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296151858|gb|EFG92732.1| flagellar biosynthesis protein FlhB [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305412615|gb|ADM37734.1| component of the flagellar export machinery [Bacillus subtilis
           subsp. spizizenii str. W23]
          Length = 360

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 112/350 (32%), Positives = 196/350 (56%), Gaps = 11/350 (3%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYL-LFFFSPGIYS-VTSDLHVLL 66
            KTE  + KK +D   +G   +++ A + +++   +I+L L    P +   + S L    
Sbjct: 13  EKTEKATPKKRKDTRKKGQ--VAKSADVNTAVSLLVIFLSLIAIGPFMRDRLLSFLETFY 70

Query: 67  ASATQRKLEDIS-HIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
             +   KL + + H +F+   L    + ++ P +L+ ++ G+ S  +Q   + +   ++P
Sbjct: 71  TESLTMKLSEANVHTLFI--SLLKDTAFVLAPIMLVALVAGVVSNYMQVGFLFSAEVIQP 128

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
             +++   +G KRIYS+  +V  +KS +KI +VG      L  +Y  +L      P   L
Sbjct: 129 KLEKLDPIKGFKRIYSMRAIVELIKSILKITVVGFAAFAVLWLHYGEILRLPLLTPEEAL 188

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQW-YSK-LKMSKQEIKDEIKQSYGNPIIK 243
             +F +   + + +    A L +  + + Y ++ Y K +KMSKQ+IKDE K+S G+PIIK
Sbjct: 189 --SFVSKLTLWMGLSGAGALLLLAGLDYLYQRFDYEKNIKMSKQDIKDEYKKSEGDPIIK 246

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
           ++ K   R     +MM+   +A +IITNPTHYA+AL+Y + + DAP +VAKG + +A K+
Sbjct: 247 SKIKQRQREMAMRRMMQEVPKADVIITNPTHYAIALKYDEEKMDAPYIVAKGVDHLALKI 306

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           RKIA EH++ + E   LAR+L+ QV I+ A+P  F+K +A+++  +Y  K
Sbjct: 307 RKIAKEHDVMMVENRPLARALYDQVEIDQAVPEEFFKVLAEILAYVYKTK 356


>gi|172059259|ref|YP_001806911.1| flagellar biosynthesis protein FlhB [Burkholderia ambifaria MC40-6]
 gi|171991776|gb|ACB62695.1| flagellar biosynthetic protein FlhB [Burkholderia ambifaria MC40-6]
          Length = 399

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 102/357 (28%), Positives = 179/357 (50%), Gaps = 29/357 (8%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSP----------GIYSV 58
           ++TEA + ++ E A  EG    SRE + F+ + A         +P          G ++ 
Sbjct: 8   DRTEAATPRRREKAREEGQVARSRELASFALLAAGFYGAWLLAAPSGAHLQAMLRGAFAF 67

Query: 59  TS----DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQR 114
                 D H +L++A    +E ++ ++ +L    L+          L     +G +LI +
Sbjct: 68  DRATAFDTHRMLSAAGSASIEGLAALLPILALTGLA---------ALLAPMALGGWLISQ 118

Query: 115 IPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTML 174
                    +  F R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L
Sbjct: 119 ------KTFELKFDRLNPISGLGRIFSIQGPIQLGMSLAKTLVVGGIGGIAIWRSKDELL 172

Query: 175 DFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIK 234
              +    S +  A   V       +  +  +  LD+ +   Q+  KL+M+K+E+K E +
Sbjct: 173 GLATQPFGSAVADAMHLVAVCCGTTVAGMLVVAALDVPYQIWQYNKKLRMTKEEVKREHR 232

Query: 235 QSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAK 294
           ++ G+P +K R +   R+  R +MM A  +A +++TNPTH+A+AL+Y   E  AP +VAK
Sbjct: 233 ENEGDPHVKGRIRQQQRAIARRRMMAAVPKADVVVTNPTHFAVALQYTDGEMRAPKVVAK 292

Query: 295 GQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           G NL+A ++R++A EHN+P+ E P LAR+L+  V I   IP   Y AVA+++  +Y 
Sbjct: 293 GVNLVAARIRELAAEHNVPLLEAPPLARALYHNVEIEREIPGSLYSAVAEVLAWVYQ 349


>gi|126665002|ref|ZP_01735985.1| flagellar biosynthesis protein B [Marinobacter sp. ELB17]
 gi|126630372|gb|EBA00987.1| flagellar biosynthesis protein B [Marinobacter sp. ELB17]
          Length = 377

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 104/356 (29%), Positives = 186/356 (52%), Gaps = 11/356 (3%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFF---FSPGIYS 57
           M+++D+   KTE  + +++E A  +G    S+E +  + ++A    LL F       + +
Sbjct: 1   MADDDSSQEKTEEATPRRLEKAKEDGETARSKELATTAVLMAGAGGLLIFGTHLGAALEA 60

Query: 58  VTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGI-GSYLIQRIP 116
           +  D   L  SA    + D+ H+   L   + +A+  + P L++ ++  I GS  I  + 
Sbjct: 61  IMRDAFTLERSA----IFDMRHMSVQLIASTKAAAWALSPILVMLLVAAIAGSIGIGGL- 115

Query: 117 VLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDF 176
           + +   + P   R++  +GI R++S  +L+   K+  K+ LV TI  + L      +L  
Sbjct: 116 LFSGKSIAPKLNRMNPIKGIGRMFSARSLIELFKAIAKVGLVLTIAILILQVRTVDLLS- 174

Query: 177 ISANPH-SILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQ 235
           ISA P    + H  +T+     ++      + V+D+ +  +  + KLKM+ QE+KDE K 
Sbjct: 175 ISAEPAVPAMEHVLWTLGWSFFLLSCATIIIAVIDVPFQIYDHHKKLKMTMQEVKDEHKD 234

Query: 236 SYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKG 295
           S G P +K R + + R   + +MM+    A ++ITNPTHYA+AL+Y      AP++VAKG
Sbjct: 235 SEGKPEVKGRIRQLQREMSQRRMMQDVPTADVVITNPTHYAVALKYDPNSMAAPMVVAKG 294

Query: 296 QNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            + +A K+ +IA E+ + I   P LAR+++    I   IP   Y A+AQ++  ++ 
Sbjct: 295 GDELAFKIMEIARENKVEILRTPPLARAVYHNSDIGQEIPDGLYMAIAQVLAYVFQ 350


>gi|237755398|ref|ZP_04584025.1| flagellar biosynthetic protein FlhB [Sulfurihydrogenibium
           yellowstonense SS-5]
 gi|237692439|gb|EEP61420.1| flagellar biosynthetic protein FlhB [Sulfurihydrogenibium
           yellowstonense SS-5]
          Length = 350

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 105/359 (29%), Positives = 189/359 (52%), Gaps = 33/359 (9%)

Query: 10  KTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGI--------YSVTSD 61
           KTE  + K+ + A  EG    S + S+ +S+    I L+F+             Y+ ++ 
Sbjct: 7   KTEKATPKRKQKAREEGQVLKSMDVSISASLFVIFIVLIFYLPFAYKYLVGYFKYTFSNP 66

Query: 62  LHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLN 121
           L+++  + +         I F L  L++    L +P +L+  + GI S +IQ   +  L 
Sbjct: 67  LYLIPDNGSM-------FIWFTLKILAI----LTLPVILILFIVGIASNVIQFGFLFTLK 115

Query: 122 HVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFT----MLDFI 177
            + P   ++++  GIKRI+S+  L   +K+  K+       T++L  +YF     + DF+
Sbjct: 116 PLTPKLDKLNVISGIKRIFSLTVLFELIKNLAKL-------TVALFLSYFLVKYLLNDFL 168

Query: 178 SANPHSILYHAFFTVRKVLIMILLFI---ATLTVLDIGWSYHQWYSKLKMSKQEIKDEIK 234
                SI    +   + ++I+++ F      + + D  +  +++   LKM+K E+K+E K
Sbjct: 169 VYMTGSINNQIYVLSKTIIILVMSFAFLSVPIAIADFLYRRYEYEENLKMTKDEVKEERK 228

Query: 235 QSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAK 294
              GNP++K   +   R     +M+    +A ++ITNP HYA+AL+Y + +  AP ++AK
Sbjct: 229 SYEGNPLVKREIRKRMRQLALKRMIAEVPKADVVITNPEHYAVALKYERGKMHAPKVIAK 288

Query: 295 GQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           GQ+LIA+K++++A EH I I E+P LAR+L+    I   IP   Y+AVA+++ +IY  K
Sbjct: 289 GQDLIAQKIKEVAKEHGIKIVEDPPLARTLYSSCEIGDYIPENLYEAVAKILAEIYKAK 347


>gi|221214213|ref|ZP_03587185.1| flagellar biosynthetic protein FlhB [Burkholderia multivorans CGD1]
 gi|221165868|gb|EED98342.1| flagellar biosynthetic protein FlhB [Burkholderia multivorans CGD1]
          Length = 399

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 100/359 (27%), Positives = 178/359 (49%), Gaps = 29/359 (8%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSP----------GIYSV 58
           ++TEA + ++ E A  EG    SRE + F+ + A          P          G ++ 
Sbjct: 8   DRTEAATPRRREKAREEGQVARSRELASFALLAAGFYGAWLLAGPAGAHLQAMLRGAFAF 67

Query: 59  TS----DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQR 114
                 D H +L++A    +E ++ ++ +L     +A               +G +LI  
Sbjct: 68  DRATAFDTHRMLSAAGSASVEGLAALLPILALTGAAAL---------LAPMALGGWLI-- 116

Query: 115 IPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTML 174
               +    +  F R++   G+ RI+SI   +    S  K ++VG I  +++  +   +L
Sbjct: 117 ----SPKTFELKFDRLNPVAGLGRIFSIQGPIQLGMSIAKTLVVGGIGGVAIWRSKDELL 172

Query: 175 DFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIK 234
              +    + L  A   V       +  +  +  LD+ +   Q+  KL+M+K+E+K E +
Sbjct: 173 GLATQPLDTALVDALHLVAVCCGTTVAGMLVVAALDVPYQLWQYNKKLRMTKEEVKREHR 232

Query: 235 QSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAK 294
           ++ G+P +K R +   R+  R +MM A  +A +++TNPTH+A+AL+Y   E  AP +VAK
Sbjct: 233 ENEGDPHVKGRIRQQQRAIARRRMMAAVPKADVVVTNPTHFAVALQYADGEMRAPKVVAK 292

Query: 295 GQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           G NL+A ++R++A EHN+P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 293 GVNLVAARIRELAAEHNVPLLEAPPLARALYHNVELEREIPGALYSAVAEVLAWVYQLK 351


>gi|284007183|emb|CBA72471.1| flagellar biosynthesis protein FlhB [Arsenophonus nasoniae]
          Length = 383

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 113/352 (32%), Positives = 178/352 (50%), Gaps = 19/352 (5%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            K E P+++K E A  EG    SRE S F  ++A +     F+  G +S    LH L + 
Sbjct: 8   EKNEEPTARKKEKAKEEGQVVRSRELSSFFMLIAGVS---LFWICG-HSCYQKLHALFSQ 63

Query: 69  A------TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYL--IQRIPVLNL 120
                       + + ++VF    + L+A   +I GL+L + F   S+   I     +N 
Sbjct: 64  TFYFDKYILYNSQLLPNLVFESVKIGLNALLPIIAGLVL-IAFAAPSFFGGIH----INF 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K  +K+++   G+KR++SIN L    K+ +K++LV   IT+ L  N       ++  
Sbjct: 119 KSIKFDWKKLNPITGLKRLFSINALAELFKALLKVMLVSIGITLFLWVNLPHFFHLVTEP 178

Query: 181 PHSILYHAF-FTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
            H  L  A    +    I I + I  L   D+ +       KL+M++QEIKDE KQ  G+
Sbjct: 179 RHLALSQATQLMIFAAYIAIFMLI-PLVGFDLIYQLRSHLKKLRMTRQEIKDEFKQQEGD 237

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLI 299
           P IK R +   R   R +MM    +A +IITNPTHYA+AL+Y      AP ++ KG  LI
Sbjct: 238 PHIKARIRQQQREISRRRMMADVPKADVIITNPTHYAVALQYDNQAMQAPKVLVKGAGLI 297

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           A  ++++  E+ IP+ E P LAR+L++   +   IP   Y AVA+++  +Y 
Sbjct: 298 ALNIKQLGEENRIPVLEAPPLARALYRHSKVGGHIPATLYAAVAEVLAWVYQ 349


>gi|290474957|ref|YP_003467841.1| putative part of export apparatus for flagellar proteins
           [Xenorhabdus bovienii SS-2004]
 gi|289174274|emb|CBJ81064.1| putative part of export apparatus for flagellar proteins
           [Xenorhabdus bovienii SS-2004]
          Length = 383

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 101/356 (28%), Positives = 181/356 (50%), Gaps = 8/356 (2%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   KTE P+  K E A  +G    S+E    +SIL  +  +   +  G  S+T 
Sbjct: 1   MAE-DSDLEKTEEPTPHKREKARKDGQIARSKE---LTSILMLVGGVSLLWMSG-NSITH 55

Query: 61  DLHVLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPV 117
           +L +++          + +   ++  +  L   A   ++P  +  ++  + +  +    +
Sbjct: 56  ELSLMVFEGFNFDHNMVSNDKQMIQQVGRLLKQAVWALLPVFVGLVLVALSAPTLMGGLI 115

Query: 118 LNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFI 177
            +   +K    ++S   G+K+I+S+N L    K+ +K  LVG    + +  N+  ML+  
Sbjct: 116 FSSKSIKFDLAKLSPISGLKKIFSMNALAELFKAILKASLVGGGTALFIWLNWPAMLNLT 175

Query: 178 SANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSY 237
           +  P   L  A   +     ++L  +  +   D+ +       KL+M++QEIKDE K+  
Sbjct: 176 AQPPLMALSDAMMMLIFAGYIVLFMLIPMVAFDVLYQIRSHLKKLRMTRQEIKDEFKEQE 235

Query: 238 GNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQN 297
           G+P +K R +   R+  R +MM    +A +I+TNPTHYA+AL+Y   +  AP ++AKG  
Sbjct: 236 GDPHVKARIRQQQRAAARKRMMSDVPKADVIVTNPTHYAVALQYDSKKMGAPKVLAKGAG 295

Query: 298 LIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           LIA ++++I  E+ IP+ E P LAR+LF+   +   IP   Y AVA+++  +Y  K
Sbjct: 296 LIALRIKEIGAENRIPLLEAPPLARALFRHAEVGGFIPATLYAAVAEVLAWVYQLK 351


>gi|89075526|ref|ZP_01161937.1| flagellar biosynthesis protein [Photobacterium sp. SKA34]
 gi|89048798|gb|EAR54369.1| flagellar biosynthesis protein [Photobacterium sp. SKA34]
          Length = 376

 Score =  156 bits (394), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 101/358 (28%), Positives = 195/358 (54%), Gaps = 12/358 (3%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS++D  + +TE  + +++E A  +G  P SRE +  + +++  + L++F   G+    S
Sbjct: 1   MSDSDGQE-RTEDATPRRLEQAREKGQVPRSRELASVAVLVSGAVGLMWF-GEGLSKALS 58

Query: 61  DLHVLLASATQRKLEDISHI-VFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLN 119
            + + + S T+  + D+  + V +L  +    + L +  + LF+   IG+  +  +   +
Sbjct: 59  HIMMAMFSLTRDDIFDLDRLFVIILDAIVYILAPLFLVLIFLFVAAFIGAAGVGGVR-FS 117

Query: 120 LNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTI---ITISLTENYFTMLDF 176
                P   +++   GIKR++ + + V  +KS +K+ LVG+I   +  S  E++F + + 
Sbjct: 118 TQAAMPKLSKINPLSGIKRMFGLQSWVELIKSILKVGLVGSIACYLIFSNLEDFFQLSNE 177

Query: 177 I-SANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQ 235
           +  AN     +HA   +   +++I   +  +  +D+ +    +  +LKM+KQEIKDE K 
Sbjct: 178 VFPAN----YFHAIDILLNFVLLICCSLLIVVAIDVPFQIWNFNQQLKMTKQEIKDEYKD 233

Query: 236 SYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKG 295
           S G P +K R + + R   + +MM    +A ++ITNP H+++ALRY    + APV++AKG
Sbjct: 234 SEGKPEVKGRIRMLQREMAQRRMMADVPQADVVITNPEHFSVALRYDPKLDSAPVVIAKG 293

Query: 296 QNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            + +A K+R+IA +H+I I     LAR+++    +   IP   + AVAQ++  ++  K
Sbjct: 294 GDHLALKIREIANKHDIDIVPAAPLARAIYYTTELEQQIPDGLFVAVAQILAYVFQLK 351


>gi|299069778|emb|CBJ41057.1| flagellar export pore protein [Ralstonia solanacearum CMR15]
          Length = 387

 Score =  156 bits (394), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 108/365 (29%), Positives = 185/365 (50%), Gaps = 31/365 (8%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE D+   KTE  S++++E A  EG+ P SRE   F         LL   + G++ +  
Sbjct: 1   MSE-DSDLEKTEPASARRLEQAREEGDVPQSRELVSF--------VLLATGAGGLWVMGE 51

Query: 61  DLHVLLASATQRKLE----DISHIVFLLTHLSLSASRL--VIPGLLLFMMFGIGSYLIQR 114
            +    AS   R LE    D +       ++      L  V+ GL+L ++    S L   
Sbjct: 52  SIVRTAASFLARCLEFHRYDYTRAQEQWHYVGAQFGPLATVLAGLVLMLVLAALSPLALT 111

Query: 115 IPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTML 174
              ++   V P   R+    G+KR++S+  L+   +   K++L+G +        ++ +L
Sbjct: 112 RGAISFKPVTPDITRLLGMHGLKRMFSVQGLLELPRLLAKLVLLGGV-------GWWLIL 164

Query: 175 ----DFISANPHSILYHAFFTVRKVLIMILLFIATLTVL----DIGWSYHQWYSKLKMSK 226
               DF+   P   L         V  +  L +A + +L    D+  +  Q+  K +M+K
Sbjct: 165 HYRDDFVEL-PRQDLIAGMRDTMHVAGVAFLCMAGVMLLVAAVDVPLALWQYARKHRMTK 223

Query: 227 QEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEN 286
           +E++ E ++S G+P +K R +++ R   + +MM    +A +I+TNPTHYA+ALRY + E 
Sbjct: 224 EEVRKEHRESEGDPQLKGRIRAMQRQAAQRRMMADVPKADVIVTNPTHYAVALRYSEQEG 283

Query: 287 DAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
            AP ++AKG +++A K+R++  EH IP+ E P LAR+L++   I   IP   Y AVA+++
Sbjct: 284 GAPRVLAKGADMVAAKIRELGAEHKIPMLEAPPLARALYRHTEIGHQIPAALYAAVAEVL 343

Query: 347 YKIYH 351
             +Y 
Sbjct: 344 AYVYQ 348


>gi|16799762|ref|NP_470030.1| flagellar biosynthesis protein FlhB [Listeria innocua Clip11262]
 gi|16413139|emb|CAC95919.1| lin0687 [Listeria innocua Clip11262]
          Length = 348

 Score =  156 bits (394), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 101/341 (29%), Positives = 183/341 (53%), Gaps = 5/341 (1%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A DNKTE  + ++I+ A NEGN   S+E +   S+L  +  LL+FF       T    V 
Sbjct: 2   AKDNKTEKATPRRIKKARNEGNVAKSKELNNAFSLL-IVAGLLYFFGEMFIKNTIKAFVA 60

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           L     +     S+ +F L        ++++P +++ ++FG+ +Y +Q   + +   VKP
Sbjct: 61  LLKQPPKLASMESYSLFYLMEFG----KVLMPVMVMVVIFGLMNYGVQVGILFSAKAVKP 116

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
            FKR++     KR++S+  +V  +K+ + I L+  +  I   ++  T++ +   N    L
Sbjct: 117 QFKRLNPANYFKRVFSVKGIVEVVKALLLITLLSYVAYIGFRDHLDTLISYTGQNWLYSL 176

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
              F   +   + + L IA + +LD  +  + +   L+MSKQEIKDE+K S G P +K R
Sbjct: 177 SQIFALFKNEFLALFLVIAVIGLLDFFYQRYDYKKGLRMSKQEIKDEMKDSEGRPEVKQR 236

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
           Q+SIAR  ++  + +  + AT ++ NPTH ++ +RY +T++ AP L+ KG++ +A  +R+
Sbjct: 237 QRSIARGLLQGSITKKMADATFVVNNPTHISVVMRYDKTKDHAPKLLVKGEDELALFIRQ 296

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           +A    +P+     LARS++     +  I    YK V +++
Sbjct: 297 VADTDGVPMITNRQLARSIYYTTNPDEYIQEDLYKDVIEVM 337


>gi|85711029|ref|ZP_01042089.1| flagellar biosynthesis protein [Idiomarina baltica OS145]
 gi|85694942|gb|EAQ32880.1| flagellar biosynthesis protein [Idiomarina baltica OS145]
          Length = 375

 Score =  156 bits (394), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 97/357 (27%), Positives = 185/357 (51%), Gaps = 9/357 (2%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D    +TE P+ K+  +A  +G    S+E    + +L       F+F   +Y+   
Sbjct: 1   MAETD--QERTEEPTEKRKREAREKGQIARSKEMGT-AFVLVSAAVAFFWFGESLYAGVR 57

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQR-IPVLN 119
            L   L +  +R+  D S I      L++    ++ P +++F    + ++L    +  +N
Sbjct: 58  GLFRDLFTLERRQAFDTSQI---YKALAVGFEHIIWPVIIIFAFITLFTFLGNSWLGGIN 114

Query: 120 LNH--VKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFI 177
            +   + P F R++   G KR++    LV  +K   K  +V     + L+  +  +L   
Sbjct: 115 FSWKAMAPKFSRMNPMNGFKRMFGTQALVELVKGIAKFGVVAISAFLLLSWQFDNILQIS 174

Query: 178 SANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSY 237
                S++ +A   +  + ++I   +  + V+D  +   +    L+M+KQEIKDE K S 
Sbjct: 175 MGQMPSMIENALDILMWMFLLICCSMFLIVVIDAPFQLWKHNKDLRMTKQEIKDEHKDSE 234

Query: 238 GNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQN 297
           G+P +K R + +       +MM+   +A +++TNPTH+A+A++Y ++ N AP+L+AKG +
Sbjct: 235 GSPEVKGRIRRLQMEMANRRMMQEVPKADVVVTNPTHFAVAIKYEESGNQAPILLAKGTD 294

Query: 298 LIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKKI 354
             A K+R+IA E+++P+   P+LARS++    + + IP   + AVAQ++  +Y  K+
Sbjct: 295 ETAAKIREIALEYDVPLVASPALARSIYHTTELETEIPRGLFVAVAQVLAYVYQLKM 351


>gi|302392376|ref|YP_003828196.1| flagellar biosynthetic protein FlhB [Acetohalobium arabaticum DSM
           5501]
 gi|302204453|gb|ADL13131.1| flagellar biosynthetic protein FlhB [Acetohalobium arabaticum DSM
           5501]
          Length = 353

 Score =  156 bits (394), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 110/346 (31%), Positives = 182/346 (52%), Gaps = 5/346 (1%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
           + KTE P+ K+ ++A  EG    S+E S+  ++L   I L F     +Y     ++    
Sbjct: 4   EEKTEDPTPKRRQEAREEGQVAQSQELSMAFTLLFSFIMLFFLMDNILYESMEFMNKYFT 63

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
                 L ++     LL  L     RLV P + +  + G+   L+Q   +     ++P  
Sbjct: 64  DYMTMTL-NLQTFYTLLLELMQFIFRLVAPLMFVVALVGVVVGLLQTGFLFTPTSLQPDP 122

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
            ++    G K+I+S   +  F KS +KI +VG I  +++ +N   ++ F     + ++  
Sbjct: 123 SKLDPVSGFKQIFSKQTVAEFFKSILKISIVGGIAYLTIKDNLPQLIMFSKMGLNQVVSL 182

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWY--SKLKMSKQEIKDEIKQSYGNPIIKNR 245
               +  + I + L +  L +LD  + Y +W    +LKM+KQE+K+E KQ+ GNP IK R
Sbjct: 183 IGSIIYSLAIKVSLILILLGILD--FIYQKWEHEQQLKMTKQEVKEEKKQTEGNPEIKKR 240

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
           QK   +    ++MME+   A ++ITNPTH A+A+++     DAP++VAKG+  IA K++K
Sbjct: 241 QKEKQQEMAMNRMMESVPEADVVITNPTHIAVAIKFDIDNMDAPIVVAKGKGEIAHKIKK 300

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            A E  I I EE  LAR+L+ QV I   IP   Y+AVA+++  +Y 
Sbjct: 301 KAEECGIEIVEEKPLARALYGQVEIEEEIPMELYQAVAEILAYVYQ 346


>gi|254522000|ref|ZP_05134055.1| flagellar biosynthetic protein FlhB [Stenotrophomonas sp. SKA14]
 gi|219719591|gb|EED38116.1| flagellar biosynthetic protein FlhB [Stenotrophomonas sp. SKA14]
          Length = 377

 Score =  156 bits (394), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 98/356 (27%), Positives = 176/356 (49%), Gaps = 11/356 (3%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISRE---ASLFSSILACLIYLLFFFSPGIYS 57
           MSEN++   KTE P+ K++ DA  +GN P SRE   A++F +    L  +    S G  +
Sbjct: 2   MSENESAGEKTEQPTEKRLRDAREQGNLPRSRELGTAAVFGA--GVLAVMAMSGSIGRGA 59

Query: 58  VTSDLHVLLASATQRK--LEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRI 115
                H L    + R+   E   H   LL    L    ++ P +L+ ++    + L+   
Sbjct: 60  TAWMKHALSPEQSLRQNPKELFGHFGDLLLQFLL----VIAPLVLVCLLASFVAPLVMGG 115

Query: 116 PVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLD 175
              +   + P   R++   G+KR+Y    +  F KS +++  VG    + +   + T+  
Sbjct: 116 LRWSQKALLPDINRLNPMSGLKRLYGPEAIAEFTKSLLRVAFVGVAAGLVVWTGFDTLRG 175

Query: 176 FISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQ 235
            I     + +        ++L+     +  L  +D  +    W  KLKM+++E++ E+K+
Sbjct: 176 LIHHPLETAITDGLGFTLRLLLATAGAMLVLAAIDAPYQRWNWMRKLKMTREELRREMKE 235

Query: 236 SYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKG 295
           S G+P +K R + + +     +MMEA   A +++ NPTHYA+AL+Y     +AP +VA G
Sbjct: 236 SEGSPEVKGRIRQLQQQMANRRMMEAVPTADVVVVNPTHYAVALKYEGGAMNAPTVVALG 295

Query: 296 QNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            +  A ++R++A  + + I   P LAR+L+++  +   IP   Y AVAQ++  +Y 
Sbjct: 296 VDETALRIREVADGNKVAIVSAPPLARALYREGQLGKEIPVRLYSAVAQVLSYVYQ 351


>gi|307824492|ref|ZP_07654717.1| flagellar biosynthetic protein FlhB [Methylobacter tundripaludum
           SV96]
 gi|307734476|gb|EFO05328.1| flagellar biosynthetic protein FlhB [Methylobacter tundripaludum
           SV96]
          Length = 374

 Score =  156 bits (394), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 107/357 (29%), Positives = 184/357 (51%), Gaps = 12/357 (3%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLL---FFFSPGIYS 57
           MS+ND   +KTE P+ K++ DA  +G  P SRE + F  ++A    LL        G+  
Sbjct: 1   MSDND---DKTEDPTGKRLADARKKGQIPRSRELNTFVILMASATMLLTQGGTIGNGLLK 57

Query: 58  VTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPV 117
           +      L  +A    + D   I   L    +    L+ P + + ++  I + +     V
Sbjct: 58  IMRTTFRLSRAA----IFDPDSITLYLKQAMIDTVMLLAPFMAVMVVVAIVTPISMGGWV 113

Query: 118 LNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFT-MLDF 176
            +   +  +  +++   GI RI++I  LV   K+ +KI+LV   + ++L  ++   +L  
Sbjct: 114 FSWEAIAFNPSKMNPIAGIARIFAIRGLVELFKALLKILLV-FAVAVALYRSFIGELLSL 172

Query: 177 ISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQS 236
              +P   + HA   +   ++++   +  + ++D+ +        +KMSKQEIKDE K +
Sbjct: 173 GGESPIHSIGHALDIIGTCILLLSSSLILVVMIDVPYQLWDHSKNMKMSKQEIKDENKDA 232

Query: 237 YGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQ 296
            G+P +K RQ+ +     + +MME   +A +I+TNP+HYA+AL+Y Q  N AP LVAKG 
Sbjct: 233 EGSPEVKGRQRRMQMETAQRRMMEEVPKADVIVTNPSHYAVALKYDQNSNSAPKLVAKGV 292

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +LIA ++R  A    +P+   P LAR+L+    ++  IP   Y AVAQ++  +Y  K
Sbjct: 293 DLIAAQIRNAAIGSGVPLVASPPLARALYYSTELDREIPQGLYLAVAQILAYVYQLK 349


>gi|238924151|ref|YP_002937667.1| flagellar biosynthesis/type III secretory pathway protein
           [Eubacterium rectale ATCC 33656]
 gi|238875826|gb|ACR75533.1| flagellar biosynthesis/type III secretory pathway protein
           [Eubacterium rectale ATCC 33656]
 gi|291524884|emb|CBK90471.1| flagellar biosynthetic protein FlhB [Eubacterium rectale DSM 17629]
          Length = 382

 Score =  156 bits (394), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 113/378 (29%), Positives = 194/378 (51%), Gaps = 49/378 (12%)

Query: 2   SENDAPDNKTEAPSSKKIEDALNEGNAPISRE-ASLFSSILACLIYLLF--FFSPGIYSV 58
           +++     KTE  + KK++DA  EG    S+E  + F  I+  L+  +F  F    +  +
Sbjct: 25  AQDGEGGEKTEPATEKKLKDAREEGKVAKSKELTAAFDLIVLFLVLKIFISFVGGNLIGL 84

Query: 59  TSDLHVLLASATQRKLEDISHIV-----------FLLTHLSLSASRLVIPGLLLFMMFGI 107
            S ++  +    +   E IS +            FLLT L   A  +VI  L+  +  G 
Sbjct: 85  FSTVYKKMPDFLKESQEQISSVSVTHYLNNVILQFLLTVLPFFAFGVVITILVSIIQVG- 143

Query: 108 GSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLT 167
             + I   P+       P   + +   G KRI S +++   +KS +K   VG I+ ++ +
Sbjct: 144 --FKISTKPM------APKLSKFNPINGFKRILSKDSIFELLKSVLK---VGIIMYVAYS 192

Query: 168 ENYFTMLDFISANPHS----ILY-----HAFFTVRKVLIMILLFIATL----TVLDIGWS 214
                     S   H     ILY      A   +  ++I   L I+ +     + D  ++
Sbjct: 193 ----------SVKSHQNDIFILYELPLKQAIVLIGDIIINTGLKISIVYMIVGIADFAYN 242

Query: 215 YHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTH 274
            H++ + +KM+KQE+KDE K + G+P IK +Q+   +   + +MM+   +A ++ITNPTH
Sbjct: 243 KHKFNNDMKMTKQEVKDEFKNTEGDPAIKGQQRKRMQEASQRRMMQDVPKADVVITNPTH 302

Query: 275 YALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAI 334
           +A+A++Y   +NDAPV+VAKGQ+ +A+K+++IA ++NI I E   LAR LF  V + + I
Sbjct: 303 FAVAVKYDAQKNDAPVVVAKGQDYVAQKIKEIARDNNIHIVENKPLARMLFHNVDLGAEI 362

Query: 335 PPVFYKAVAQLIYKIYHK 352
           PP  Y++VA+++  IY +
Sbjct: 363 PPELYRSVAEILAMIYKE 380


>gi|313624921|gb|EFR94829.1| flagellar biosynthesis protein FlhB [Listeria innocua FSL J1-023]
          Length = 348

 Score =  156 bits (394), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 101/341 (29%), Positives = 183/341 (53%), Gaps = 5/341 (1%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A DNKTE  + ++I+ A NEGN   S+E +   S+L  +  LL+FF       T    V 
Sbjct: 2   AKDNKTEKATPRRIKKARNEGNVAKSKELNNAFSLL-IVAGLLYFFGEMFIKNTIQAFVA 60

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           L     +     S+ +F L        ++++P +++ ++FG+ +Y +Q   + +   VKP
Sbjct: 61  LLKQPPKLASMESYSLFYLMEFG----KVLMPVMVMVVIFGLMNYGVQVGILFSAKAVKP 116

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
            FKR++     KR++S+  +V  +K+ + I L+  +  I   ++  T++ +   N    L
Sbjct: 117 QFKRLNPANYFKRVFSVKGIVEVVKALLLITLLSYVAYIGFRDHLDTLISYTGQNWLYSL 176

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
              F   +   + + L IA + +LD  +  + +   L+MSKQEIKDE+K S G P +K R
Sbjct: 177 SQIFALFKNEFLALFLVIAIIGLLDFFYQRYDYKKGLRMSKQEIKDEMKDSEGRPEVKQR 236

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
           Q+SIAR  ++  + +  + AT ++ NPTH ++ +RY +T++ AP L+ KG++ +A  +R+
Sbjct: 237 QRSIARGLLQGSITKKMADATFVVNNPTHISVVMRYDKTKDHAPKLLVKGEDELALFIRQ 296

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           +A    +P+     LARS++     +  I    YK V +++
Sbjct: 297 VADTDGVPMITNRQLARSIYYTTNPDEYIQEDLYKDVIEVM 337


>gi|119476304|ref|ZP_01616655.1| Flagellar biosynthesis pathway, component FlhB [marine gamma
           proteobacterium HTCC2143]
 gi|119450168|gb|EAW31403.1| Flagellar biosynthesis pathway, component FlhB [marine gamma
           proteobacterium HTCC2143]
          Length = 386

 Score =  156 bits (394), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 103/365 (28%), Positives = 177/365 (48%), Gaps = 29/365 (7%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+END    KTE  + K++E +  EG    S+E      +LA +  L+ +          
Sbjct: 1   MAENDNGQEKTEEATPKRLEKSREEGQVARSKELGTALILLAGVGGLIVY--------GG 52

Query: 61  DLHVLLASATQRKLEDISHIVF----LLTHLSLSASRLVIPGLLLFMMF----------G 106
           D    L    +        + F    +L HL  + S  +I  +L F              
Sbjct: 53  DFGQALMGVMRFNFSMPRDVAFDESLMLRHLG-NTSIFIIETMLPFFALIAVAAVVGPVA 111

Query: 107 IGSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISL 166
           +G +      +L+   + P   R+   +GIKRI+S+ +LV  +KS  K+++VG++   +L
Sbjct: 112 LGGF------ILSGKALVPKLTRLDPIKGIKRIFSLTSLVELLKSICKVLVVGSMAYFTL 165

Query: 167 TENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSK 226
                 +LD   A     +      V   ++ +   +  + ++D+ +       KLKM+ 
Sbjct: 166 RNAEMDLLDLAHAELQPAIVQMLTIVAWSVLAVSASMILIVLIDVPFQIFDHSKKLKMTL 225

Query: 227 QEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEN 286
           QE+KDE+K S G P +K R + + R   + +MMEA   A ++ITNP H+++AL+Y     
Sbjct: 226 QEVKDEMKDSEGKPEVKGRIRQLQREMAQRRMMEAVPEADVVITNPEHFSIALKYDVEGG 285

Query: 287 DAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
            AP+LVAKG + +A K+R+IA  +++ I   P LAR+++    I+  IP   Y AVAQ++
Sbjct: 286 GAPILVAKGVDFLAIKIREIANANDVMILAAPPLARAIYFTTEIDDEIPNTLYLAVAQVL 345

Query: 347 YKIYH 351
             ++ 
Sbjct: 346 AYVFQ 350


>gi|319649548|ref|ZP_08003704.1| flagellar biosynthesis protein B [Bacillus sp. 2_A_57_CT2]
 gi|317398710|gb|EFV79392.1| flagellar biosynthesis protein B [Bacillus sp. 2_A_57_CT2]
          Length = 361

 Score =  155 bits (393), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 93/261 (35%), Positives = 154/261 (59%), Gaps = 8/261 (3%)

Query: 97  PGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKII 156
           P +L+ M+ GI +  +Q   + +   ++P  +++   +G KRI+S+  +V  +KS +KI 
Sbjct: 102 PIMLVAMLAGITANFMQVGTLFSTEAIQPKLEKMDPIKGFKRIFSMRAIVELLKSMLKIA 161

Query: 157 LVG--TIITISLTENYFTMLDFISANPHSILYHAFFTVRKVLIM--ILLFIATLTVLDIG 212
            VG      + L  +   +L   S    ++   A  TV+  LI    LLF   L+VLD  
Sbjct: 162 FVGVAAFAVLWLRIDEILILSQKSVGT-AMATLASLTVQMGLIASAALLF---LSVLDYL 217

Query: 213 WSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNP 272
           +  + +   ++MSKQ+IKDE K   G+P+IK++ K   R     +MM+   +A ++ITNP
Sbjct: 218 YQKYDFEKNIRMSKQDIKDEYKNIEGDPLIKSKIKQRQREMAMRRMMQEVPKADVVITNP 277

Query: 273 THYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINS 332
           TH+A+AL Y +T++DAP++VAKG + +A+K++ IA EH++   E   LAR+L+ Q  I  
Sbjct: 278 THFAIALSYDETKSDAPIVVAKGVDFVAQKIKLIAKEHDVIAVENRPLARALYSQAEIGQ 337

Query: 333 AIPPVFYKAVAQLIYKIYHKK 353
           AIP  F+KAVA+++  +Y  K
Sbjct: 338 AIPEEFFKAVAEILAYVYRTK 358


>gi|309778952|ref|ZP_07673722.1| flagellar biosynthetic protein FlhB [Ralstonia sp. 5_7_47FAA]
 gi|308922299|gb|EFP67926.1| flagellar biosynthetic protein FlhB [Ralstonia sp. 5_7_47FAA]
          Length = 387

 Score =  155 bits (393), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 103/367 (28%), Positives = 180/367 (49%), Gaps = 50/367 (13%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE  S +++E A  EG+ P SRE + F+         L   S G   V  D  V  AS
Sbjct: 8   EKTEPASPRRLEQAREEGDVPRSRELASFA---------LTAVSAGGLWVMGDSIVRAAS 58

Query: 69  A-TQRKLE-----------DISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIP 116
           A   R LE             +++      L+++     + GL+L ++    S L     
Sbjct: 59  AFLARCLEFHRYNYTSGQDQWNYVTGQFMPLAMA-----LGGLMLMLVIAALSPLALTRG 113

Query: 117 VLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILV------------GTIITI 164
            ++   + P   R+   +G+ R++S+  L+   +  +K+ L+            G +I +
Sbjct: 114 AISFKPLSPDISRLFKLQGLTRMFSLEGLMELPRLLIKLFLIAGVGWLLVRYYRGDLIEL 173

Query: 165 SLTENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKM 224
              +    M D +      +   AF  +  V++++         +D+  S  Q+  K +M
Sbjct: 174 PQQDLGVAMRDTLH-----VAGVAFLCMAAVMMLV-------AAVDVPLSLWQYARKHRM 221

Query: 225 SKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQT 284
           +K+E++ E ++S G+P +K R +++ R   + +MM    +A +I+TNPTHYA+ALRY + 
Sbjct: 222 TKEEVRKEHRESEGDPHVKGRIRNLQRQAAQRRMMADVPKADVIVTNPTHYAVALRYSEK 281

Query: 285 ENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQ 344
           E  AP ++AKG +++A K+R++  EH IPI E P LAR+L++   I   IP   Y AVA+
Sbjct: 282 EGGAPRVLAKGADMVAAKIRELGTEHKIPILEAPPLARALYRHTEIGHQIPEALYAAVAE 341

Query: 345 LIYKIYH 351
           ++  +Y 
Sbjct: 342 VLAYVYQ 348


>gi|304312007|ref|YP_003811605.1| Translocation protein in type III secretion [gamma proteobacterium
           HdN1]
 gi|301797740|emb|CBL45962.1| Translocation protein in type III secretion [gamma proteobacterium
           HdN1]
          Length = 358

 Score =  155 bits (393), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 99/342 (28%), Positives = 186/342 (54%), Gaps = 9/342 (2%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSIL-ACLIYLLFFFSPGIYSVTSDLHVLLA 67
           ++TE P+ K+IEDA  +GN  +SR   L  ++L    I LL    P ++     +H +  
Sbjct: 7   DQTELPTPKRIEDARRDGN--VSRSQDLGKTLLIPVWIGLLGGLLPVLFQRW--IHYVRT 62

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYL--IQRIPVLNLNHVKP 125
           +      ++++ +  L   +S +   L I   L+F    IG ++  +Q   VL L  VKP
Sbjct: 63  TWQNLPPDNLNGL--LDAMMSGAGVFLAILLPLIFFAAAIGVFIEFVQVGKVLALKPVKP 120

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
              R++   G+KR++S  N V   KS  K  L+  +  I L +     L     +  ++ 
Sbjct: 121 DLNRLNPAAGLKRMFSQRNFVELAKSVGKSSLIILLSMIVLRDQLGDTLKLPYGSHETLF 180

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
              + T+R +LI + +    +  +D+ +  + W   L MS+++I+ E K S G+P++K +
Sbjct: 181 AVLWLTLRAMLISVTIAFLLIAAMDVAYQKYAWTKDLMMSRRDIQQEHKNSEGDPMLKGQ 240

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
           ++++ +   +   M +   A++++TNPTHYA+A+ Y + + D P++VAKG++  A+ +R+
Sbjct: 241 RRALHQEWSQENAMGSVRGASVVVTNPTHYAVAIHYEKGKTDLPLVVAKGEDYFARMIRE 300

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIY 347
            A E  +PI E   LAR+L++ + +++ I   F++AVAQL++
Sbjct: 301 AAQEAGVPIMENVDLARALYRDIDVHNPITSEFFEAVAQLLH 342


>gi|253681513|ref|ZP_04862310.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           botulinum D str. 1873]
 gi|253561225|gb|EES90677.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           botulinum D str. 1873]
          Length = 610

 Score =  155 bits (393), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 107/354 (30%), Positives = 183/354 (51%), Gaps = 10/354 (2%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A D+KTE  +  K+ +A  +G  P S+E +    +L   I LL        S   D+   
Sbjct: 261 ASDDKTEEATPHKLSEARKKGQVPKSKEVNSAIILLTSTIILLTLGEYVANSFKKDIIEF 320

Query: 66  LASATQRKLED---ISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNH 122
             +    +L     IS IV +L    +    +V+P     M+ GIG+ L+Q   + +   
Sbjct: 321 FTNYLNIELNSSSLISIIVTVLWRFMIVFLPVVVP----LMIMGIGANLLQTGYINSKEP 376

Query: 123 VKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPH 182
           +KP   +++   G K+++S+  ++  +K    I ++G      L  N+  +L   +    
Sbjct: 377 LKPQLSKINPISGFKKMFSMRTVMELLKDIAVITIIGFAGYGFLKSNFKKVLSMTNLRFP 436

Query: 183 SILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPII 242
            I+         +   + L +  + + D  +   Q+   ++MSKQE+K+E KQ  G+P I
Sbjct: 437 VIITSFLKLTTNIFFRVSLIMFAIALTDFIYQKFQFKKDMRMSKQEVKEEFKQMEGDPQI 496

Query: 243 KNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKK 302
           K + K   R     +MM+    A+++ITNPTH A+AL+Y   +++AP+LVAKG + IA K
Sbjct: 497 KGKIKQKQREMAMGRMMQNVPDASVVITNPTHIAVALKYEDGQDNAPMLVAKGSDYIAIK 556

Query: 303 MRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQ---LIYKIYHKK 353
           +++IA E+++PI E   LAR +FK+V I + IP   Y+AVA+   L+YK+  +K
Sbjct: 557 IKQIAKENDVPIIENKPLARLIFKEVEIENEIPSDMYQAVAEILALVYKLKRRK 610


>gi|297569688|ref|YP_003691032.1| flagellar biosynthetic protein FlhB [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296925603|gb|ADH86413.1| flagellar biosynthetic protein FlhB [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 353

 Score =  155 bits (393), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 97/351 (27%), Positives = 181/351 (51%), Gaps = 1/351 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  +   KTE P+ +++ +A  +G+   S E    + +LA +I L F        VT 
Sbjct: 1   MAEEQSGQEKTEKPTERRLLEARKKGDVAKSMEVPSAAVLLAGVIVLYFTGERMFNQVTG 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L +     L    ++  +     +S   ++ P +L   +  + +  +Q   +   
Sbjct: 61  MMQFYLGNLDTLNLSP-GNMPAISRQALISIFDVLWPLMLTVFIVALLANYMQIGVLFTT 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +KP  +++   +G  R++S   L NF KS  K+ +VG +    +      +L  +   
Sbjct: 120 EKMKPKLEKIDPLKGFGRLFSKQALANFFKSMAKMGVVGYVAYSEVKRALNEILPLMDKA 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P+ I+     T   + +   L IA +  +D  +   Q+  K+KM+KQ++KDE KQ+ G+P
Sbjct: 180 PYPIVMFMTETAFWIFLKCALAIAIIAAIDYAFQRWQFMEKMKMTKQDMKDEGKQTEGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R ++I     R +MM    +A +++TNPT  A+A++Y      AP ++AKG  ++A
Sbjct: 240 HVKGRIRAIQTEMARKRMMAEVPKADVVVTNPTRLAIAIKYDALTMPAPKVLAKGAGVVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            K+R+IA EH +PI E+  LA++L++ V I+  IP   ++AVA+++  +Y+
Sbjct: 300 GKIREIAQEHEVPIVEDKPLAQALYQTVEIDQTIPENLFQAVAEVLAYVYN 350


>gi|89895721|ref|YP_519208.1| hypothetical protein DSY2975 [Desulfitobacterium hafniense Y51]
 gi|89335169|dbj|BAE84764.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 354

 Score =  155 bits (393), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 104/356 (29%), Positives = 181/356 (50%), Gaps = 22/356 (6%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSI-LACLIYLLFFFSPGIYSVTSDL----H 63
            KT   + ++ ++A  +G   + +   + S++ L   I LL F+ P +    S +    +
Sbjct: 7   EKTFQATPRRRQEARKKGQ--VFKSTEMVSALMLVSFIGLLKFYVPTMLEKVSQIFPYVY 64

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
            L A  T R       +  L+  L     ++V P  ++  +   G+  +Q   +  L  +
Sbjct: 65  GLSAEWTAR------SVASLMVDLLWLGVQIVAPLFVVGAVIATGANYLQVRSLFTLEPL 118

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENY--FTMLDFISANP 181
           KP   R+S+  G KR++ +   V  +KS +K+  +G  +  ++ +N+  F ++  ++   
Sbjct: 119 KPQLSRISMISGAKRMFGMKAWVELIKSLLKVTFIGYFLYATIRDNFEIFPVMARLTVGQ 178

Query: 182 HSILYHAFFTVRKVLIMILLF-IATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            ++            I +  F IA +  L   W Y +    LKMS +E+K E KQ+ GNP
Sbjct: 179 GAMFIGGLIVELGWKIALSFFVIAAIDFLYQWWDYEK---NLKMSHEELKQEYKQTEGNP 235

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K   K   R+    +MM+    A +++TNPTHYA+ALRY   EN APV+VAKG + IA
Sbjct: 236 QLKGEIKRKQRAMSMRRMMQDLKTADVVVTNPTHYAVALRYDPKENSAPVVVAKGADEIA 295

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQL---IYKIYHKK 353
           ++++++A ++ I   E   LAR+LF Q  I  A+P   YKAVA++   +Y++  KK
Sbjct: 296 QRIKQLAKDYGIITMENKPLARALFAQAEIGQAVPADLYKAVAEVLAFVYRLKRKK 351


>gi|148266206|ref|YP_001232912.1| flagellar biosynthesis protein FlhB [Geobacter uraniireducens Rf4]
 gi|146399706|gb|ABQ28339.1| flagellar biosynthetic protein FlhB [Geobacter uraniireducens Rf4]
          Length = 354

 Score =  155 bits (393), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 114/363 (31%), Positives = 201/363 (55%), Gaps = 22/363 (6%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISRE----ASLFSSILACLIYLLFFFSPGIY 56
           MSE D   +KTE P+ K+I DA  +GN P SR+     +L + I+A  +   F FS    
Sbjct: 1   MSEQD-KHSKTEQPTGKRISDAKEKGNIPRSRDLTSTVTLMAGIIALYVTGGFMFS---- 55

Query: 57  SVTSDLHVLLAS-ATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRI 115
           ++      LLA  ATQ   +  + +  L+  L  + + ++ P LL+ ++ G+ + + Q  
Sbjct: 56  TLKGSAKELLAGIATQDMTQ--AGVYTLMLKLLFTTTLVLAPFLLVVVVAGLVAEISQGG 113

Query: 116 PVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTI---ITISLTENYFT 172
              +   +   F++++  +G+KR+++ +  V  +KSF+KI++VG +   +      N   
Sbjct: 114 ISTSFEKIGFDFEKLNPVQGVKRLFNKDAAVQVLKSFLKIVIVGYMAYRVMRDEVNNLIY 173

Query: 173 MLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDE 232
           ++D         + H  F   K+++     +  L+VLD+ +   ++   LKM+KQE+KDE
Sbjct: 174 LVDMDIGGITEFIGHISF---KIVLHTCGALFILSVLDLIFVKWRFIENLKMTKQEVKDE 230

Query: 233 IKQSYGNPIIKNR--QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPV 290
            K S G+P IK +  QK   ++R R +++  T  A +++TNPTH+A+AL+Y + +  APV
Sbjct: 231 NKDSEGDPHIKGKIKQKQFEQARRRMRLIIPT--ADVVVTNPTHFAVALKYDRQKMAAPV 288

Query: 291 LVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           ++AKG + +A+++++IA E NI + E   LAR L+ QV     IP   Y AVA+++  +Y
Sbjct: 289 VLAKGADFLAQRIKEIARESNITLVENRFLARELYAQVKEGEEIPEALYAAVAEILAYVY 348

Query: 351 HKK 353
             K
Sbjct: 349 SLK 351


>gi|289208350|ref|YP_003460416.1| flagellar biosynthetic protein FlhB [Thioalkalivibrio sp. K90mix]
 gi|288943981|gb|ADC71680.1| flagellar biosynthetic protein FlhB [Thioalkalivibrio sp. K90mix]
          Length = 383

 Score =  155 bits (392), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 104/368 (28%), Positives = 185/368 (50%), Gaps = 31/368 (8%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN++   KTE P+ K++ +A  +G  P SRE S F  ++A   ++ FF          
Sbjct: 1   MAENESGQEKTEQPTPKRLREAKEKGQVPRSRELSTFLVLMAAGGFMTFF--------GP 52

Query: 61  DLHVLLASATQRKLE-------DISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQ 113
            L   LA  T  + +       D S ++  L+       R ++P   + M+  + + ++ 
Sbjct: 53  TLGGQLAEQTAGRFDIERDLAYDSSLLLPYLSEQIFMTLRTLLPLFGVLMVAAVLAPILI 112

Query: 114 RIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTM 173
                +    KP   +++  +G+KRI+S   L+ F K+F K +LV  +  +S+   +   
Sbjct: 113 GGANFSWQAAKPKASKLNPLKGLKRIFSWQGLMEFGKTFAKFVLVAGV-AMSVLWTFSDR 171

Query: 174 LDFISANP-HSILYHA-------FFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMS 225
           L  +   P    + HA       F  V   LI++    A   +    W++ +   +L+M+
Sbjct: 172 LLMLGYEPLEQAITHAAQLALGTFVAVSAALILVAAIDAPFQM----WNHQK---QLRMT 224

Query: 226 KQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTE 285
           +QE+KDE K++ G P +K + + + +   + +MME   +A ++ITNPTHYA+A+ Y  + 
Sbjct: 225 RQELKDEYKETDGKPEVKQKIRQLQQEMAQRRMMEEVPKADVVITNPTHYAVAITYEASR 284

Query: 286 NDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQL 345
             AP LVAKG + +A  +R +A EH I   E P +AR+++    +N  IP   + AVA++
Sbjct: 285 MAAPKLVAKGVDEVAASIRAVADEHKIIRVEAPRVARAIYFTTDLNQEIPNGLFVAVARI 344

Query: 346 IYKIYHKK 353
           +  +Y  K
Sbjct: 345 LAYVYQLK 352


>gi|325920558|ref|ZP_08182480.1| flagellar biosynthetic protein FlhB [Xanthomonas gardneri ATCC
           19865]
 gi|325548951|gb|EGD19883.1| flagellar biosynthetic protein FlhB [Xanthomonas gardneri ATCC
           19865]
          Length = 376

 Score =  155 bits (392), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 92/351 (26%), Positives = 180/351 (51%), Gaps = 1/351 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE++    +TE P+ K++ +A  +GN P SRE S  +++    ++ L   + GI    S
Sbjct: 1   MSESEDGGERTELPTEKRLREAREQGNIPQSRELST-AAVFGAGVFGLMALARGIGDGAS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
                  S   +  E+   +      L L    +++P + + +  G+   L+      + 
Sbjct: 60  VWMKTALSPDPKMRENPMALFGHFGDLLLQLLWVMVPLIGICLAAGLAGPLLMSGLHFSG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   +++   GIKR++  N+L   +KS ++++ VG   ++ +++    +   ++  
Sbjct: 120 KAIMPDLNKLNPANGIKRMWGSNSLAELVKSVLRLLFVGLAASLCISKGLHGLRSLVNQP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + +     + +L      +  L  +D  +    W  KLKM+++EIK E+K+S G+P
Sbjct: 180 LEQAVGNGLDFTKSLLFYTAGALVLLAAIDAPYQKWNWMRKLKMTREEIKREMKESEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + +     + +MMEA  +A +++ NPTHYA+AL+Y   +  AP++VAKG + +A
Sbjct: 240 EVKGRIRQMQMQMSQRQMMEAVPKADVVLMNPTHYAVALKYEGGKMRAPIVVAKGVDEMA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            ++R++  +H + I   P LAR+L+++  I   IP   Y  VAQ++  +Y 
Sbjct: 300 FRIREVCEQHRVSIVTAPPLARALYREAQIGKEIPVRLYSVVAQVLSYVYQ 350


>gi|30250406|ref|NP_842476.1| flagellar biosynthesis protein FlhB [Nitrosomonas europaea ATCC
           19718]
 gi|30181201|emb|CAD86399.1| FlhB HrpN YscU SpaS Family [Nitrosomonas europaea ATCC 19718]
          Length = 376

 Score =  155 bits (392), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 105/365 (28%), Positives = 184/365 (50%), Gaps = 32/365 (8%)

Query: 6   APDN---KTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDL 62
           A DN   +TE  S +++E A  EG    S+E + F+ ++A    L    S  I  +++ L
Sbjct: 2   ADDNDLERTEPASPRRLEKAREEGQVARSQELTTFTLLIAASSSLWVIGSIIIQKLSAVL 61

Query: 63  H--------------VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIG 108
                          +LL    Q  L+ +  I  LL  L + A  LV P LL   +F   
Sbjct: 62  ESGLRMEQEVAFNPALLLPRLFQLALDGLLAIAPLLGWLVIIA--LVAPMLLSGWLFSSK 119

Query: 109 SYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTE 168
           +               P  KR++   G+KRI+S   L+  +K+  K++++G +    +  
Sbjct: 120 ALF-------------PDLKRLNPVNGLKRIFSSRGLIELVKAIAKVMVIGGVAAGIIWS 166

Query: 169 NYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQE 228
           +   +LD +     + L      +    ++I+  +  + V+D+ +       +L+MS+++
Sbjct: 167 HKQDVLDLVGMPLDTSLISMSRLIGLTFMLIVGAMLLIVVIDVPFQIWNHARQLRMSRED 226

Query: 229 IKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDA 288
           ++ E K+  G+P +K R +++ R   R +MM    +A +++TNPTHYA+AL+Y      A
Sbjct: 227 LRKEAKEDEGDPQVKGRIRNMQRQIARRRMMAEVPKADVVVTNPTHYAVALKYQDRSMRA 286

Query: 289 PVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYK 348
           P +VAKG  LIA ++R++A EH+IP+ E P LAR+L+  V +++ IP   Y AVA ++  
Sbjct: 287 PKVVAKGTQLIAARIRELADEHHIPVLEVPPLARALYHHVELDTEIPETLYTAVAHVLAY 346

Query: 349 IYHKK 353
           I+  K
Sbjct: 347 IFQLK 351


>gi|219670145|ref|YP_002460580.1| flagellar biosynthetic protein FlhB [Desulfitobacterium hafniense
           DCB-2]
 gi|219540405|gb|ACL22144.1| flagellar biosynthetic protein FlhB [Desulfitobacterium hafniense
           DCB-2]
          Length = 350

 Score =  155 bits (392), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 103/353 (29%), Positives = 179/353 (50%), Gaps = 19/353 (5%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSI-LACLIYLLFFFSPGIYSVTSDL----H 63
            KT   + ++ ++A  +G   + +   + S++ L   I LL F+ P +    S +    +
Sbjct: 3   EKTFQATPRRRQEARKKGQ--VFKSTEMVSALMLVSFIGLLKFYVPTMLEKVSQIFPYVY 60

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
            L A  T R       +  L+  L     ++V P  ++  +   G+  +Q   +  L  +
Sbjct: 61  GLSAEWTAR------SVASLMVDLLWLGVQIVAPLFVVGAVIATGANYLQVRSLFTLEPL 114

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENY--FTMLDFISANP 181
           KP   R+S+  G KR++ +   V  +KS +K+  +G  +  ++ +N+  F ++  ++   
Sbjct: 115 KPQLSRISMISGAKRMFGMKAWVELIKSLLKVTFIGYFLYATIRDNFEIFPVMARLTVGQ 174

Query: 182 HSILYHAFFTVRKVLIMILLF-IATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            ++            I +  F IA +  L   W Y +    LKMS +E+K E KQ+ GNP
Sbjct: 175 GAMFIGGLIVELGWKIALSFFVIAAIDFLYQWWDYEK---NLKMSHEELKQEYKQTEGNP 231

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K   K   R+    +MM+    A +++TNPTHYA+ALRY   EN APV+VAKG + IA
Sbjct: 232 QLKGEIKRKQRAMSMRRMMQDLKTADVVVTNPTHYAVALRYDPKENSAPVVVAKGADEIA 291

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           ++++++A ++ I   E   LAR+LF Q  I  A+P   YKAVA+++  +Y  K
Sbjct: 292 QRIKQLAKDYGIITMENKPLARALFAQAEIGQAVPADLYKAVAEVLAFVYRLK 344


>gi|298528402|ref|ZP_07015806.1| type III secretion exporter [Desulfonatronospira thiodismutans
           ASO3-1]
 gi|298512054|gb|EFI35956.1| type III secretion exporter [Desulfonatronospira thiodismutans
           ASO3-1]
          Length = 359

 Score =  155 bits (392), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 106/355 (29%), Positives = 190/355 (53%), Gaps = 12/355 (3%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGI---YS 57
           M + D   +KTE  + K+ + A  +GN P S+E     S++A ++ L  FF P I   Y 
Sbjct: 1   MPQKDP--SKTEDATPKRRKKAREQGNVPKSQEMPKIISLIAGILALRLFF-PHIRDTYM 57

Query: 58  VTSDLHVLLASATQRKLEDISHI-VFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIP 116
             ++  +  A   Q   E + H+ VF + +++     +++P +L+     I +  +Q   
Sbjct: 58  EMTEWFMDQAFHYQLNPESLYHLAVFSIQNIA----SMLLPFMLIVFFVTIVAIYLQVGF 113

Query: 117 VLNLNHVKPSFKRVSLREGIKRIY-SINNLVNFMKSFVKIILVGTIITISLTENYFTMLD 175
           +     +KP  K  ++ EG+K+ +  +N LV  +K+      V T   I +T  +   L 
Sbjct: 114 LWTFKPLKPKMKIFNVVEGLKKKFLDLNTLVRLVKNVGIASAVATAPYIIITSEFENFLP 173

Query: 176 FISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQ 235
               +P  I+ +   T  K+ ++ ++ +  + + D+ ++   +   LKM+K E+KDE KQ
Sbjct: 174 LFYEDPPFIVAYILNTAFKMAMLAMIPLLIIAIADVAYTRWDYEQNLKMTKDEVKDERKQ 233

Query: 236 SYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKG 295
           + GNP +K  Q+   +S  + +M +   +A ++ITNPTH A+A++Y      AP+++AKG
Sbjct: 234 AEGNPEVKKEQRKKMQSTTQQRMRQEVPKADVVITNPTHLAVAIKYDPVLAPAPMVLAKG 293

Query: 296 QNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
            N  A+K+++IA E+NIPI E   LA++L+K V     IP   YKAVA ++ ++Y
Sbjct: 294 ANFRAEKIKEIARENNIPIRENKPLAQALYKNVQEGETIPEDMYKAVASILAQLY 348


>gi|114566403|ref|YP_753557.1| flagellar biosynthesis/type III secretory pathway protein
           [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
 gi|114337338|gb|ABI68186.1| flagellar biosynthesis/type III secretory pathway protein
           [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
          Length = 369

 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 100/350 (28%), Positives = 184/350 (52%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D    KTE  + ++ E+A  +G    S + +    ++A  +     F   + ++ S   
Sbjct: 17  DDGMGEKTEKATPRRREEARKKGQVFKSTDLNSAIILIAGSVASFMAFPYMVNNLKSFTT 76

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
           + L   TQ+   +  +I F+L  + +   +++ P  L   +  +    +Q   V +   +
Sbjct: 77  LYLLQRTQQDFSN-DYIYFMLLEVLIIMGKMIFPIFLTTFIVALLITYLQVGFVFSGESL 135

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
            P  +R++  EG KRI+S   LV   KS +K+I+ G I+   + ++Y     FI     +
Sbjct: 136 TPKLERLNPVEGFKRIFSKRALVELGKSLLKVIVTGYIVYSVMRKHYILFPRFIDMELIA 195

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            L      V ++ + + L    + + D  + +++    LKMSK EIK E KQ+ G+P +K
Sbjct: 196 GLQVLSSIVFEMAMKVGLVFIIIGIADYIFQWYEHEKSLKMSKYEIKQEYKQTEGDPQLK 255

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
           +RQ+ I R     +MM    +A ++ITNPTH+A+ L+Y  ++ +APV+VA+G++ +A K+
Sbjct: 256 SRQRRIQRDIAMQRMMAEVPKADVVITNPTHFAVVLKYEASKMEAPVVVARGKDFMALKI 315

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           ++IA  H + I E P LAR+L+    I   +P   Y+AVA+++  +Y +K
Sbjct: 316 KEIARMHGVVIVENPVLARTLYYNTEIGDLVPEELYQAVAEVLAFVYKQK 365


>gi|322382375|ref|ZP_08056282.1| flagellar biosynthesis protein FlhB [Paenibacillus larvae subsp.
           larvae B-3650]
 gi|321153728|gb|EFX46103.1| flagellar biosynthesis protein FlhB [Paenibacillus larvae subsp.
           larvae B-3650]
          Length = 378

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 84/232 (36%), Positives = 142/232 (61%), Gaps = 2/232 (0%)

Query: 123 VKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPH 182
           +K  F +++  EG KRI+S+  +++F+KS +K+I++  I+ +++      ++        
Sbjct: 144 LKMKFNKINPIEGAKRIFSLRAIIDFLKSTIKMIVIAAIVWMTIWGEKDKLISLGHVPLQ 203

Query: 183 SIL-YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPI 241
            +L Y    TV+  L +  + IA +  LD  +   ++   L+MSKQEIKDE K+S G+P+
Sbjct: 204 DMLPYIGSLTVQLGLKIGGVLIA-IAALDYMYQKFEYEKSLRMSKQEIKDEFKKSEGDPL 262

Query: 242 IKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAK 301
           IK + +   R     +MM+   +A +IITNPTH+A+ALRY   E +AP ++AKG +LIA 
Sbjct: 263 IKGKIRERQRRMAMQRMMQEVPKADVIITNPTHFAVALRYDAAEMEAPAVIAKGTDLIAL 322

Query: 302 KMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           K++++A E+ + I E   LAR+L+ QV I  AIP   ++AVA+++  +Y  K
Sbjct: 323 KIKEVAKENGVTIMENKPLARALYAQVEIGQAIPADLFQAVAEVLAYVYKAK 374


>gi|206603139|gb|EDZ39619.1| flagellar biosynthesis protein, FlhB [Leptospirillum sp. Group II
           '5-way CG']
          Length = 362

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 105/348 (30%), Positives = 183/348 (52%), Gaps = 1/348 (0%)

Query: 5   DAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHV 64
           D  + K E P+++K+E A  EG    SRE      +LA L+         +  + + +  
Sbjct: 3   DEFEQKQEEPTARKLEKAREEGQVARSREVGSLFFLLAALLLFGSVGHTVVVGLENQMEQ 62

Query: 65  LLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVK 124
               A   +L   S I   L  +  +  +   P    F+   I ++L Q  PV ++  + 
Sbjct: 63  GFVEAPSIRLTPDS-IGPYLGKILWNTLKTGFPLWGGFLAASILAFLFQGPPVWSVKALV 121

Query: 125 PSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSI 184
           P ++RVS  +G+ R++S  +L+   K  VK++LV  ++  SL  ++  +    +A  H  
Sbjct: 122 PKWERVSPVKGMGRLFSGRSLIELAKYLVKVLLVMFVVLWSLRGDWERLPALQAAGVHRF 181

Query: 185 LYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKN 244
                  +R  L  ++     + +LD      Q    L+M++ EI++E K++ G+P +++
Sbjct: 182 FGALTGFLRDALYRLIPLFVVIAILDFLLQRIQLNRSLRMTRSEIREEFKETEGDPHVRS 241

Query: 245 RQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMR 304
           R +SI R+  R +MM     AT+++TNPTH+A+A+RY      APV+VAKGQ+ +A  +R
Sbjct: 242 RIRSIQRAMARRRMMAKVKTATVVVTNPTHFAVAIRYEPMTMAAPVVVAKGQDEVALNIR 301

Query: 305 KIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
           KIA E  +P+ E P LAR+L+   P++  IP  FY+AVA+++  +Y +
Sbjct: 302 KIAREARVPVMENPPLARTLYAACPLDREIPVEFYQAVAEILSLLYER 349


>gi|190574224|ref|YP_001972069.1| flagellar biosynthesis protein FlhB [Stenotrophomonas maltophilia
           K279a]
 gi|190012146|emb|CAQ45769.1| putative flagellar biosynthetic protein FlhB [Stenotrophomonas
           maltophilia K279a]
          Length = 376

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 94/354 (26%), Positives = 173/354 (48%), Gaps = 7/354 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISRE---ASLFSSILACLIYLLFFFSPGIYS 57
           MSEN++   KTE P+ K++ DA  +GN P SRE   A++F + +  ++ +      G  +
Sbjct: 1   MSENESAGEKTEQPTEKRLRDAREQGNLPRSRELGTAAVFGAGVLAVMAMSGSIGRGASA 60

Query: 58  VTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPV 117
                        Q   E   H   LL    L    ++ P +L+ ++    + L+     
Sbjct: 61  WMKHALSPEQGLRQNPKELFGHFGDLLLQFML----VIAPLVLVCLLASFVAPLVMGGLR 116

Query: 118 LNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFI 177
            +   + P   R++   G+KR+Y    +  F KS +++  VG    + +   + T+   I
Sbjct: 117 WSQKALLPDINRMNPMSGLKRLYGPEAIAEFTKSLLRVAFVGVAAGLVVWTGFDTLRGLI 176

Query: 178 SANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSY 237
                + +        ++L+     +  L  +D  +    W  KLKM+++E++ E+K+S 
Sbjct: 177 HHPLETAITDGLGFTLRLLLATAGAMLVLAAIDAPYQRWNWMRKLKMTREELRREMKESE 236

Query: 238 GNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQN 297
           G+P +K R + + +     +MMEA   A +++ NPTHYA+AL+Y     +AP +VA G +
Sbjct: 237 GSPEVKGRIRQLQQQMANRRMMEAVPTADVVVVNPTHYAVALKYEGGTMNAPTVVALGVD 296

Query: 298 LIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
             A ++R++A  + + I   P LAR+L+++  +   IP   Y AVAQ++  +Y 
Sbjct: 297 ETALRIREVADGNKVAIVSAPPLARALYREGQLGKEIPVRLYSAVAQVLSYVYQ 350


>gi|325981881|ref|YP_004294283.1| flagellar biosynthetic protein FlhB [Nitrosomonas sp. AL212]
 gi|325531400|gb|ADZ26121.1| flagellar biosynthetic protein FlhB [Nitrosomonas sp. AL212]
          Length = 379

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 109/367 (29%), Positives = 188/367 (51%), Gaps = 35/367 (9%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE ++   +TE  + +++E A  EG    S+E + F+ ++A  + +L            
Sbjct: 1   MSE-ESDLERTEEATPRRLEKAREEGQVVRSQELTSFTLLMAAAVGIL------------ 47

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSY---------L 111
               +L SA   KL  I      L       S L+I     F + G+ S          +
Sbjct: 48  ----MLGSALMEKLVKIMQSGMQLDRELAFQSELMINRFYEFAIEGLISMAPLLFLLLVV 103

Query: 112 IQRIPVL------NLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITIS 165
               P+L      +   V P FKR+   +G  RI+S+ +L+  +K+ +K IL+G +  + 
Sbjct: 104 AFFAPMLLSGWLVSAKAVIPDFKRIDPIKGFGRIFSMRSLIELVKAILKTILIGGVAALV 163

Query: 166 LTENYFTMLDFISANPH-SILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKM 224
           +  N  +++  ++ +    I     F     L++I   I  + V D+ +   +   +L+M
Sbjct: 164 IWHNKDSVMALLTVSIDLGISRTGDFLAMSFLLIISAMIIIVAV-DVPFQIWEHAKQLRM 222

Query: 225 SKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQT 284
           +K++++ E K+S G+P +K R +++ R   R +MM    +A +I+TNPTHYA+ALRY Q+
Sbjct: 223 TKEDVRKEYKESEGDPYVKARIRNLQREAARRRMMSEIPKADVIVTNPTHYAVALRY-QS 281

Query: 285 ENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQ 344
              AP +VAKG +L+A ++R+IA EH IPI E P LAR+L+    + S IP   Y AVA+
Sbjct: 282 NMRAPKVVAKGVHLLAARIREIATEHRIPILEAPPLARALYHHTELESEIPEKLYTAVAE 341

Query: 345 LIYKIYH 351
           ++  ++ 
Sbjct: 342 VLAYVFQ 348


>gi|319790410|ref|YP_004152043.1| flagellar biosynthetic protein FlhB [Thermovibrio ammonificans
           HB-1]
 gi|317114912|gb|ADU97402.1| flagellar biosynthetic protein FlhB [Thermovibrio ammonificans
           HB-1]
          Length = 347

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 105/355 (29%), Positives = 189/355 (53%), Gaps = 26/355 (7%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASL-FSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
           +KTE  + ++ + A  EG    S++ S+ FS +L  +   LFF+ P  ++    L +   
Sbjct: 6   SKTEKATPRRRQKAREEGQVLRSQDLSIAFSLVLVAVT--LFFYLP--FAFRELLKLFNY 61

Query: 68  SATQRKLEDISHIVFL-LTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
           +  +    +++  VF+ L  L+L    L  P  L+ ++ G+ S ++Q   +  L  + P 
Sbjct: 62  TFEELPFLELNQFVFVSLEILAL----LTFPVFLVLLVGGVLSNVVQFGFLFTLKPLVPK 117

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTI--ITISLTENYFTMLDFISANPHSI 184
              ++  +G +R++S+  L   +KS VK+     +    +     YFT     S     +
Sbjct: 118 LDPINPVKGFQRLFSLKTLFELVKSLVKLGFASAVGYFAVKYLTRYFT-----SYASFPL 172

Query: 185 LYHAFFTVRKVLIMILLF------IATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYG 238
               ++  + ++++++ F      +A L  L   W Y +    LKMSKQE+K+E KQ  G
Sbjct: 173 EVQLYYLAKSLVVLVVAFALLAVPVAGLDFLYRRWEYEE---NLKMSKQEVKEERKQYEG 229

Query: 239 NPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL 298
           +P+IK+  +   R     +MM    +A ++ITNP HYA+AL+Y + +  AP +VAKG + 
Sbjct: 230 HPLIKSEIRKRQRQLAMRRMMAEVPKADVVITNPEHYAVALKYERGKMYAPKVVAKGVDS 289

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +A K+++IA EH +P+ E P LAR+L++   +   IP  FY+AVA+++ KIY ++
Sbjct: 290 VALKIKEIALEHGVPVEENPPLARALYESCEVGDFIPEEFYRAVARILAKIYRRR 344


>gi|167464149|ref|ZP_02329238.1| flagellar biosynthesis protein FlhB [Paenibacillus larvae subsp.
           larvae BRL-230010]
          Length = 363

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 84/232 (36%), Positives = 142/232 (61%), Gaps = 2/232 (0%)

Query: 123 VKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPH 182
           +K  F +++  EG KRI+S+  +++F+KS +K+I++  I+ +++      ++        
Sbjct: 129 LKMKFNKINPIEGAKRIFSLRAIIDFLKSTIKMIVIAAIVWMTIWGEKDKLISLGHVPLQ 188

Query: 183 SIL-YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPI 241
            +L Y    TV+  L +  + IA +  LD  +   ++   L+MSKQEIKDE K+S G+P+
Sbjct: 189 DMLPYIGSLTVQLGLKIGGVLIA-IAALDYMYQKFEYEKSLRMSKQEIKDEFKKSEGDPL 247

Query: 242 IKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAK 301
           IK + +   R     +MM+   +A +IITNPTH+A+ALRY   E +AP ++AKG +LIA 
Sbjct: 248 IKGKIRERQRRMAMQRMMQEVPKADVIITNPTHFAVALRYDAAEMEAPAVIAKGTDLIAL 307

Query: 302 KMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           K++++A E+ + I E   LAR+L+ QV I  AIP   ++AVA+++  +Y  K
Sbjct: 308 KIKEVAKENGVTIMENKPLARALYAQVEIGQAIPADLFQAVAEVLAYVYKAK 359


>gi|224419239|ref|ZP_03657245.1| flagellar biosynthesis protein FlhB [Helicobacter canadensis MIT
           98-5491]
 gi|253826957|ref|ZP_04869842.1| flagellar biosynthesis protein [Helicobacter canadensis MIT
           98-5491]
 gi|313142741|ref|ZP_07804934.1| flagellar biosynthesis protein FlhB [Helicobacter canadensis MIT
           98-5491]
 gi|253510363|gb|EES89022.1| flagellar biosynthesis protein [Helicobacter canadensis MIT
           98-5491]
 gi|313131772|gb|EFR49389.1| flagellar biosynthesis protein FlhB [Helicobacter canadensis MIT
           98-5491]
          Length = 357

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 106/359 (29%), Positives = 188/359 (52%), Gaps = 32/359 (8%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILA--CLIYLLF-FFSPGIYSVTSDLHV 64
           + KTEAPS++KIE A  EGN   S + + F  ++    LI+L F F+  G+ ++  +++ 
Sbjct: 5   EEKTEAPSARKIEKAREEGNVIKSPDVNAFLGLVVGLVLIFLCFNFWVDGLSAIFFEVYH 64

Query: 65  LLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVK 124
           +      R     S+ + L   L      L+ P     M+ GI + + Q   +L    ++
Sbjct: 65  IFNQDLTR-----SNAISLTISLVFKILYLLAPIFGALMLIGIVANISQSGFLLTTKAIQ 119

Query: 125 PSFKRVSLREGIKRIYSINNLVN-FMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           P  ++++   G+K I S+  L++ F+ +F   +L   II       +F  L F+      
Sbjct: 120 PKLQKLNFISGLKNIISLKKLLDGFLITFK--VLTAFIIA------FFVFLGFM----KE 167

Query: 184 ILYHAFFTVRKVLIMI-----------LLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDE 232
           +   + F +   +I +           L F   + + D     +Q++  L+MSKQE+KDE
Sbjct: 168 LTTVSLFPIGDQMIWLKDKALILIAILLAFFLVMAITDYLIKRYQYFKSLRMSKQEVKDE 227

Query: 233 IKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLV 292
            K   G+  +K + +S+     + +MM+    A +++TNPTHYA+ALRY  T+  AP ++
Sbjct: 228 FKNQEGDQQVKGKIRSLMFQAAKKRMMQNIPNADVVVTNPTHYAVALRYDSTKERAPRVL 287

Query: 293 AKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           AKG + +A+++++IA E+ IPI E P LAR+L+K V I+  IP   Y+A+ +++ K+  
Sbjct: 288 AKGVDFLAQRIKEIAKENEIPIIENPPLARALYKDVDIDKEIPETLYQAMVEILIKVQQ 346


>gi|115523575|ref|YP_780486.1| flagellar biosynthesis protein FlhB [Rhodopseudomonas palustris
           BisA53]
 gi|115517522|gb|ABJ05506.1| flagellar biosynthetic protein FlhB [Rhodopseudomonas palustris
           BisA53]
          Length = 356

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 106/346 (30%), Positives = 188/346 (54%), Gaps = 3/346 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS++D+ + KTE P+ K+++DA   G+   S+E + +  I    + L  F       + +
Sbjct: 1   MSDDDSSE-KTEDPTQKRLDDAHQRGDVAKSQEVNTWFVIAGGTLVLSSFSGSIGAGLQN 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  LL ++   + +    +    T + +  + L +P LL+ M+  +   ++Q   V + 
Sbjct: 60  PLRNLLENSWMIRTDGPGLLALAQTLIYVVIAALGVP-LLMLMIAAVAGNVLQHRLVFSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +KP F ++S  +G KR++       F+K   KII +G ++   L      +   +  +
Sbjct: 119 EGLKPKFSKLSPMQGAKRLFGKQAWATFLKGLFKIIALGAVMVAVLWPERHRLEAMVRFD 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             +++        ++L  ++  +A + V D  + Y  WY K KMS QEIK+E KQS G+P
Sbjct: 179 VAALMGTTITLTLQLLGAVVAMLAAVAVADFFFQYRTWYEKQKMSLQEIKEEHKQSEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK + + +   R+R +MM A  +A+++ITNPTHY++AL Y ++   APV VAKG + +A
Sbjct: 239 HIKGKLRQLRMQRMRQRMMAAVPKASVVITNPTHYSVALSY-ESGMQAPVCVAKGADAVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
            K+R++A  +++PI E   LAR+L+  V I+  +P   Y AVA++I
Sbjct: 298 LKIREVAKANDVPIVENVPLARALYATVKIDEEVPVEHYHAVAEVI 343


>gi|242309640|ref|ZP_04808795.1| flagellar biosynthesis protein FlhB [Helicobacter pullorum MIT
           98-5489]
 gi|239523641|gb|EEQ63507.1| flagellar biosynthesis protein FlhB [Helicobacter pullorum MIT
           98-5489]
          Length = 354

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 108/360 (30%), Positives = 184/360 (51%), Gaps = 30/360 (8%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILA--CLIYLLF-FFSPGIYSVTSDL 62
           A + KTEAPS++KIE A  EGN   S + + F  ++    LI+L F F+  GI ++   +
Sbjct: 2   ADEEKTEAPSARKIEKAREEGNVLKSPDVNAFLGLVVGLVLIFLCFNFWVDGISNIFFQI 61

Query: 63  HVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNH 122
           +        R     S  + +   L+     L+ P     ++ GI + + Q   +L    
Sbjct: 62  YNSFNQDLTR-----SDAISITISLTFQILYLLAPIFGALVLTGIVANISQSGFLLTTKA 116

Query: 123 VKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPH 182
           ++P  ++++   GIK I S+  L++    F+    V T   I+    +F  L F+     
Sbjct: 117 IQPKLQKLNFITGIKNIISLKKLLD---GFLITFKVMTAFIIA----FFVFLGFM----K 165

Query: 183 SILYHAFFTVRKVLIMI-----------LLFIATLTVLDIGWSYHQWYSKLKMSKQEIKD 231
            +   + F +   +I +           L F   + + D     +Q++  L+MSKQE+KD
Sbjct: 166 ELTTVSLFPIGDQMIWLKDKALILIAILLAFFLVMAITDYLIKRYQYFKSLRMSKQEVKD 225

Query: 232 EIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVL 291
           E K   G+  IK + +S+     + +MM+    A +++TNPTHYA+ALRY  T+  AP +
Sbjct: 226 EFKNQEGDQQIKGKIRSLMFQAAKKRMMQNIPSADVVVTNPTHYAVALRYDSTKERAPRV 285

Query: 292 VAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           +AKG + +A++++ IA EH IPI E P LAR+L+K V I+  IP   Y+A+ +++ K+  
Sbjct: 286 LAKGVDFLAQRIKDIAKEHEIPIIENPPLARALYKDVDIDKEIPETLYQAMIEVLIKVQQ 345


>gi|323158635|gb|EFZ44649.1| flagellar biosynthetic protein FlhB [Escherichia coli E128010]
          Length = 382

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 107/367 (29%), Positives = 197/367 (53%), Gaps = 35/367 (9%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGI-------- 55
           +D  D+KTEAP+  ++E A  EG  P SRE    +S+L  L+ +   +  G+        
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRE---LTSLLILLVGVSVIWFGGVSLARRLSG 58

Query: 56  ---------YSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFG 106
                    +S+ +D +++L        E +  ++ L++ + L A  L+ P +L  ++F 
Sbjct: 59  MLSAGLHFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVA--LISPVMLGGLVFS 116

Query: 107 IGSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISL 166
             S             ++P F +++   GIKR++S       +K+ +K ILVG++    L
Sbjct: 117 GKS-------------LQPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFL 163

Query: 167 TENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSK 226
             ++  M+  ++ +P + + +A   V   +++++L +  +   D+ +       KL+MS+
Sbjct: 164 WHHWPQMMRLMAESPITAMGNAMDLVGLCVLLVVLGVIPMVGFDVFFQIFSHLKKLRMSR 223

Query: 227 QEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEN 286
           Q+I+DE KQS G+P +K R + + R+  R +MM    +A +I+ NPTHY++AL+Y + + 
Sbjct: 224 QDIRDEFKQSEGDPHVKGRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKM 283

Query: 287 DAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
            AP +VAKG  L+A ++R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++
Sbjct: 284 SAPKVVAKGAGLVALRIREIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVL 343

Query: 347 YKIYHKK 353
             ++  K
Sbjct: 344 AWVWQLK 350


>gi|291558215|emb|CBL35332.1| flagellar biosynthetic protein FlhB [Eubacterium siraeum V10Sc8a]
          Length = 353

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 100/351 (28%), Positives = 182/351 (51%), Gaps = 6/351 (1%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A + KTE  + KK +D   +G    S+E ++   ++    +L  F   G Y     L+ +
Sbjct: 2   AGEEKTEKATPKKRKDTRKKGEVLQSKEVAVAVFVVGIFAFLAIF---GNYMFQMLLNFM 58

Query: 66  LASAT--QRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             S +   +    +   + +   +++     V P L + ++  +   ++Q   + ++  +
Sbjct: 59  EQSMSSIDKTGNTVEFAMSVFWKVAIICVCTVGPILAVGVVLSVLPVIVQTKGLFSMEAM 118

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           KP F R++   GIKR++S+  LV  +K  ++II+V  I+   + +        I  +   
Sbjct: 119 KPKFSRLNPFTGIKRLFSMQALVGLVKGLIEIIVVVAILYFQVMDRINEFKKLIDTDVIK 178

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
           I+ +   T   +++ I + +  +   D  + +  +  KLKMSKQE+KDE KQ  G+P IK
Sbjct: 179 IVAYISETAMSLIVTIFVMLVFVAAADYVFQWWSFEKKLKMSKQEVKDEYKQLEGDPQIK 238

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYI-QTENDAPVLVAKGQNLIAKK 302
            + K   +   + +MM+    A +++ NPTHYA+AL+Y  +T   APV+VAKG + +A +
Sbjct: 239 GKIKRKQQEMAQQRMMQEVPSADVVVRNPTHYAVALKYDRKTAYRAPVVVAKGTDALALR 298

Query: 303 MRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +  +A EHN+ I E   LAR L++ V I   IP  FY AVA+++  +Y ++
Sbjct: 299 IVAVAEEHNVYITENRPLARGLYEAVDIGQEIPREFYTAVAEVLAMVYEEQ 349


>gi|317051542|ref|YP_004112658.1| flagellar biosynthetic protein FlhB [Desulfurispirillum indicum S5]
 gi|316946626|gb|ADU66102.1| flagellar biosynthetic protein FlhB [Desulfurispirillum indicum S5]
          Length = 354

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 112/372 (30%), Positives = 187/372 (50%), Gaps = 47/372 (12%)

Query: 5   DAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHV 64
           ++   KTE P+ KK+E A  EGN   S++ S  + + A ++ L F            LH 
Sbjct: 4   ESDQEKTEEPTPKKLEKAREEGNVAKSKDMSDTAVLFAGVMTLYF------------LH- 50

Query: 65  LLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVL------ 118
                 +R LE      F +    L  +R   P +     FGI + L+Q + +L      
Sbjct: 51  ------ERMLEGF----FAIMRNYLDLTRNTFPTINEMPSFGI-TILLQMLHILWPLFLA 99

Query: 119 --------NLNH---------VKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTI 161
                   N+           V P + +++  +GI + +S+ NL+   KS +K+ + G +
Sbjct: 100 LTLFALAINIGQIGLLWSSKAVAPKWSKLNPIKGIAQKFSLKNLIEVTKSLLKVSVFGPV 159

Query: 162 ITISLTENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSK 221
                 + + ++L  +   P  I   A   + K+ I I+L +  ++ +D  +  +Q + K
Sbjct: 160 AYFIAKDEFGSILMMMHLTPIEIFATALMIIFKIWITIILIMLIVSAVDFYFQKYQHHEK 219

Query: 222 LKMSKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRY 281
           LKMSKQE+K+E KQ  GNP +K R +S+ R     +MM    ++ ++ITNP   A+AL+Y
Sbjct: 220 LKMSKQEVKEERKQMDGNPEVKQRIRSLQREMAMKRMMGDVPKSDVVITNPLFLAVALKY 279

Query: 282 IQTENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKA 341
                 AP LVAKGQ L+A+++R +A EH+IPI ++P LAR L+  +     I    Y+A
Sbjct: 280 DTEVKAAPYLVAKGQELVAQRIRDLALEHDIPIQQDPLLARQLYDSLEPGDEITHELYQA 339

Query: 342 VAQLIYKIYHKK 353
           VA+++ +IY +K
Sbjct: 340 VAEILAEIYRQK 351


>gi|117617532|ref|YP_855917.1| flagellar biosynthetic protein FlhB [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117558939|gb|ABK35887.1| flagellar biosynthetic protein FlhB [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 376

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 104/357 (29%), Positives = 179/357 (50%), Gaps = 16/357 (4%)

Query: 5   DAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHV 64
           D    +TE P+ K+++ A  +G    S+E    S +LA +  LL        S+   +  
Sbjct: 3   DTDQERTEQPTGKRLQQAREKGQIARSKELGTASVLLAAVFGLLMVKE----SLAGAMVK 58

Query: 65  LLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLN--- 121
           +L        E       ++T L      L+ P  LLFM+  I ++ +  I +  +N   
Sbjct: 59  VLTMGFTLDREQAFDPNAMMTMLPALLRELLHPLGLLFMLVAIAAF-VGNILMGGMNFSS 117

Query: 122 -HVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDF-ISA 179
             + P + ++S   GIKR++ + +LV  +KS  K++ +       L+  +  +L+  +  
Sbjct: 118 EAMLPKWSKLSPLNGIKRMFGVQSLVELVKSIAKVVFISLFAWWMLSSQFNHLLNLSLEG 177

Query: 180 NPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQW--YSKLKMSKQEIKDEIKQSY 237
            P  I+      +    ++I+L  A + ++ I   + QW    +LKM+KQE+KDE K S 
Sbjct: 178 YPGGIIDALDLLL---WMLIILCCALIPIVAIDVPFQQWNHMRQLKMTKQEVKDEFKDSE 234

Query: 238 GNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTE-NDAPVLVAKGQ 296
           G P +K R + +       +MM    +A ++ITNPTHY++AL+Y   +   AP +VAKG 
Sbjct: 235 GKPEVKGRIRRLQMEMAMRRMMGDVPKADVVITNPTHYSVALKYDTAKPGSAPKVVAKGT 294

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           + IA K+R+IA E+ IP+   P+L R+++    I   IP   + AVAQ++  +Y  K
Sbjct: 295 DEIAMKIREIAREYEIPVMPSPALTRAIYHATEIGHEIPEGLFAAVAQVLAYVYQLK 351


>gi|54307250|ref|YP_128270.1| FlhB flagellar biosynthetic protein [Photobacterium profundum SS9]
 gi|46911670|emb|CAG18468.1| Hypothetical FlhB flagellar biosynthetic protein [Photobacterium
           profundum SS9]
          Length = 375

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 117/364 (32%), Positives = 194/364 (53%), Gaps = 28/364 (7%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISRE-ASLFSSILACLIYLLFFFSPGIYSVT 59
           MSEN + D KTE PS +K+  A  EGN P S+E  +   ++ A L  LL  FS  +  + 
Sbjct: 1   MSENSSQD-KTEQPSQQKLRKAREEGNLPRSKELVTALMTLGAAL--LLSAFSSDLAHMF 57

Query: 60  SDLHVL-LASATQRKLEDISHIVFLLTHLSLSASRLVI---PGLLLFMMFGIGSYLIQRI 115
            ++  L LA   +   E      F+L HLS S + ++    P   L ++  I + +I+  
Sbjct: 58  DEVATLNLALPKKAAFEP----EFMLKHLSFSLTSMIFTISPIFGLLLLVTILANIIRGG 113

Query: 116 PVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLD 175
             +++   +P   +++   GIKR++S  +LV  +KS +K+ L+G  +   L+ N+ T + 
Sbjct: 114 WNISVTAAQPKLSKLNPLSGIKRMFSTKSLVELVKSILKVSLIGGTLYWLLS-NHLTQII 172

Query: 176 FISANPHS--------ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQ 227
            +   P +        IL+   F+      + LL IA L +   GW Y +   +LKM+KQ
Sbjct: 173 ALQRLPMTEAILQTVDILWQGLFSFG----LALLLIAVLELPYAGWDYTK---QLKMTKQ 225

Query: 228 EIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEND 287
           E+K+E K S G P +K + + + +   + +M +   +A ++ITNPTHYA+AL+Y   +  
Sbjct: 226 EVKEEHKNSEGKPEVKAKIRQLQQQMSQRQMHKTVPQADVVITNPTHYAIALKYDLDKAS 285

Query: 288 APVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIY 347
           AP ++AKG + +A +MRKIA  HN PI E P+L R+++        IP   Y AVA ++ 
Sbjct: 286 APFVLAKGTDQMALEMRKIARHHNCPIVEIPALTRAVYYSTNEWQEIPAPLYVAVAHILT 345

Query: 348 KIYH 351
            ++ 
Sbjct: 346 FVFQ 349


>gi|78355426|ref|YP_386875.1| flagellar biosynthesis protein FlhB [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|78217831|gb|ABB37180.1| flagellar biosynthetic protein FlhB [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 357

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 107/356 (30%), Positives = 188/356 (52%), Gaps = 22/356 (6%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M + D   ++TE  + K+   A  EGN P S+E       +A  I  L+ +   I S   
Sbjct: 1   MPQQDP--SRTEQATPKRRRKARGEGNVPKSQEVPKTFVTMAGTI-ALYVYMDHIASEMM 57

Query: 61  DLH------VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQR 114
            L+       ++  AT + + D      LL  +S   + +++P ++LF+   + +Y++ R
Sbjct: 58  GLYEHFFRNAVMFEATPQAVYD------LLLWISGKLALMLLP-IMLFL--ALVAYVVIR 108

Query: 115 IPVLNL---NHVKPSFKRVSLREGIKRIY-SINNLVNFMKSFVKIILVGTIITISLTENY 170
           + V  L      KP F R +L +G+KR++ S   L+   KS +   ++G    I +    
Sbjct: 109 LQVGKLWAPKVFKPKFARFNLIKGLKRLFISPQTLIRLGKSILMAAVIGIAPYIVIRNEM 168

Query: 171 FTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIK 230
              L    A P +I  +      K++   +L +  + + D+ ++   +   LKM+K E+K
Sbjct: 169 HHFLPLFYATPTAIGVYMLEMGMKMVKYAMLPMLVIAIADLWYTRWDYEENLKMTKDEVK 228

Query: 231 DEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPV 290
           DE KQ+ G+P +K +Q+      +  +M+E   +A +++TNPTHYA+ALRY   E  APV
Sbjct: 229 DERKQAEGDPAVKAQQRQKMMEVMAQRMLENVPKADVVVTNPTHYAVALRYDAVEAPAPV 288

Query: 291 LVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           ++AKG + +A++++++A EH +PI E   LAR+L++QV +   IP   Y+AVA L+
Sbjct: 289 VLAKGVDHLAERIKEVAREHRVPIRENVPLARALYRQVEVGDMIPEELYQAVASLL 344


>gi|149908444|ref|ZP_01897107.1| flagellar biosynthesis protein [Moritella sp. PE36]
 gi|149808607|gb|EDM68542.1| flagellar biosynthesis protein [Moritella sp. PE36]
          Length = 376

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 105/356 (29%), Positives = 188/356 (52%), Gaps = 12/356 (3%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D    +TE  + KK+  A  +G    S+E +    + A     L F      ++  
Sbjct: 1   MAEKDG-QEQTEDATEKKLTQAREKGQVVRSKELATTFVLTATGAAFLAFGD----ALAR 55

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIP--GLLLFMMFG--IGSYLIQRIP 116
            L + + S  Q + EDI     LL  +S+S   L  P  G+++   F   IG+ L+  + 
Sbjct: 56  ALVINMTSLFQLEREDIFSPDALLEIVSVSIKPLFWPMFGIMIVGFFAGIIGNILMGGM- 114

Query: 117 VLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDF 176
           V +   ++P   ++S + G+KR+     +V  +KS  K+ +V TI  + L   +  +++F
Sbjct: 115 VFSGESIRPKASKMSPKAGLKRMMGPQAMVELIKSIAKVAVVVTIALLVLKVQFLQIMEF 174

Query: 177 ISANPHSI-LYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQ 235
            S  P +I +  +   +  V I +   +  +  +D+ + Y +   +L+M+KQE+KDE+K 
Sbjct: 175 -SLQPLNISIIQSLNFLTDVFIWLCASLIIIVAIDVPYQYWKHAKELRMTKQEVKDEMKD 233

Query: 236 SYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKG 295
             GNP +K + + +     + +MM     A +IITNPTHY++AL+Y ++ N AP +VAKG
Sbjct: 234 VNGNPQLKGKIRQMQMEISQRRMMGDVPDADVIITNPTHYSVALKYEKSGNAAPKVVAKG 293

Query: 296 QNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            + +A ++R++A EH +PI E  +L R+++    I+  IP   + AVAQ++  +Y 
Sbjct: 294 VDQVAFRIREMAKEHKVPILESAALTRAIYHSTEIDDPIPEGLFIAVAQILAYVYQ 349


>gi|186477710|ref|YP_001859180.1| flagellar biosynthesis protein FlhB [Burkholderia phymatum STM815]
 gi|184194169|gb|ACC72134.1| flagellar biosynthetic protein FlhB [Burkholderia phymatum STM815]
          Length = 411

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 109/365 (29%), Positives = 187/365 (51%), Gaps = 35/365 (9%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSD-L 62
            D+   KTE+ + +++E A  EG    SRE + F+     L+   F  + G+  +  + +
Sbjct: 12  EDSDLEKTESATPRRLEKAREEGQVARSRELATFA-----LVAAGFLGAWGMSGMIGEHV 66

Query: 63  HVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPG-------------LLLFMMFGIGS 109
             +L +A     E     VF      +SA  +   G               L     +G 
Sbjct: 67  QTMLRTAFTFNHE----TVFDPKRAFISAGAVTREGAYMLMPLLALLGLAALLAPMAMGG 122

Query: 110 YLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTEN 169
           +L      L+   + P+F+R++   G+ RI+SIN  +    S  KI++VG I  +++   
Sbjct: 123 WL------LSTKSLAPNFQRLNPVSGLGRIFSINGWIQLGMSLAKIVVVGLIGGLAIWHR 176

Query: 170 YFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIG---WSYHQWYSKLKMSK 226
              +L   +   H  L +A   +     M +  +  L  +D+    WS+H+   KL+M+K
Sbjct: 177 REDILALATQPLHVALSNAGHLIAVCCAMTVGGMFLLAAMDVPYQLWSFHK---KLRMTK 233

Query: 227 QEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEN 286
           +E+K E ++S G+P +K R +S  R+  R +MM    +A +++TNPTH+A+AL+Y   E 
Sbjct: 234 EEVKREHRESEGDPHVKARIRSQQRAMARRRMMANVPKADVVVTNPTHFAVALQYTDGEM 293

Query: 287 DAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
            AP +VAKG NL+A ++R++A E+N+P+ E P LAR+L+  V +N  IP   Y AVA+++
Sbjct: 294 GAPKVVAKGVNLVAARIRELAVENNVPLLEAPPLARALYHNVELNREIPGALYGAVAEVL 353

Query: 347 YKIYH 351
             +Y 
Sbjct: 354 AWVYQ 358


>gi|187926251|ref|YP_001892596.1| flagellar biosynthetic protein FlhB [Ralstonia pickettii 12J]
 gi|241665739|ref|YP_002984098.1| flagellar biosynthetic protein FlhB [Ralstonia pickettii 12D]
 gi|187728005|gb|ACD29169.1| flagellar biosynthetic protein FlhB [Ralstonia pickettii 12J]
 gi|240867766|gb|ACS65426.1| flagellar biosynthetic protein FlhB [Ralstonia pickettii 12D]
          Length = 387

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 102/367 (27%), Positives = 180/367 (49%), Gaps = 50/367 (13%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE  S +++E A  EG+ P SRE + F+         L   S G   V  D  V  AS
Sbjct: 8   EKTEPASPRRLEQAREEGDVPRSRELASFA---------LTAVSAGGLWVMGDSIVRAAS 58

Query: 69  A-TQRKLE-----------DISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIP 116
           +   R LE             +++      L+++     + GL+L ++    S L     
Sbjct: 59  SFLARCLEFHRYNYTSGQDQWNYVTGQFMPLAMT-----LGGLMLMLVIAALSPLALTRG 113

Query: 117 VLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILV------------GTIITI 164
            ++   + P   R+   +G+ R++S+  L+   +  +K+ L+            G +I +
Sbjct: 114 AISFKPLSPDISRLFKLQGLTRMFSLEGLMELPRLLIKLFLIAGVGWLLVRYYRGDLIEL 173

Query: 165 SLTENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKM 224
              +    M D +      +   AF  +  V++++         +D+  S  Q+  K +M
Sbjct: 174 PQQDLGVAMRDTLH-----VAGVAFLCMAAVMMLV-------AAVDVPLSLWQYARKHRM 221

Query: 225 SKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQT 284
           +K+E++ E ++S G+P +K R +++ R   + +MM    +A +I+TNPTHYA+ALRY + 
Sbjct: 222 TKEEVRKEHRESEGDPHVKGRIRNLQRQAAQRRMMADVPKADVIVTNPTHYAVALRYSEK 281

Query: 285 ENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQ 344
           E  AP ++AKG +++A K+R++  EH IPI E P LAR+L++   I   IP   Y AVA+
Sbjct: 282 EGGAPRVLAKGADMVAAKIRELGTEHKIPILEAPPLARALYRHTEIGHQIPEALYAAVAE 341

Query: 345 LIYKIYH 351
           ++  +Y 
Sbjct: 342 VLAYVYQ 348


>gi|94500293|ref|ZP_01306826.1| Flagellar biosynthesis pathway, component FlhB [Oceanobacter sp.
           RED65]
 gi|94427592|gb|EAT12569.1| Flagellar biosynthesis pathway, component FlhB [Oceanobacter sp.
           RED65]
          Length = 375

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 106/365 (29%), Positives = 192/365 (52%), Gaps = 29/365 (7%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+    KTE P+ ++++ A ++G  P S+E S  S +L   +  ++  +  ++S   
Sbjct: 1   MAENENSQEKTEEPTPRRLQKAKDDGQIPRSKELST-SLVLIVGVLSIWLLADLLFSGAK 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVI---PGLLLFMMFGIGSYLIQRIPV 117
           ++        + ++ D      +L HL  SA   ++   P ++L ++    + L     +
Sbjct: 60  NIFQYNFVIEREQIFDEKQ---MLKHLGASAYEAILTMTPTMMLILLAAALAPLALGGWM 116

Query: 118 LNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILV-GTIITISLTENYFTMLDF 176
            +   + P   R+S   G+KR++ + +LV  +KS+ K+++V G            T L F
Sbjct: 117 FSGKALLPKANRISPLSGLKRMFGVKSLVELIKSWAKVLVVIGC-----------TFLLF 165

Query: 177 ISANPHSILYHAFFTVRKV-----LIMILLFI---ATL--TVLDIGWSYHQWYSKLKMSK 226
              N   +  H     R +     L+M+  FI   +TL  +V+D+ +  +++  K++MS 
Sbjct: 166 FIFNDKVLFLHREPGTRAIADSADLVMLCAFILACSTLLVSVIDVPYQIYEYMQKMRMSL 225

Query: 227 QEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEN 286
           QE+KDE K++ G P +K R + +     + +MM+    A ++ITNPTHYA+AL+Y   + 
Sbjct: 226 QEVKDEHKETEGKPEVKQRIRRLQYEMSQRRMMDDVKDADVVITNPTHYAVALKYDSDQM 285

Query: 287 DAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
            AP++VAKG + +A K+R+IA ++ I + E P LARS++    I   IP   Y AVAQ++
Sbjct: 286 GAPLMVAKGTDEVALKIREIAKQNKIAVVEAPPLARSIYAFTKIGKEIPEGLYVAVAQVL 345

Query: 347 YKIYH 351
             +Y 
Sbjct: 346 AYVYQ 350


>gi|269103165|ref|ZP_06155862.1| flagellar biosynthesis protein FlhB [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268163063|gb|EEZ41559.1| flagellar biosynthesis protein FlhB [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 376

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 103/360 (28%), Positives = 192/360 (53%), Gaps = 16/360 (4%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFF---FSPGIYS 57
           M+++D    +TE  + ++ + A  +G  P SRE +  + ++A  + L++F       + +
Sbjct: 1   MADSD-DQERTEDATPRRRQQAQEKGQVPRSRELASVAVLIAGAVGLMWFGGSLGQALAA 59

Query: 58  VTSDLHVLLASATQRKLEDISHIVFLLTHLSLS-ASRLVIPGLLLFMMFGIGSYLIQRIP 116
           V S L  L    T+ ++ D+  +  +++ +    A+ L +  + LF+   IG+  +  + 
Sbjct: 60  VMSRLFSL----TREEVFDLGAMSTVISEVIWGIAAPLTLVLVFLFVAAFIGAAGLGGV- 114

Query: 117 VLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDF 176
             +     P   +++   G KR++ + + V  +KS +K   VG +  ++    Y ++ DF
Sbjct: 115 RFSSEAAMPKLSKMNPLSGFKRMFGMQSWVELIKSILK---VGLVSGVAYYLMYDSLDDF 171

Query: 177 ISANPHSI---LYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEI 233
                 S    +YHA  T+   +++I   +  +  +D+ +  +Q+  +LKM+KQEIKDE 
Sbjct: 172 FQLAQESYPNNIYHALSTLLHFILLISCSLLVVVAIDVPFQIYQFNQQLKMTKQEIKDEY 231

Query: 234 KQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVA 293
           K++ G P +K R + + R   + +MM    +A +IITNP HY++ALRY    + APV++A
Sbjct: 232 KETEGKPEVKGRIRMLQREMAQRRMMADVPQADVIITNPEHYSVALRYDPKLDSAPVVIA 291

Query: 294 KGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           KG +  A K+R+IA EHNI I   P LAR+++    +   IP   + AVAQ++  ++  K
Sbjct: 292 KGVDHTAFKIREIAKEHNIDIVPVPPLARAIYHTTELEQQIPDGLFIAVAQVLAYVFQLK 351


>gi|167750709|ref|ZP_02422836.1| hypothetical protein EUBSIR_01687 [Eubacterium siraeum DSM 15702]
 gi|167656388|gb|EDS00518.1| hypothetical protein EUBSIR_01687 [Eubacterium siraeum DSM 15702]
          Length = 353

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 100/351 (28%), Positives = 182/351 (51%), Gaps = 6/351 (1%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A + KTE  + KK +D   +G    S+E ++   ++    +L  F   G Y     L+ +
Sbjct: 2   AGEEKTEKATPKKRKDTRKKGEVLQSKEVAVAVFVVGIFAFLAIF---GNYMFQMLLNFM 58

Query: 66  LASAT--QRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             S +   +    +   + +   +++     V P L + ++  +   ++Q   + ++  +
Sbjct: 59  EQSMSSIDKTGNTVEFAMSVFWKVAIICICTVGPILAVGVVLSVLPVIVQTKGLFSMEAM 118

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           KP F R++   GIKR++S+  LV  +K  ++II+V  I+   + +        I  +   
Sbjct: 119 KPKFSRLNPFTGIKRLFSMQALVGLVKGLIEIIVVVAILYFQVMDRINEFKKLIDTDVIK 178

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
           I+ +   T   +++ I + +  +   D  + +  +  KLKMSKQE+KDE KQ  G+P IK
Sbjct: 179 IVAYISETAMSLIVTIFVMLVFVAAADYVFQWWSFEKKLKMSKQEVKDEYKQLEGDPQIK 238

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYI-QTENDAPVLVAKGQNLIAKK 302
            + K   +   + +MM+    A +++ NPTHYA+AL+Y  +T   APV+VAKG + +A +
Sbjct: 239 GKIKRKQQEMAQQRMMQEVPSADVVVRNPTHYAVALKYDRKTAYRAPVVVAKGTDALALR 298

Query: 303 MRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +  +A EHN+ I E   LAR L++ V I   IP  FY AVA+++  +Y ++
Sbjct: 299 IVAVAQEHNVYITENRPLARGLYEAVDIGQEIPREFYTAVAEVLAMVYEEQ 349


>gi|320015476|gb|ADV99047.1| Flagellar biosynthesis protein flhB [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 259

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 75/219 (34%), Positives = 129/219 (58%)

Query: 135 GIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAFFTVRK 194
           G+KR++S   L   +K+ +K  LVG +  + L  N+  M+  I+A P + L  A   +  
Sbjct: 6   GLKRMFSSQALAELLKAILKATLVGWVTGLFLWHNWPDMMRLIAAPPVAALGDALHLIIF 65

Query: 195 VLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSRI 254
             ++++L ++ +   D+ +       KL+M+KQ+I+DE K   G+P +K R +   R+  
Sbjct: 66  CGLVVVLGLSPMVGFDVFYQITSHIKKLRMTKQDIRDEFKNQEGDPHVKGRIRQQQRAMA 125

Query: 255 RHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIPI 314
           R +MM    +A +I+TNPTHYA+AL+Y +++  AP ++AKG   +A ++R++  EH IP+
Sbjct: 126 RRRMMVDVPKADVIVTNPTHYAVALQYNESKMSAPKVLAKGAGAVALRIRELGAEHRIPL 185

Query: 315 FEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            E P LAR+LF+   +   IP   Y AVA+++  +Y  K
Sbjct: 186 LEAPPLARALFRHSEVGQHIPATLYAAVAEVLAWVYQLK 224


>gi|146307831|ref|YP_001188296.1| flagellar biosynthesis protein FlhB [Pseudomonas mendocina ymp]
 gi|145576032|gb|ABP85564.1| flagellar biosynthetic protein FlhB [Pseudomonas mendocina ymp]
          Length = 378

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 102/362 (28%), Positives = 193/362 (53%), Gaps = 23/362 (6%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+++   K+E P+SK++E++  +G    S+E +  +  L   + L+ F   G Y    
Sbjct: 1   MAESESGAEKSEEPTSKRLEESRKKGQIARSKELNTLAVTLTGTVALIIF---GAYMGNV 57

Query: 61  DLHVLLASATQRK---LEDISHIVFLLTHL--SLSASRLVIPGLLLFMMFG---IGSYLI 112
            + ++  + +  +   + + S  ++LL     +L A + +   LL+  + G   +G +L 
Sbjct: 58  LMDLMRGNFSLPREVLMHEGSMALYLLASGKHALVAIQPLFLALLIASVIGPIALGGWL- 116

Query: 113 QRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFT 172
                 +   ++P   R++   G+KR++S+  LV  +K+  K +++  +  + L  +   
Sbjct: 117 -----FSAEALQPKASRMNPLAGLKRMFSVQALVELLKALAKFLVILAVALVVLALDQDD 171

Query: 173 MLDFISANPHSILYHAFFTVRKVLIMI---LLFIATLTVLDIGWSYHQWYSKLKMSKQEI 229
           +L   +      + H+   V      +   L+ IA + V    WS+ Q   KLKM+KQE+
Sbjct: 172 LLAIANEPVEPAILHSLRVVGWSAFWLSCGLILIAAVDVPFQLWSHKQ---KLKMTKQEV 228

Query: 230 KDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAP 289
           +DE K + G P +K R + + R     +MM+A  +A ++ITNPTH+A+AL+Y   +  AP
Sbjct: 229 RDEYKDTEGKPEVKGRIRQLQREMAERRMMQAVPQADVVITNPTHFAVALKYDPEKGGAP 288

Query: 290 VLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKI 349
           +L+AKG + +A K+R+IA EH + + E P+LAR+++    ++  IP   Y AVAQ++  +
Sbjct: 289 MLLAKGGDFLALKIREIAQEHKVMVLESPALARAVYYSTELDQEIPAGLYLAVAQVLAYV 348

Query: 350 YH 351
           Y 
Sbjct: 349 YQ 350


>gi|308050045|ref|YP_003913611.1| flagellar biosynthetic protein FlhB [Ferrimonas balearica DSM 9799]
 gi|307632235|gb|ADN76537.1| flagellar biosynthetic protein FlhB [Ferrimonas balearica DSM 9799]
          Length = 374

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 110/359 (30%), Positives = 188/359 (52%), Gaps = 29/359 (8%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLF---FFSPGIYS 57
           MS++ A  +KTE  + ++I+ A  +G  P S++ +  +  + C + LL    +F+ G   
Sbjct: 1   MSQSAA--DKTEKATPQQIKKAREKGQVPRSKDLATAALFIGCALMLLASADWFARG--- 55

Query: 58  VTSDLHVLLASATQRKLEDISHIVFLLTHLSLSAS---RLVIPGLLLFMMFGIGSYLIQR 114
            T+DL     S T+   ED+     ++ H+  S      L+ P  LL  +  + +  +  
Sbjct: 56  -TADLLRYNMSLTR---EDLMAPDVMVRHVGASLVAMINLLSPLFLLIAVLALVAGALPG 111

Query: 115 IPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILV-GTI------ITISLT 167
            P+L+L + +    R+    GIKR++S+ +LV  +KS +K+ L+ GT+          L 
Sbjct: 112 GPLLSLKNAEFKGSRIDPIAGIKRMFSMKSLVELIKSILKVSLILGTLYFLLRGRLEGLL 171

Query: 168 ENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQ 227
             Y   LD   A   S L     T    L ++LLFIA   ++D+ W  +    +LKM++Q
Sbjct: 172 GLYRMPLDQAVAEGVSFLAFGILT----LGVVLLFIA---LIDVPWQIYDHQKELKMTRQ 224

Query: 228 EIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEND 287
           ++KDE KQ  G P +K R + I +   R +   A  +A +++TNP HYA+AL+Y     D
Sbjct: 225 QVKDEHKQMEGKPEVKARIRQIQQKMARSRAETAIPKADVLLTNPQHYAIALKYEPDRAD 284

Query: 288 APVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           AP ++AKG + +A  MR++A  H + I E P LAR+++    ++  +P   Y A+AQ++
Sbjct: 285 APFVLAKGTDELALHMRQLARRHGVEIIEAPPLARAVYHSTQVDQMVPQALYVAIAQVL 343


>gi|82702438|ref|YP_412004.1| flagellar biosynthesis protein FlhB [Nitrosospira multiformis ATCC
           25196]
 gi|82410503|gb|ABB74612.1| flagellar biosynthetic protein FlhB [Nitrosospira multiformis ATCC
           25196]
          Length = 392

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 108/361 (29%), Positives = 189/361 (52%), Gaps = 22/361 (6%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE ++   +TE  S +++E +  EG AP S E S F+ ++A    L          ++S
Sbjct: 1   MSE-ESDQERTEPASPRRLEKSREEGQAPRSTELSTFALLIAAGTGLWLMGG----HLSS 55

Query: 61  DLHVLLASATQRKLE---DISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPV 117
            L  L+        E   + + +   L   S  A     P L+L ++  + + ++    +
Sbjct: 56  QLARLMKEGMHIPRETGFEPARLAERLFDQSFHALITFAPFLILMILVALVAPMLLSGWL 115

Query: 118 LNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFI 177
            +   + P FKR++   G+ R++S+++L+   K+ +K  L+G     ++     ++L  I
Sbjct: 116 FSWKSLNPDFKRINPLSGLSRMFSLHSLLELAKALLKAALIGGAGVWTIWHYKESVLSLI 175

Query: 178 SANPHSILYH-------AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIK 230
           +      L H       +FF++   +I+I    AT+ V    W +   Y KL+M+K+E++
Sbjct: 176 ARPLVPGLTHMGELVALSFFSIAGTMILI----ATVDVPFKLWDH---YRKLRMTKEEVR 228

Query: 231 DEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPV 290
            E K++ GNP IK R ++  R   R +MM    RA +IITNPTHY++ALRY   +  AP 
Sbjct: 229 QENKETEGNPQIKGRIRAQQREMARKRMMTEIPRADVIITNPTHYSVALRYEDGKMRAPR 288

Query: 291 LVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           +VAKG +L+A K+R+I ++H +P+ E P LAR+L++   +   IP   Y  VA+++  +Y
Sbjct: 289 VVAKGMHLLALKIREIGHQHKVPVLEAPPLARALYQHTELGDEIPQTLYNVVAEVLAYVY 348

Query: 351 H 351
            
Sbjct: 349 Q 349


>gi|292669764|ref|ZP_06603190.1| flagellar biosynthetic protein FlhB [Selenomonas noxia ATCC 43541]
 gi|292648561|gb|EFF66533.1| flagellar biosynthetic protein FlhB [Selenomonas noxia ATCC 43541]
          Length = 374

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 107/350 (30%), Positives = 177/350 (50%), Gaps = 7/350 (2%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A   KTE P++KK  DA  +G    S+E +    +L     L   +     S+ +    +
Sbjct: 24  AGGEKTEEPTAKKRADARKKGQVGRSQELNTAFVLLVGFFSLKLLWDSIYLSIATYTTYV 83

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
            ++  Q    D  +I+ +   + +  ++   P +L  M+ G+     Q    LN +    
Sbjct: 84  FSNLNQ--TVDTENIIRIFIGIIIVLAKTAFPIMLFIMVIGLAINFFQ--VGLNFSAESI 139

Query: 126 SFKRVSLR--EGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
            FK   L    G  RI+S   LV   KSF KII++G  +   + E    M  F+  +  +
Sbjct: 140 EFKLDKLNPINGFGRIFSKRALVELAKSFFKIIVIGFFLYRFIHEQILAMPQFMFFDLTT 199

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            L      + ++  +++  I  +   D G+   Q    LKM+KQE+KDE+KQ+ G+P IK
Sbjct: 200 SLALVAEIIFQMAFIVIGVIMIMAFCDYGYQRWQTTQDLKMTKQEVKDEMKQTEGDPQIK 259

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            + +   R     +MM+   +A +IITNPTHYA+AL Y Q    AP +VAKGQ+L+A+++
Sbjct: 260 GKIRQKQRQMAMARMMKEVPKADVIITNPTHYAVALSYEQGMV-APTVVAKGQDLVAQRI 318

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           ++I  +  +PI E   LAR+L+  V +  A+P   Y+AVA+++  +Y  K
Sbjct: 319 KEIGRDARVPIIENKPLARTLYAAVQVGDAVPHELYQAVAEVLAYVYRLK 368


>gi|87119470|ref|ZP_01075367.1| flagellar biosynthetic protein FlhB [Marinomonas sp. MED121]
 gi|86164946|gb|EAQ66214.1| flagellar biosynthetic protein FlhB [Marinomonas sp. MED121]
          Length = 380

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 118/377 (31%), Positives = 193/377 (51%), Gaps = 49/377 (12%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLF-------------SSILACLIYL 47
           M+EN+    KTE  SSKK+++A N+GN P S++ S                S+LA  +  
Sbjct: 1   MAENEDGAEKTEDASSKKLDEARNKGNLPRSKDLSSALLLLIAAASLYATGSLLAQDMSN 60

Query: 48  LFFFSPGIYSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGI 107
           +F F           + +L+ A      D+     ++ HLS S+  ++   L++ ++  I
Sbjct: 61  VFQF-----------NFVLSRA------DMFDTAKMVIHLSDSSISMMDSLLVMMIVLAI 103

Query: 108 GSYLIQRIPVLNLNH----VKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTI-- 161
              ++  + +   N     + P   +++   GIKR++S+N+LV  +KS  K+ LV  +  
Sbjct: 104 AG-IVGSVALGGFNFSWEPLIPKLSKMNPISGIKRMFSVNSLVELLKSIAKVSLVLVVAF 162

Query: 162 --ITISLTENY---FTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYH 216
             + I L E     F  L+    +  +++  AF  V     + +L IA + V    WS+ 
Sbjct: 163 FVLKIYLPEMLLVPFQSLELALGHAINVVIWAFIYVS----LAVLLIAAVDVPYQAWSHK 218

Query: 217 QWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYA 276
               KLKM+KQE KDE K + G+P IK R +   R     +MME    A +IITNPTH++
Sbjct: 219 ---DKLKMTKQETKDEYKNAEGDPQIKARIRQAQRQASMRRMMEDVPNADVIITNPTHFS 275

Query: 277 LALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPP 336
           +AL+Y      AP L+AKG + +A K+R+I   HNIP+ + P+LARS++    I   IP 
Sbjct: 276 VALKYEAGVKGAPKLLAKGNDFVALKIREIGTFHNIPVVQSPALARSIYHYTEIGEEIPT 335

Query: 337 VFYKAVAQLIYKIYHKK 353
             +++VAQ++  +Y  K
Sbjct: 336 GLFQSVAQILAYVYQLK 352


>gi|167623392|ref|YP_001673686.1| flagellar biosynthesis protein FlhB [Shewanella halifaxensis
           HAW-EB4]
 gi|167353414|gb|ABZ76027.1| flagellar biosynthetic protein FlhB [Shewanella halifaxensis
           HAW-EB4]
          Length = 377

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 105/361 (29%), Positives = 183/361 (50%), Gaps = 21/361 (5%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+END+   KTE  +S+K++ A ++G    S+E    + ++A  + LL    P I     
Sbjct: 1   MAENDSSQEKTEEATSRKLQQAKDKGQVARSKELGTSAVLIAASVGLLMT-GPDIAQAMH 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIP--GLLLFMMF--GIGSYLIQRIP 116
           ++   L + ++ ++ D      ++    +  + L +P  G ++F+      G+  +  I 
Sbjct: 60  NIMTKLFTMSRDEIFDTKQ---MMNVWGVIGTELALPLMGFIVFLALIAFAGNVALGGIS 116

Query: 117 VLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVK--IILVGTIITISLTENYFTML 174
             ++    P   ++S   G KR++ +  LV   K   K  ++ +   + +S   N   ML
Sbjct: 117 -FSVKAFMPKASKMSPMAGFKRMFGVQALVELTKGIAKFSVVAITAFLLLSTYLNDILML 175

Query: 175 --DFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQW--YSKLKMSKQEIK 230
             D +  N    +YHA   V  V I ILL  +T  ++ I   +  W    +LKM+KQE+K
Sbjct: 176 SQDHLPGN----IYHALDIV--VWIFILLCASTFLIVVIDVPFQIWNHAKQLKMTKQEVK 229

Query: 231 DEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPV 290
           DE K + G P +K R + +     + +MM     A +I+ NP HYA+A++Y  T + AP 
Sbjct: 230 DEYKDTEGKPEVKGRIRQLQHEMSQRRMMGEVPNADVIVVNPEHYAVAVKYDATRSTAPF 289

Query: 291 LVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           +VAKG + +A K+R+IA EH++ I   P LAR++F    I+  IP   + AVAQ++  ++
Sbjct: 290 VVAKGVDEVAFKIREIAREHDVAIVSAPPLARAIFHTTKIDQEIPEGLFTAVAQVLAYVF 349

Query: 351 H 351
            
Sbjct: 350 Q 350


>gi|150390466|ref|YP_001320515.1| flagellar biosynthetic protein FlhB [Alkaliphilus metalliredigens
           QYMF]
 gi|149950328|gb|ABR48856.1| flagellar biosynthetic protein FlhB [Alkaliphilus metalliredigens
           QYMF]
          Length = 361

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 104/347 (29%), Positives = 186/347 (53%), Gaps = 5/347 (1%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISRE-ASLFSSILACLIYLLF--FFSPGIYSVTSDLHV 64
           + KTE P+ KK +D+  +G    S+E  S F  I A +I  LF  +    + S T  ++V
Sbjct: 12  EEKTERPTPKKRKDSREKGQVLQSKELNSAFLLIGAFVILGLFSSYIGMTMKSFTRSIYV 71

Query: 65  LLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVK 124
              +     L  I ++  LL +   +  +++ P  +  ++ G+    +Q   +     + 
Sbjct: 72  EYLNTDY--LFSIQNLYRLLVYSLYNLLKIIAPISIASLLIGLAVSYLQVGYLFTTKTLA 129

Query: 125 PSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSI 184
               +++  EG K+I+S+  +V   KSF+KI LVG I+         T+ + ++ +   I
Sbjct: 130 FKLSKLNPIEGFKKIFSLKAIVELAKSFIKIGLVGYIVFQYAQGQLETIFNTMAMDMDGI 189

Query: 185 LYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKN 244
           +    + +  + I   + +  L   D  +  +++   LKM+KQE K+E KQS GNP IK+
Sbjct: 190 IQVLIYILVNIGIRAGVVLLVLAGFDYLYQKYEYDKNLKMTKQETKEEYKQSEGNPQIKS 249

Query: 245 RQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMR 304
           + K   R     +MM+   +A +IITNPTH+A+A++Y   +  AP ++AKGQ+++A+ ++
Sbjct: 250 KIKEKQRQMSTKRMMQEVPKADVIITNPTHFAIAIQYNPDDFQAPRVIAKGQDILAQSIK 309

Query: 305 KIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           K+  E+++PI E   LARSL+  V I + IP   Y+AVA+++  +Y 
Sbjct: 310 KVGLENDVPIVENKPLARSLYDTVEIGAFIPTELYQAVAEILAYVYR 356


>gi|319787087|ref|YP_004146562.1| flagellar biosynthetic protein FlhB [Pseudoxanthomonas suwonensis
           11-1]
 gi|317465599|gb|ADV27331.1| flagellar biosynthetic protein FlhB [Pseudoxanthomonas suwonensis
           11-1]
          Length = 379

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 108/368 (29%), Positives = 188/368 (51%), Gaps = 35/368 (9%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISRE---ASLFSSILACLIYLLFFFSPGI-- 55
           M+EN+    KTE P+ ++ E A+ +GN P SRE   A LF S +  ++     F+ G   
Sbjct: 1   MAENEDGQEKTEQPTGRRREKAIKQGNLPRSRELSNAVLFGSGVVAMMAGGSMFARGASG 60

Query: 56  ---YSVTSDLHVLLASATQ----RKLEDISHIVFLLTHLSLS-ASRLVIPGLLLFMMFGI 107
               ++T DL V+L S  +      +  +  ++ +L  + ++ A+  V PGL+    F  
Sbjct: 61  WFRQALTPDL-VMLESPGELFGYMGILLLRLVLVMLPLIGVALAACFVAPGLMGGFHF-- 117

Query: 108 GSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLT 167
                          ++P  +R++   G+KRI+S   LV   KS +++ L+     + L 
Sbjct: 118 -----------TTESLQPKPERLNPLAGLKRIFSSEGLVEVAKSLLRVALLVIACGLVLV 166

Query: 168 ENYFTMLDFISANPHSILYHAFFT----VRKVLIMILLFIATLTVLDIGWSYHQWYSKLK 223
             +    D + A P   L  A  T      ++L    + +  L + D  +    W  KLK
Sbjct: 167 HGF----DVLKAMPGQSLEDAASTGLHFAGRLLGAAAVALVLLALADAPYQKWNWTRKLK 222

Query: 224 MSKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQ 283
           M++QE+++E+K++ GNP +K + + +     + +MMEA   A +++ NPTHYA+AL+Y  
Sbjct: 223 MTRQEVREEMKETDGNPQVKGKIRQMQFQMSQRRMMEAVPTADVVVVNPTHYAVALKYEG 282

Query: 284 TENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVA 343
               AP +VAKG + +A ++R++A +H I     P LAR+L+++  I+  IP   Y AVA
Sbjct: 283 GTMRAPKVVAKGVDEMAMRIREVADQHRIATVSAPPLARALYREGEIDKEIPVRLYAAVA 342

Query: 344 QLIYKIYH 351
           Q++  +Y 
Sbjct: 343 QVLSYVYQ 350


>gi|77457779|ref|YP_347284.1| flagellar biosynthesis protein FlhB [Pseudomonas fluorescens Pf0-1]
 gi|77381782|gb|ABA73295.1| flagellar biosynthetic protein flhb [Pseudomonas fluorescens Pf0-1]
          Length = 379

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 98/356 (27%), Positives = 181/356 (50%), Gaps = 11/356 (3%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+++  +KTE P+ K+ +D+  +G    S+E +  + +LA    LL F       +  
Sbjct: 1   MAESESGQDKTEDPTEKRKKDSREKGEIARSKELNTLAIMLAGSAALLIFGGMLAQELMD 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTH--LSLSASRLVIPGLLLFMMFG---IGSYLIQRI 115
            +      + +  +++ S   FL++    +L A + ++  LLL    G   +G +L    
Sbjct: 61  LMRQNFTLSREVIMDERSMATFLMSSGLQALLAIQPIMITLLLAAFLGPIALGGWL---- 116

Query: 116 PVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLD 175
                  + P F R++   G+KR++S+  +V  +K+  K ++   +  + L  +   +L 
Sbjct: 117 --FAAGSLAPKFSRMNPAAGLKRMFSMKAVVELLKALAKFLITLGVALVVLNSDIDDLLR 174

Query: 176 FISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQ 235
                    + H+   V    + +   +  +  +D+     +   KLKM+KQE++DE K 
Sbjct: 175 IAHEPLDRAIIHSLQLVGWSSLWLACGLIIIAAVDVPVQIWESIKKLKMTKQEVRDEHKD 234

Query: 236 SYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKG 295
             G P +K R + + R   + +MM A   A ++ITNPTHYA+AL+Y   +  AP+L+AKG
Sbjct: 235 QEGRPEVKQRIRQLQREMSQRRMMAAIPDADVVITNPTHYAVALKYDAEKGGAPMLLAKG 294

Query: 296 QNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            + +A K+R+IA  +N+ + E P+LARS++    +   IP   Y AVAQ++  +Y 
Sbjct: 295 SDFLALKIREIAVANNVMLLESPALARSIYYSTELEEEIPGGLYLAVAQVLAYVYQ 350


>gi|326204607|ref|ZP_08194463.1| flagellar biosynthetic protein FlhB [Clostridium papyrosolvens DSM
           2782]
 gi|325985174|gb|EGD46014.1| flagellar biosynthetic protein FlhB [Clostridium papyrosolvens DSM
           2782]
          Length = 381

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 116/352 (32%), Positives = 186/352 (52%), Gaps = 13/352 (3%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDL--HVLL 66
           +KTE  + KK  DA  +G    SRE +  S IL   +  +  F   IY+  S        
Sbjct: 30  DKTEKATPKKKSDARKKGQVFQSREVTA-SLILIVTVVAMRIFGGTIYAQLSQYLKKTFN 88

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
              T +   D + +  L   + +  ++ V+P LL+  +  +     Q   +  +  +K  
Sbjct: 89  EYLTIKDAIDFNILANLFIDVLMVLAKTVLPLLLVAFLTALIVNYAQVGILFTMETLKIK 148

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL- 185
             R++   G KRI+S+ ++V  +KS +KII+VG +    L      +L  I  +  S+L 
Sbjct: 149 GDRINPLSGFKRIFSLRSVVELLKSIIKIIIVGWVAYSYLKSKTEQVLTLIDTDLMSVLI 208

Query: 186 --YHAFFTV--RKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPI 241
               A FTV  R  + M+LL  A     D  +  + +   LKM+KQE+K+E KQ  GNP 
Sbjct: 209 FIADAAFTVALRICMAMVLLGFA-----DYLYQRYDYEKNLKMTKQEVKEEYKQMEGNPE 263

Query: 242 IKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAK 301
           IK++ K   R     +MM+   +A +IITNPTH+A+AL+Y   ++ AP +VAKGQ+ IA 
Sbjct: 264 IKSKIKQKQRQMSLKRMMQDIPKADVIITNPTHFAVALKYDSEKSAAPFVVAKGQDYIAL 323

Query: 302 KMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           ++++IA ++ + I E   LAR+L+  V I  AIPP  Y+AVA+++  +Y+ K
Sbjct: 324 RIKQIAADNKVQIVENKPLARTLYSTVDIGQAIPPDLYQAVAEILAFVYNLK 375


>gi|260886652|ref|ZP_05897915.1| flagellar biosynthetic protein FlhB [Selenomonas sputigena ATCC
           35185]
 gi|330839517|ref|YP_004414097.1| flagellar biosynthetic protein FlhB [Selenomonas sputigena ATCC
           35185]
 gi|260863795|gb|EEX78295.1| flagellar biosynthetic protein FlhB [Selenomonas sputigena ATCC
           35185]
 gi|329747281|gb|AEC00638.1| flagellar biosynthetic protein FlhB [Selenomonas sputigena ATCC
           35185]
          Length = 366

 Score =  154 bits (388), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 98/346 (28%), Positives = 177/346 (51%), Gaps = 5/346 (1%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSV-TSDLHVLLA 67
            KTE P++K+  DA  +G    S+E S    +LA    +    S  +  + T  +H+   
Sbjct: 20  EKTEEPTAKRRNDARQKGQVARSQELSGAFVLLAGFFVMRALGSTILTEIETYTVHIY-- 77

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
            A   +  D   ++ L+    +  ++   P ++  ++ G+     Q   +     +    
Sbjct: 78  -ANMNQTVDAETVMRLIIDGMIVLAKTAFPVMIAILVMGLAINFYQVGFMFTTEPLSFKL 136

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
            +++   G  RI+S  ++V  +KS +KI ++G  + + L+     M +FI  +  S +  
Sbjct: 137 DKLNPITGFGRIFSKRSIVELLKSLLKIAIIGAFLYVYLSGEIMHMPEFIYLDLKSSMAR 196

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
               +  ++  I++    +   D  +   Q    LKMSKQ+IK+E KQ+ G+P IK + +
Sbjct: 197 MGDIIFSLVFQIIIVYFVMAAADFAYQKWQTTQDLKMSKQDIKEEFKQTEGDPQIKGKIR 256

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              +    ++MM+    A +I+TNPTHYA+AL+Y +    AP +VAKGQ+L+A+K++ IA
Sbjct: 257 QKQQQMAMNRMMKEVPEADVIVTNPTHYAVALKY-KAGMKAPEVVAKGQDLVAQKIKDIA 315

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            EH + I E   LAR+L+  V +   +PP  Y+AVA+++  +Y  K
Sbjct: 316 REHRVTIVENKPLARALYAAVDVGGIVPPELYQAVAEVLAYVYRLK 361


>gi|254250896|ref|ZP_04944214.1| Flagellar biosynthesis pathway component FlhB [Burkholderia dolosa
           AUO158]
 gi|124893505|gb|EAY67385.1| Flagellar biosynthesis pathway component FlhB [Burkholderia dolosa
           AUO158]
          Length = 414

 Score =  154 bits (388), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 77/227 (33%), Positives = 130/227 (57%)

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
           F R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +    + L 
Sbjct: 140 FDRLNPIAGLGRIFSIQGPIQLAMSVAKTLVVGGIGGIAIWRSKDELLGLATRPLGTALA 199

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
            A   V       +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P +K R 
Sbjct: 200 DALHLVAVCCGTTVAGMLVVAALDVPYQLWQYNKKLRMTKEEVKREHRENEGDPHVKGRI 259

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           +   R+  R +MM A  +A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A ++R++
Sbjct: 260 RQQQRAIARRRMMAAVPKADVVVTNPTHFAVALQYTDGEMRAPKVVAKGVNLVAARIREL 319

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A EHN+P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 320 AAEHNVPLLEAPPLARALYHNVELEREIPGSLYSAVAEVLAWVYQLK 366


>gi|304316890|ref|YP_003852035.1| flagellar biosynthetic protein FlhB [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302778392|gb|ADL68951.1| flagellar biosynthetic protein FlhB [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 357

 Score =  154 bits (388), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 106/355 (29%), Positives = 188/355 (52%), Gaps = 24/355 (6%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFS-----PGIYSVTSDLH 63
            KTE  + K+ +DA  +G    SRE +  S+I+    +L+ +F+       I ++   L 
Sbjct: 9   EKTEPATPKRRQDARKKGQVFQSREVT--SAIITIAGFLVIYFTVQNSIEEIMNLIKYLF 66

Query: 64  VLLASATQR--------KLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRI 115
           +    A+          KL +I   VFL         +L++P +    +  + S   Q  
Sbjct: 67  LNYGGASDNTFTVNGIYKLFEIILPVFL---------KLILPTVATVFLVALVSTYAQVG 117

Query: 116 PVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLD 175
            V     +    +R++  EGIKR++S   ++  +K+ VKI ++G ++   L   Y  +  
Sbjct: 118 FVFTSESLNIKLERLNPLEGIKRMFSRRTILELLKAVVKIGILGYVMYSFLIGQYKGIPQ 177

Query: 176 FISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQ 235
            +  +   ++ ++      +L+ I + +  L V+D  + +  + S L+MSK++IK+E K+
Sbjct: 178 LLDMSVQDLIKYSLNIFGGILLRIFIVLIVLGVVDYIFQWRDYESNLRMSKEDIKEEFKE 237

Query: 236 SYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKG 295
           + GNP IK+  K   R     +M++   +A ++ITNPTH A+AL Y    NDAPV+VAKG
Sbjct: 238 TEGNPQIKSEIKKKQRQISMRRMIQNIKKADVVITNPTHIAVALMYDNEINDAPVVVAKG 297

Query: 296 QNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           Q+ IA+++++ A +++I I E   LA+SL+K   I  +IPP  YKAVA+++  +Y
Sbjct: 298 QDYIAQRIKEEAIKYSIAIVENKPLAQSLYKTTDIGDSIPPELYKAVAEVLAYVY 352


>gi|170743254|ref|YP_001771909.1| flagellar biosynthetic protein FlhB [Methylobacterium sp. 4-46]
 gi|168197528|gb|ACA19475.1| flagellar biosynthetic protein FlhB [Methylobacterium sp. 4-46]
          Length = 353

 Score =  154 bits (388), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 79/220 (35%), Positives = 131/220 (59%), Gaps = 1/220 (0%)

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
           ++RVS   G+KR++       F K  +K+ LVGT+  + L  +   +       P ++L 
Sbjct: 126 WERVSPAAGLKRLFGPEAWFQFGKGILKVALVGTVAALVLWGDRDRLDALARLEPSALLP 185

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
                V +++  IL     + + D  +   +W ++L+M+K EIK+E+K+S G+P +K R 
Sbjct: 186 ATLALVLRLMAGILAAYLVIALGDAAYQRLRWRARLRMTKAEIKEEMKESEGSPEVKARL 245

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           + I  +R + +MM A   AT+++ NPTH+A+AL Y +T   APV VAKG +++A ++R +
Sbjct: 246 RRIRATRAKKRMMAAVPGATVVVANPTHFAVALLY-ETGMAAPVCVAKGVDVLALRIRAL 304

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           A E+ +P+ E P LAR+L   V I+ AIP   YKAVA++I
Sbjct: 305 AAENGVPVVENPPLARALHATVEIDQAIPTEHYKAVAEVI 344


>gi|194365643|ref|YP_002028253.1| flagellar biosynthesis protein FlhB [Stenotrophomonas maltophilia
           R551-3]
 gi|194348447|gb|ACF51570.1| flagellar biosynthetic protein FlhB [Stenotrophomonas maltophilia
           R551-3]
          Length = 376

 Score =  154 bits (388), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 101/360 (28%), Positives = 178/360 (49%), Gaps = 19/360 (5%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISRE---ASLFSSILACLIYLLFFFSPGIYS 57
           MSE+++   KTE P+ K++ DA  +GN P SRE   A++F + +  ++ +      G  +
Sbjct: 1   MSEDESAGEKTEQPTEKRLRDAREQGNLPRSRELGTAAVFGAGVLAVMAMSGSIGRGASA 60

Query: 58  VTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLL-----FMMFGIGSYLI 112
                     S  Q   E   H   LL    L  + LV+  LL       +M G+     
Sbjct: 61  WMKHALSPEQSLRQNPKELFGHFGDLLLQFMLVIAPLVLVCLLASFVAPLLMGGL--RWS 118

Query: 113 QRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFT 172
           Q+  + ++N + P         G+KR+Y    +  F KS +++  VG    + +   + T
Sbjct: 119 QKAMLPDINRMNPM-------SGLKRLYGPEAIAEFTKSLLRVAFVGVAAGLVVWTGFDT 171

Query: 173 MLDFISANPHSILYHAF-FTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKD 231
           +   I     + +     FT+R +L+     +  L  +D  +    W  KLKM+++E++ 
Sbjct: 172 LRGLIHHPLETAITDGLSFTLR-LLLATAGAMLVLAAIDAPYQRWNWMRKLKMTREELRR 230

Query: 232 EIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVL 291
           E+K+S G+P +K R + + +     +MMEA   A +++ NPTHYA+AL+Y     +AP +
Sbjct: 231 EMKESEGSPEVKGRIRQLQQQMANRRMMEAVPTADVVVVNPTHYAVALKYEGGAMNAPKV 290

Query: 292 VAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           VA G +  A ++R++A  + + I   P LAR+L+++  +   IP   Y AVAQ++  +Y 
Sbjct: 291 VALGVDETALRIREVADGNKVAIVSAPPLARALYREGQLGKEIPVRLYSAVAQVLSYVYQ 350


>gi|260438787|ref|ZP_05792603.1| flagellar biosynthetic protein FlhB [Butyrivibrio crossotus DSM
           2876]
 gi|292808776|gb|EFF67981.1| flagellar biosynthetic protein FlhB [Butyrivibrio crossotus DSM
           2876]
          Length = 370

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 107/361 (29%), Positives = 190/361 (52%), Gaps = 16/361 (4%)

Query: 5   DAPDN-KTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           D P   +TE  ++KK++DA  +G    SR+ +   S+L   I L  +         ++  
Sbjct: 12  DGPGGQRTEPATAKKLKDARKKGQVAKSRDLTSSVSLLVFFIILKIYVGTMGTKFINEFK 71

Query: 64  VLL-----ASATQRKLEDISHIVFLLTHLS---LSASRLVIPGLLLFMMFGIGSYLIQRI 115
           V+       +AT  +L  +S   F   ++S   L    +++P +   ++      L+Q  
Sbjct: 72  VIYKKMGEVNATSLELNSLSR--FFKNYMSDAILDMLVILLPIMAAAVLVAFVGDLVQVK 129

Query: 116 PVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTML- 174
                  +KP   + +   GIKRI+S+  LV  +KS + I+ +  ++T +  +    +L 
Sbjct: 130 WKPTAEPMKPKADKFNPVNGIKRIFSVKTLVQLLKS-IAIVAICMLVTYNKLKKEIGLLY 188

Query: 175 DFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIK 234
           +F + +  + +      +  V I I +    + + D  + Y ++ + +KMSKQE+KDE K
Sbjct: 189 NFYNISLEAAIIRMGDVLLDVGITISVIYLIVGIADFIFEYVKFKNDMKMSKQELKDEWK 248

Query: 235 QSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAK 294
            + GNP +KN+QK       R +MM+A   A ++ITNPTH+A+AL+Y Q    APV+VAK
Sbjct: 249 DTEGNPEVKNQQKRRMNEASRRRMMQAVPEADVVITNPTHFAVALKYEQNSGKAPVVVAK 308

Query: 295 GQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQL---IYKIYH 351
           G++ +A+K+++ A ++ + I E   LAR L+  V + S IP   Y+AVA++   ++K+ H
Sbjct: 309 GEDYLAQKIKETARKNQVEIVENKPLARMLYYNVDLGSEIPQELYQAVAEVLAFVWKVKH 368

Query: 352 K 352
           K
Sbjct: 369 K 369


>gi|325527806|gb|EGD05073.1| flagellar biosynthesis protein FlhB [Burkholderia sp. TJI49]
          Length = 308

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 77/227 (33%), Positives = 130/227 (57%)

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
           F R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +    + L 
Sbjct: 37  FDRLNPISGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELLGLATQPLDAALV 96

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
            A   V       +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P +K R 
Sbjct: 97  DALHLVAVCCGTTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEVKREHRENEGDPHVKGRI 156

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           +   R+  R +MM A  +A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A ++R++
Sbjct: 157 RQQQRAIARRRMMAAVPKADVVVTNPTHFAVALQYTDGEMRAPKVVAKGVNLVAARIREL 216

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A EHN+P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 217 AAEHNVPLLEAPPLARALYHNVELEREIPGSLYAAVAEVLAWVYQLK 263


>gi|229827381|ref|ZP_04453450.1| hypothetical protein GCWU000182_02769 [Abiotrophia defectiva ATCC
           49176]
 gi|229788319|gb|EEP24433.1| hypothetical protein GCWU000182_02769 [Abiotrophia defectiva ATCC
           49176]
          Length = 387

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 98/357 (27%), Positives = 182/357 (50%), Gaps = 22/357 (6%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLF-----FFSPGI-------Y 56
           +KTE  + KK+EDA  EG   ++R + L + ++  L++ +      F + G        Y
Sbjct: 34  DKTEKATPKKLEDARKEGR--VARSSDLINGLMLLLMFFVLRIFGNFMAKGFLESFVKYY 91

Query: 57  SVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIP 116
           + T+D+ +        ++ D+   V L   +        +P L+   +      ++Q   
Sbjct: 92  NKTADISM--------EIFDVKQAVNLGNEIVFDIVIACLPVLIGSFLVAFAGNVVQIGW 143

Query: 117 VLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDF 176
            +    +KP   R++   G+KR++S   +V  +KS +K++ +  +    + + +  +L+ 
Sbjct: 144 KVTTKPLKPKLDRLNPIGGLKRMFSQEKVVELIKSILKVLAIAIVAYNEVKDRWLFILNL 203

Query: 177 ISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQS 236
                   + + F  V  V + I +    + + D G+   +    L+MSKQE+KDE+KQS
Sbjct: 204 YDFEFMQAIVNIFDIVLDVGVKISVLFVIIGIADFGYQKWKHLHDLRMSKQEVKDEMKQS 263

Query: 237 YGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQ 296
            G+P +K R +   R   R +MM+   +A ++ITNPTH+A+A++Y + + +AP ++AKG 
Sbjct: 264 EGDPQVKGRIRQKMREGARRRMMQELPKADVVITNPTHFAVAIKYDKEKAEAPYVLAKGA 323

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           + +A  +++ A EH I I E   LAR L+  V I   IPP  Y+ VA+++  +Y  K
Sbjct: 324 DYVAATIKEAAKEHKIEIVENKPLARMLYYNVEIGEQIPPELYQMVAEVLAYVYSVK 380


>gi|218133682|ref|ZP_03462486.1| hypothetical protein BACPEC_01551 [Bacteroides pectinophilus ATCC
           43243]
 gi|217991057|gb|EEC57063.1| hypothetical protein BACPEC_01551 [Bacteroides pectinophilus ATCC
           43243]
          Length = 386

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 101/362 (27%), Positives = 188/362 (51%), Gaps = 20/362 (5%)

Query: 5   DAPDN-KTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFF---FSPGIYSVTS 60
           D P   KTE P++KK+ DA  EG    S+E      +LA  + + F+       +    S
Sbjct: 22  DGPGGEKTEVPTAKKLNDARKEGQVAKSKEIITALMLLALFVVIKFYIGNLGQQMIECFS 81

Query: 61  DLHVLLA-----SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRI 115
           + + L       S    ++ D + +V L     L+   +++P + L ++  I    +Q+ 
Sbjct: 82  EFYDLFGKIISNSEYGMRMVDATGVVSLGLTTVLN---MIVPFIALAVVIAILGNALQQK 138

Query: 116 PVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLD 175
            ++    ++P   ++S   G+KR++++  L    KS   I ++  +I  ++ +    +  
Sbjct: 139 WMVTTKPLQPKLSKISPISGLKRMFNVKQLFEVGKSVAMIAVMSYVIYTTVKDKLGVLYT 198

Query: 176 FISANPHSILYHAFFTVRKVLIMILLFIAT----LTVLDIGWSYHQWYSKLKMSKQEIKD 231
           F + +    LY A   V  +++ + + I+     +  +D+ +  H++   +KM+KQE+KD
Sbjct: 199 FYNIS----LYEALEIVGDIIVDLGIKISAVFLVIGFVDLIYQRHKFKEDMKMTKQEVKD 254

Query: 232 EIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVL 291
           E K + G+P +K + +   +   R +MMEA  +A ++ITNPTH+A+AL+Y   +  APV+
Sbjct: 255 EFKNTEGDPQVKGQIRRRMQQVSRRRMMEALPQADVVITNPTHFAVALKYEANKGQAPVV 314

Query: 292 VAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           +AKG + +A  ++  A E+ I I E   LAR L+  V I + IPP  Y+AVA+++  +Y 
Sbjct: 315 IAKGADYLAFDIKAKAKEYGIEIVENKPLARILYNNVEIGAQIPPELYQAVAEVLAFVYS 374

Query: 352 KK 353
            K
Sbjct: 375 LK 376


>gi|311992333|gb|ADQ26740.1| protein export component [Aeromonas hydrophila]
          Length = 375

 Score =  153 bits (387), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 103/357 (28%), Positives = 179/357 (50%), Gaps = 16/357 (4%)

Query: 5   DAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHV 64
           D    +TE P+ K+++ A  +G    S+E    S +LA +  LL        S+   +  
Sbjct: 2   DTDQERTEQPTGKRLQQAREKGQIARSKELGTASVLLAAVFGLLMVKE----SLAGAMVK 57

Query: 65  LLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLN--- 121
           +L        E       ++T L      L+ P  LLFM+  I +++   + +  +N   
Sbjct: 58  VLTMGFTLDREQAFDPNAMMTMLPALLRELLHPLGLLFMLVAIAAFVGNTL-MGGMNFSS 116

Query: 122 -HVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDF-ISA 179
             + P + ++S   GIKR++ + +LV  +KS  K++ +       L+  +  +L+  +  
Sbjct: 117 EAMLPKWSKLSPLNGIKRMFGVQSLVELVKSIAKVVFISLFAWWMLSSQFNHLLNLSLEG 176

Query: 180 NPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQW--YSKLKMSKQEIKDEIKQSY 237
            P  I+      +    ++I+L  A + ++ I   + QW    +LKM+KQE+KDE K S 
Sbjct: 177 YPGGIIDALDLLL---WMLIILCCALIPIVAIDVPFQQWNHMRQLKMTKQEVKDEFKDSE 233

Query: 238 GNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTE-NDAPVLVAKGQ 296
           G P +K R + +       +MM    +A ++ITNPTHY++AL+Y   +   AP +VAKG 
Sbjct: 234 GKPEVKGRIRRLQMEMAMRRMMGDVPKADVVITNPTHYSVALKYDTAKPGSAPKVVAKGT 293

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           + IA K+R+IA E+ IP+   P+L R+++    I   IP   + AVAQ++  +Y  K
Sbjct: 294 DEIAMKIREIAREYEIPVMPSPALTRAIYHATEIGHEIPEGLFAAVAQVLAYVYQLK 350


>gi|237751917|ref|ZP_04582397.1| flagellar biosynthetic protein flhb [Helicobacter winghamensis ATCC
           BAA-430]
 gi|229376676|gb|EEO26767.1| flagellar biosynthetic protein flhb [Helicobacter winghamensis ATCC
           BAA-430]
          Length = 354

 Score =  153 bits (387), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 104/351 (29%), Positives = 186/351 (52%), Gaps = 14/351 (3%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILA--CLIYLLF-FFSPGIYSVTS 60
           +DA   KTE P+++KIE A  EGN   S + + F  ++    L++L F F+  G+ SV  
Sbjct: 3   DDA--EKTEEPTARKIEKAREEGNVLKSPDVNAFLGLVVGLALVFLCFNFWVRGLGSVFE 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            ++   +    R     ++ + +   L      L+ P     M+ G+ + + Q   +L  
Sbjct: 61  QIYQSFSQEFTR-----ANAMSITLSLVFQVLYLLAPIFGALMLIGVIANVSQSGFLLTA 115

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVN-FMKSFVKIILVGTIITISLTENYFTMLDFISA 179
             ++P  ++++   G+K + S+  L++ F+ +F   +L   II   +   +   L  ++ 
Sbjct: 116 KAIQPKLQKLNFITGMKNLISLKKLLDGFLITFK--VLSAFIIAFFVFLGFMHELTTVAL 173

Query: 180 NPHSILYHAFFTVRKVLIMILL-FIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYG 238
            P       F     +LI ILL F   +  +D     +Q++  L+MSKQE+KDE K   G
Sbjct: 174 FPLGDQMLWFRDKAIILIGILLAFFLVMASVDYMIKRYQYFKSLRMSKQEVKDEFKNQEG 233

Query: 239 NPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL 298
           +  +K + +S+     R +MM+    A +++TNPTHYA+ALRY   +  AP ++AKG + 
Sbjct: 234 DQQVKGKIRSLMFQAARKRMMQNIPSADVVVTNPTHYAVALRYDSKKERAPRVLAKGVDF 293

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKI 349
           +A+++++IA EH IPI E P LAR+L+K V ++  IP   Y+A+  ++ ++
Sbjct: 294 LAQRIKEIATEHEIPIIENPPLARALYKDVDLDMEIPESLYQAMVNVLLEV 344


>gi|226313051|ref|YP_002772945.1| flagellar biosynthetic protein FlhB [Brevibacillus brevis NBRC
           100599]
 gi|226095999|dbj|BAH44441.1| flagellar biosynthetic protein FlhB [Brevibacillus brevis NBRC
           100599]
          Length = 365

 Score =  153 bits (386), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 106/345 (30%), Positives = 182/345 (52%), Gaps = 7/345 (2%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE  + KK +DA  +G    S++ S   S+ A    L+   S  + +    +   L +
Sbjct: 18  EKTEKATPKKKQDARKKGQVAKSQDLSPALSLTAFFFLLMMLGSTMLGTFQDLMRESLIT 77

Query: 69  ATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFK 128
            T  +L +  ++  ++  L   A ++V P L L  +       +Q     +   ++   +
Sbjct: 78  YTTWQLNE-ENLKVMVMQLVFEAIKIVGPILGLSFLVAFAVNYMQVGWHFSTEPLQMKLE 136

Query: 129 RVSLREGIKRIYSINNLVNFMKSFVKI---ILVGTIITISLTENYFTMLDFISANPHSIL 185
           ++   +G KRI+S+ +LV  +KS +KI   I V  +I  +  E     L  +S    ++L
Sbjct: 137 KIDPIKGAKRIFSLRSLVELLKSLLKISAGIYVAYVILWNAKEQ-VVQLSLLSLG--AVL 193

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
                 V K+ I + L +  L VLD  +  ++    L+MSKQ++KDE KQ+ G+P+IK +
Sbjct: 194 SFTAEEVTKLGIYLGLLLFILAVLDYAYQRYEHEKNLRMSKQDLKDEHKQAEGDPLIKGK 253

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
            +   RS    +MM+   +A +IITNPTH+A+A+RY  +   AP ++AKGQ+ +A K+R+
Sbjct: 254 IRERQRSMAIRRMMQELPKADVIITNPTHFAVAVRYDASAMSAPTVIAKGQDYLALKIRE 313

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           +A +H I   E   LAR+L+ QV +   IP   +KAVA+++  +Y
Sbjct: 314 VAKKHRIVTMENKPLARALYSQVEVGQQIPEEMFKAVAEVLAYVY 358


>gi|300697969|ref|YP_003748630.1| flagellar export pore protein [Ralstonia solanacearum CFBP2957]
 gi|299074693|emb|CBJ54250.1| flagellar export pore protein [Ralstonia solanacearum CFBP2957]
          Length = 387

 Score =  153 bits (386), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 106/358 (29%), Positives = 181/358 (50%), Gaps = 32/358 (8%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE  S++++E A  EG+ P SRE          + ++L   S G   V  +  V  AS
Sbjct: 8   EKTEPASARRLEQAREEGDVPQSRE---------LVSFVLLAVSAGGLWVMGESIVRAAS 58

Query: 69  A-TQRKLE----DISHIVFLLTHLSLSASRL--VIPGLLLFMMFGIGSYLIQRIPVLNLN 121
           A   R LE    D +       ++      L  V+ GL+L ++    + L      ++L 
Sbjct: 59  AFLARCLEFHRYDYTRAQDQWQYVGAQFGPLATVLAGLMLMLVLAALAPLALTRGAISLK 118

Query: 122 HVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTML----DFI 177
            + P   R+    G+KR++S+  L+   +   K+ LVG +        ++ +L    DF+
Sbjct: 119 PLTPDITRLIGMHGLKRMFSVQGLLELPRLLAKLALVGGV-------GWWLILHYRDDFV 171

Query: 178 SANPHSILYHAFFTVRKVLIMILLFIATLTVL----DIGWSYHQWYSKLKMSKQEIKDEI 233
              P   L         V  +  L +A + +L    D+  +  Q+  K +M+K+E++ E 
Sbjct: 172 EL-PRQDLAAGMHDTMHVAGVAFLCMAGVMLLVAAVDVPLALWQYARKHRMTKEEVRKEH 230

Query: 234 KQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVA 293
           ++S G+P +K R +++ R   + +MM    +A +I+TNPTHYA+ALRY + E  AP ++A
Sbjct: 231 RESEGDPQLKGRIRAMQRQAAQRRMMADVPKADVIVTNPTHYAVALRYSEQEGGAPRVLA 290

Query: 294 KGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           KG +++A K+R++  EH IP+ E P LAR+L++   I   IP   Y AVA+++  +Y 
Sbjct: 291 KGADMVAAKIRELGAEHKIPMLEAPPLARALYRHTEIGHQIPTALYAAVAEVLAYVYQ 348


>gi|302387776|ref|YP_003823598.1| flagellar biosynthetic protein FlhB [Clostridium saccharolyticum
           WM1]
 gi|302198404|gb|ADL05975.1| flagellar biosynthetic protein FlhB [Clostridium saccharolyticum
           WM1]
          Length = 353

 Score =  153 bits (386), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 101/349 (28%), Positives = 190/349 (54%), Gaps = 7/349 (2%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDL--- 62
           A D+KTE  + KK  D   +G+  +S++  + +S+L   + L   F P +Y    +    
Sbjct: 2   AGDSKTEKATPKKRRDERKKGHVAVSKDVVMVASLLGIFMMLKLLF-PFMYKTLRNYMIK 60

Query: 63  HVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNH 122
           ++ LA A +  L D +   ++ T +++   +   P LL  ++  + +  +Q   +   ++
Sbjct: 61  YISLAPAAE-TLSDYTTKAYMDTVIAVL--KACFPILLAAVLLAVIATGVQTRFLFTKSN 117

Query: 123 VKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPH 182
           + P F R++  +GIK I S+ +LV  +KS +KII++  I+   +  +   +   I     
Sbjct: 118 LAPKFDRLNPLQGIKNILSVKSLVELIKSLIKIIILILILYQIIKGDLRAVARTIDMELQ 177

Query: 183 SILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPII 242
               +    + +++I + +    +   D  + +  +  +++MSKQE+K+E KQ+ GNP I
Sbjct: 178 DSAVYVLNAILEMIIKVSIVFLAIAGFDFFYQWWDFERQIRMSKQELKEEYKQTEGNPEI 237

Query: 243 KNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKK 302
           K R ++I R R R +MM+A   A +I+ NPTHYA+ALRY   +++APVLVAKGQ+ +A +
Sbjct: 238 KGRIRNIQRERARSRMMQAVPTADVIVRNPTHYAVALRYNIEKDNAPVLVAKGQDELALR 297

Query: 303 MRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           +  +  E+ + + E   LAR ++    + + IPP +Y  VA+++  +Y 
Sbjct: 298 IVAVGEENGVYVLENKPLARGIYAGTQVGAEIPPEYYGMVAEILVYVYR 346


>gi|207725003|ref|YP_002255400.1| flagellar biosynthetic protein flhb [Ralstonia solanacearum MolK2]
 gi|206590230|emb|CAQ37191.1| flagellar biosynthetic protein flhb [Ralstonia solanacearum MolK2]
          Length = 387

 Score =  153 bits (386), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 105/358 (29%), Positives = 181/358 (50%), Gaps = 32/358 (8%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE  S++++E A  EG+ P SRE          + ++L   S G   V  +  V  AS
Sbjct: 8   EKTEPASARRLEQAREEGDVPQSRE---------LVSFVLLTVSAGGLWVMGESIVRAAS 58

Query: 69  A-TQRKLE----DISHIVFLLTHLSLSASRL--VIPGLLLFMMFGIGSYLIQRIPVLNLN 121
           A   R LE    D +       ++      L  V+ GL+L ++    + L      ++  
Sbjct: 59  AFLARCLEFHRYDYTRAQDQWQYVGAQFGPLATVLAGLMLMLVLAALAPLALTRGAISFK 118

Query: 122 HVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTML----DFI 177
            + P   R+    G+KR++S+  L+   +   K++LVG +        ++ +L    DF+
Sbjct: 119 PLTPDITRLIGMHGLKRMFSVQGLLELPRLLAKLVLVGGV-------GWWLILHYRDDFV 171

Query: 178 SANPHSILYHAFFTVRKVLIMILLFIATLTVL----DIGWSYHQWYSKLKMSKQEIKDEI 233
              P   L         V  +  L +A + +L    D+  +  Q+  K +M+K+E++ E 
Sbjct: 172 EL-PRQDLVAGMHDTMHVAGVAFLCMAGVMLLVAAVDVPLALWQYARKHRMTKEEVRKEH 230

Query: 234 KQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVA 293
           ++S G+P +K R +++ R   + +MM    +A +I+TNPTHYA+ALRY + E  AP ++A
Sbjct: 231 RESEGDPQLKGRIRAMQRQAAQRRMMADVPKADVIVTNPTHYAVALRYSEQEGGAPRVLA 290

Query: 294 KGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           KG +++A K+R++  EH IP+ E P LAR+L++   I   IP   Y AVA+++  +Y 
Sbjct: 291 KGADMVAAKIRELGAEHKIPMLEAPPLARALYRHTEIGHQIPTALYAAVAEVLAYVYQ 348


>gi|238755333|ref|ZP_04616676.1| Flagellar biosynthetic protein flhB [Yersinia ruckeri ATCC 29473]
 gi|238706469|gb|EEP98843.1| Flagellar biosynthetic protein flhB [Yersinia ruckeri ATCC 29473]
 gi|253317686|gb|ACT22775.1| flagellar biosynthesis protein FlhB [Yersinia ruckeri]
          Length = 383

 Score =  153 bits (386), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 104/353 (29%), Positives = 178/353 (50%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+   KTE P++ K+E A  +G  P SRE +    + A L  L  F      S+   L 
Sbjct: 3   EDSDLEKTEEPTAHKLEKAREKGQIPRSRELTSMLMLGAGLSILWVFGE----SIGRQLA 58

Query: 64  VLLASATQRKLEDISHIVFLLTHLSL---SASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            ++A   Q     I +   +L  + +      + ++P  +  ++  I   ++      + 
Sbjct: 59  AMIAQGLQFNHGVIGNEKQMLRQVGMLLMQTVKALLPVFIGLVLVAISVPMLLGGIAFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
              K   KR++   G+KR++S   L   +K+ +K  LVG +  + L   +  ML  I+A 
Sbjct: 119 ESFKFDLKRMNPISGLKRMFSSQVLAELLKAILKATLVGWVTGMFLWHYWPDMLRLIAAP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + L  A   +     +++L +  +   D+ +       KL+M+KQEI+DE K   G+P
Sbjct: 179 PIAALGDALHLILFCGFIVVLGLTPMVGFDVFYQIMSHIKKLRMTKQEIRDEFKDQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A +I+TNPTHYA+AL+Y + +  AP ++AKG   +A
Sbjct: 239 HVKGRIRQQQRAMARRRMMADVPQADVIVTNPTHYAVALQYNENKMSAPKVLAKGAGEVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++  EH IP+ E P LAR+L++   I   IP   Y AVA+++  +Y  K
Sbjct: 299 LRIRELGAEHRIPMLEAPPLARALYRHSEIGQHIPATLYAAVAEVLAWVYQLK 351


>gi|325917832|ref|ZP_08180011.1| flagellar biosynthetic protein FlhB [Xanthomonas vesicatoria ATCC
           35937]
 gi|325535943|gb|EGD07760.1| flagellar biosynthetic protein FlhB [Xanthomonas vesicatoria ATCC
           35937]
          Length = 376

 Score =  153 bits (386), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 94/354 (26%), Positives = 182/354 (51%), Gaps = 7/354 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE+D    +TE P+ K++ +A  +GN P SRE S  +++    ++ L   + GI    +
Sbjct: 1   MSESDDGGERTELPTEKRLREAREQGNFPQSRELST-AAVFGAGVFGLMALAGGIGDGAA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLS---LSASRLVIPGLLLFMMFGIGSYLIQRIPV 117
              V + +A         H + L  H     L    +++P + + ++ G+   L+     
Sbjct: 60  ---VWMKTALSPDPRMREHPMALFGHFGDLLLQLLWVMLPLIGVCLLAGLAGPLMMSGLH 116

Query: 118 LNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFI 177
            +   + P   +++   GIKR++  N+L   +KS ++++ VG    + ++++   +   +
Sbjct: 117 FSSKAIMPDLTKLNPMNGIKRMWGSNSLAELVKSVLRLLFVGLAAWLCISKSLPGLRALV 176

Query: 178 SANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSY 237
           +      + +     + +L      +  L  +D  +    W  KLKM+++EIK E+K+S 
Sbjct: 177 NQPLEQAVGNGLDFTKSLLFYTAGALVLLAAIDAPYQKWNWLRKLKMTREEIKREMKESE 236

Query: 238 GNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQN 297
           G+P +K R + +     + +MMEA  +A +++ NPTHYA+AL+Y   +  AP++VAKG +
Sbjct: 237 GSPEVKGRIRQMQMQMSQRQMMEAVPKADVVLMNPTHYAVALKYEGGKMRAPIVVAKGVD 296

Query: 298 LIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            +A ++R+   +H + I   P LAR+L+++  I   IP   Y  VAQ++  +Y 
Sbjct: 297 EMAFRIRETCEQHRVAIVTAPPLARALYREAQIGKEIPVRLYSVVAQVLSYVYQ 350


>gi|51246526|ref|YP_066410.1| flagellar biosynthesis protein FlhB [Desulfotalea psychrophila
           LSv54]
 gi|50877563|emb|CAG37403.1| related to flagellar biosynthetic protein (FlhB) [Desulfotalea
           psychrophila LSv54]
          Length = 355

 Score =  153 bits (386), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 112/361 (31%), Positives = 187/361 (51%), Gaps = 22/361 (6%)

Query: 4   NDAP--DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSD 61
            +AP    +TE  SSK+ ED   +G    S+E    +     L++  F+   GI+     
Sbjct: 3   EEAPTGGERTEDASSKRREDFRKKGQVAQSKEVQTAALFTLLLLFWSFYI--GIFG--RK 58

Query: 62  LHVLLASATQRKLEDISHIVFLLTHLSL----SASRLVIPGLLLFMMFGIGSYLIQRIPV 117
           L +L+ S  Q  LE  S        L+L      + ++ P  LL ++ GI S   Q   +
Sbjct: 59  LLILIQSIWQ-SLESFSPTPSQTMQLALFVIKECAIILAPLFLLVVIVGIASSFFQIGWL 117

Query: 118 LNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFI 177
                + P F +++   G  R +S  + +  +KS  K+ L+G +   ++ E++   L   
Sbjct: 118 FTTKPLSPDFSKMNPIAGFGRFFSKKSFIEVIKSLSKVTLIGWLAFSTIIEHFNEALVQT 177

Query: 178 SANPHSILYHAFFTVRKVLIM-----ILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDE 232
             +P + L   F  V   LI+     IL+ +A +  L + W   +   K+KM+KQE K+E
Sbjct: 178 DTSPMATL--VFIGVTASLIVAKVCAILILLAFIDFLYVKWEMEE---KMKMTKQEQKEE 232

Query: 233 IKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLV 292
            K+S G+P IK++ ++I +   R +MM     A +IITNPTH ++ALRY   ++ AP++V
Sbjct: 233 FKESEGDPHIKSQIRAIQQEMARKRMMADVPGADVIITNPTHISIALRYRAGQDQAPIIV 292

Query: 293 AKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
           AKG + +A K+R+IA E++IPI E P +AR L K + I  ++P   +  VA+++  +Y  
Sbjct: 293 AKGVDFVAMKIREIARENSIPIIENPPVARMLHK-IEIGGSVPEEMFAVVAEILAHVYSL 351

Query: 353 K 353
           K
Sbjct: 352 K 352


>gi|311030112|ref|ZP_07708202.1| flagellar biosynthesis protein FlhB [Bacillus sp. m3-13]
          Length = 362

 Score =  152 bits (385), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 106/350 (30%), Positives = 194/350 (55%), Gaps = 17/350 (4%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE  + KK +D   +G   +++ A + +S +   ++L  F + G +     L +   S
Sbjct: 15  EKTEKATPKKKQDTRKKGQ--VAKSADVNTSFVLIAVFLCLF-AIGPWMKDETLKLFEHS 71

Query: 69  ATQRKLEDIS----HIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVK 124
                LE+++    H++FL   L +    ++ P +L  ++  + +  +Q  P+ +   + 
Sbjct: 72  FRVYLLEEVTVQKVHMIFL--ELIMQLIWIIGPIMLAALLGAVIANYLQVGPLFSTEAIH 129

Query: 125 PSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSI 184
               ++   +G KRIYS+  +V  +KS +KI+ VG IIT S+    +  L+ +       
Sbjct: 130 MKLNKLDPIQGFKRIYSVRAIVELVKSMLKIVFVG-IITFSIL---WMSLEEVLILSQKN 185

Query: 185 LYHAFFTVRKVLIMILLFIAT----LTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           L+ AF  +  + + + LF       L++ D  +  + +   ++MSK ++KDE K++ G+P
Sbjct: 186 LHEAFAFLGTLTVRMGLFAGGALLFLSIFDYLYQKYDYEKNIRMSKHDVKDEYKKAEGDP 245

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           +IK++ K   R     +MM+   +A +IITNPTH+A+AL+Y +++ DAP+++AKG + +A
Sbjct: 246 LIKSKIKQKQREMAMQRMMQDVPQADVIITNPTHFAIALKYDESKGDAPIVLAKGVDYVA 305

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           KK+++ A EHNI   E   LARSL+ Q  I  AIP  F++AVA+++  +Y
Sbjct: 306 KKIKEKAKEHNIVTVENKPLARSLYSQAEIGDAIPEEFFQAVAEILAYVY 355


>gi|260768792|ref|ZP_05877726.1| flagellar biosynthesis protein FlhB [Vibrio furnissii CIP 102972]
 gi|260616822|gb|EEX42007.1| flagellar biosynthesis protein FlhB [Vibrio furnissii CIP 102972]
          Length = 372

 Score =  152 bits (385), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 102/350 (29%), Positives = 186/350 (53%), Gaps = 13/350 (3%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS  D    KTE  SS+K++ A  +G    S+E   FSS +  ++ + +F++    S++ 
Sbjct: 1   MSSGD----KTEQASSQKLDKARKQGQIARSKE---FSSAIMLMVCIGYFYANA-DSLSG 52

Query: 61  DLHVLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLL-FMMFGIGSYLIQRIP 116
            L  L   +   T     D  HI+ L+T       ++  P ++  F+   I + L+    
Sbjct: 53  HLMQLFEVSFRFTAESQSDHDHILHLITQSLYLMIKVFAPLIIFQFIASAIATCLLGGFH 112

Query: 117 VLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDF 176
             NL+ + P F +++   GIKRI+S   LV F+K+  KI L+  ++   ++ N+  +   
Sbjct: 113 -FNLSLLAPKFSKINPLSGIKRIFSKQTLVEFLKNVAKISLIFALLYYMISTNFHMIGSL 171

Query: 177 ISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQS 236
           + A+  + ++ +   V ++L M++L      V+DI +    + +++KM+KQE+K E K+ 
Sbjct: 172 VRASFQTTIHFSLQYVLELLGMLILIAILFGVIDIPYQKMTFGTQMKMTKQEVKQEHKEQ 231

Query: 237 YGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQ 296
            G P IK+R + I     R    +    A +++ NPTH+A+AL+Y  T+ +AP +VAKG+
Sbjct: 232 EGRPEIKSRIRQIQMQNARRSASQTVPTADVVLMNPTHFAVALKYDLTKAEAPFVVAKGK 291

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           N +A  +R +A +H + +   P + RS++    +N  IP   + AVAQ++
Sbjct: 292 NEVAFYIRTLAEQHQVEVLVVPEITRSIYHTTQLNQMIPNQLFLAVAQIL 341


>gi|332981452|ref|YP_004462893.1| flagellar biosynthetic protein FlhB [Mahella australiensis 50-1
           BON]
 gi|332699130|gb|AEE96071.1| flagellar biosynthetic protein FlhB [Mahella australiensis 50-1
           BON]
          Length = 361

 Score =  152 bits (385), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 98/354 (27%), Positives = 181/354 (51%), Gaps = 15/354 (4%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS---DL 62
           A D KTE P+ K+  +A  +G    S E ++ + +LA  + +   F   +  +T+    +
Sbjct: 11  ADDEKTEQPTPKRRREAREKGQVFKSAEINMVAVLLASFLVIKAIFPSLLQILTAYERQI 70

Query: 63  HVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIG----SYLIQRIPV- 117
           + +  SA      +    +F+ T + +     +    +  +   +      ++    P+ 
Sbjct: 71  YTMAGSADSIYTSENLSTLFINTIIQIGKGLWIFIFGICIIGIAVNIAQVGFVFSAKPLA 130

Query: 118 LNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFI 177
           ++L H+ P+        G KRI+S   +   +KS +KI ++G +    +  +    L   
Sbjct: 131 MDLGHLNPA-------AGFKRIFSKRAVNELVKSILKIAIIGYVAYTEIRNDINIFLAMS 183

Query: 178 SANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSY 237
                 ++Y     V    I +   +AT+ VLD  +   ++   L+MSKQE+K E K++ 
Sbjct: 184 REGTSVMIYDMVSIVLNAAIKLTAVMATVAVLDYIFQRREYERNLRMSKQEVKQEFKETE 243

Query: 238 GNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQN 297
           G+P IK R + I R     +MM+   +A ++ITNPTH+A+ALRY    + APV++AKG +
Sbjct: 244 GDPQIKARIRQIQRQLAMMRMMQQVPKADVVITNPTHFAVALRYDAETDQAPVILAKGVD 303

Query: 298 LIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            +A++++++A +  +PI E   LAR+L+  V I   IPP FY+AVA+++  +Y+
Sbjct: 304 YMAQRIKEVARQSRVPIVENRELARNLYYAVDIGQIIPPQFYEAVAEVLAYVYN 357


>gi|323705428|ref|ZP_08117003.1| flagellar biosynthetic protein FlhB [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323535330|gb|EGB25106.1| flagellar biosynthetic protein FlhB [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 357

 Score =  152 bits (385), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 100/344 (29%), Positives = 180/344 (52%), Gaps = 2/344 (0%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA- 67
            KTE  + K+ +DA  +G    SRE +     +A  + + F     I  + + +  L   
Sbjct: 9   EKTEPATPKRRQDARKKGQVFQSREVTSALVTIAGFLVIYFTVQNSIAEIMNLIKFLFLN 68

Query: 68  -SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
                  +  I+ I  L   +     +L++P +    +  + S   Q   V  L  +   
Sbjct: 69  YGGASDNVFTINGIYKLFEMVFSVFIKLILPTIATVFIIALISTYAQVGFVFTLETLNFK 128

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
            +R++  +G+KR++S  +L+  +KS +KI ++  ++   L   Y  +   +  +   ++ 
Sbjct: 129 LERLNPLDGLKRMFSKRSLLELVKSIIKISILAYVMYSFLIGQYKGIPQLLDMSVQDLIK 188

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
           +       +L+ I L +  L  +D  + + ++ S L+MSK++IK+E K++ GNP IK+  
Sbjct: 189 YNMNIFAGILLRISLVLVVLGAIDYVYQWREYESNLRMSKEDIKEEFKETEGNPQIKSEI 248

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           +   R     +MM+   +A ++ITNPTH A+AL Y    NDAPV+VAKGQ+ IA+K+++ 
Sbjct: 249 RKKQRQISMRRMMQNIKKADVVITNPTHIAVALMYDNEINDAPVVVAKGQDYIAQKIKEE 308

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           A +++I I E   LA+SL+K   I  +IPP  YKAVA+++  +Y
Sbjct: 309 AIKYSIAIVENKPLAQSLYKTTEIGDSIPPELYKAVAEVLAYVY 352


>gi|294635599|ref|ZP_06714076.1| flagellar biosynthetic protein FlhB [Edwardsiella tarda ATCC 23685]
 gi|291091051|gb|EFE23612.1| flagellar biosynthetic protein FlhB [Edwardsiella tarda ATCC 23685]
          Length = 401

 Score =  152 bits (385), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 114/369 (30%), Positives = 177/369 (47%), Gaps = 49/369 (13%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE P+  +IE A  +G  P SRE    +S+L   + L      G Y + S L V++A 
Sbjct: 21  EKTEDPTPHRIEKAREKGQIPRSRE---LTSMLMLAVGLAILLLGGDY-LASSLAVMIAQ 76

Query: 69  ATQRKLEDISHIVFLLTHLSLSASR--LVIPGLLLFMMFG-------------------I 107
                            HL LS  R  L+  G+LL                        I
Sbjct: 77  GLH------------FDHLLLSNDRQMLIQLGMLLRQAVAALLPVLLGLMLVGWCAPMLI 124

Query: 108 GSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLT 167
           G +L       N   +K    R++   G KR++S   L   +K  +K  LVG +    L 
Sbjct: 125 GGFL------FNPGSIKCELNRLNPLTGFKRMFSSQVLAELLKGVLKATLVGCVTGWFLW 178

Query: 168 ENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYS---KLKM 224
             +  ML  I+ +    +  A   V    ++++L +  +   D+   ++Q +S   KL+M
Sbjct: 179 HYWPRMLRLITESSLEAMGDALHLVGMCGLLVVLGLLPMVGFDV---FYQLWSNLNKLRM 235

Query: 225 SKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQT 284
           +KQEIKDE K+  G+P +K R +   R+  R +MM    +A +I+TNPTHYA+AL+Y + 
Sbjct: 236 TKQEIKDEFKEQEGDPHVKGRIRQQQRAAARRRMMSDVPKADVIVTNPTHYAVALQYQEN 295

Query: 285 ENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQ 344
           +  AP ++AKG   IA++++ +  EH IP  E P LAR+L++   I  AIP   Y AVA+
Sbjct: 296 KMSAPKVLAKGAGNIAQRIKALGMEHRIPQLEAPPLARALYRHSEIGQAIPATLYAAVAE 355

Query: 345 LIYKIYHKK 353
           ++  +Y  K
Sbjct: 356 VLAWVYQLK 364


>gi|261344152|ref|ZP_05971796.1| flagellar biosynthetic protein FlhB [Providencia rustigianii DSM
           4541]
 gi|282567746|gb|EFB73281.1| flagellar biosynthetic protein FlhB [Providencia rustigianii DSM
           4541]
          Length = 383

 Score =  152 bits (385), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 111/360 (30%), Positives = 180/360 (50%), Gaps = 35/360 (9%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLF----------------FFS 52
            KTE P+  K + A ++G    S+E S    +LA +  L                  F  
Sbjct: 8   EKTEEPTPHKKQKAKDDGQIVRSKELSSLMMMLAGVSLLWLSGGHLAAQLRQIMRQGFIF 67

Query: 53  PGIYSVTSDLHV-LLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYL 111
            G Y   + L +  L S     L  +  ++  L  + +SAS LV  G LLF      S L
Sbjct: 68  DGHYLQNTKLMLNYLGSVVSEALFALLPVIGGLALVGISASSLV--GGLLF-----NSKL 120

Query: 112 IQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYF 171
           I+  P           K++   +G+KRI+S+N L    K+ +K + VG    I L +++ 
Sbjct: 121 IKFDP-----------KKLDPIKGLKRIFSMNALSELFKAILKSLFVGLGTWIFLWQSWP 169

Query: 172 TMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKD 231
           ++L  +   P + L +A   V     +I+  +  +   D+ + +     KL+MS+QEIKD
Sbjct: 170 SLLHLVMEPPVTALGNALEKVIFAGYLIVFMLIPMVAFDVFYQFRSHLKKLRMSRQEIKD 229

Query: 232 EIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVL 291
           E KQ  G+P IK + +   R+  R++MM     A +I+TNPTHYA+AL+Y   +  AP +
Sbjct: 230 EFKQQEGDPHIKAKIRQQQRAIARNRMMADVPSADVIVTNPTHYAVALKYDDKKMGAPKV 289

Query: 292 VAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           +AKG  +IA+++++I  E+ I   E P LAR+L++   I  +IP   Y AVA+++  +Y 
Sbjct: 290 LAKGAGVIAQRIKEIGEENRILQLEAPPLARALYRHAEIGQSIPVALYAAVAEVLAWVYQ 349


>gi|162210026|ref|YP_331480.2| flagellar biosynthesis protein FlhB [Burkholderia pseudomallei
           1710b]
          Length = 405

 Score =  152 bits (385), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 103/350 (29%), Positives = 179/350 (51%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+  ++TEA + K+ E A  EG    SRE + F+ + A          P    + + LH
Sbjct: 7   EDSDLDRTEAATPKRREKAREEGQVARSRELASFALLSAGFYGAWMLSGPIGEHLRTMLH 66

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
               S  +    D + ++     LSL     + P L L  +  + + +     +++    
Sbjct: 67  TAF-SFDRAAAFDTNRMLSHAGTLSLEGLYALAPVLALTGVAALAAPMAMGGWLVSTKTF 125

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +  F+R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +   H+
Sbjct: 126 ELKFERLNPITGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELLGLATQPLHA 185

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            L  A   V     M +  +  +  LD+ +   Q+  KL+M+K+EIK E +++ G+P +K
Sbjct: 186 ALADALHLVAVCCGMTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEIKREHRENEGDPHVK 245

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R +   R+  R +MM     A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A ++
Sbjct: 246 GRIRQQQRAMARRRMMANVPTADVVVTNPTHFAVALKYTDGEMRAPKVVAKGVNLVAARI 305

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R++A EH++P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 306 RELAAEHHVPLLEAPPLARALYHNVELEREIPGTLYSAVAEVLAWVYQLK 355


>gi|76581465|gb|ABA50940.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei
           1710b]
          Length = 470

 Score =  152 bits (385), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 103/350 (29%), Positives = 179/350 (51%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+  ++TEA + K+ E A  EG    SRE + F+ + A          P    + + LH
Sbjct: 72  EDSDLDRTEAATPKRREKAREEGQVARSRELASFALLSAGFYGAWMLSGPIGEHLRTMLH 131

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
               S  +    D + ++     LSL     + P L L  +  + + +     +++    
Sbjct: 132 TAF-SFDRAAAFDTNRMLSHAGTLSLEGLYALAPVLALTGVAALAAPMAMGGWLVSTKTF 190

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +  F+R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +   H+
Sbjct: 191 ELKFERLNPITGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELLGLATQPLHA 250

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            L  A   V     M +  +  +  LD+ +   Q+  KL+M+K+EIK E +++ G+P +K
Sbjct: 251 ALADALHLVAVCCGMTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEIKREHRENEGDPHVK 310

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R +   R+  R +MM     A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A ++
Sbjct: 311 GRIRQQQRAMARRRMMANVPTADVVVTNPTHFAVALKYTDGEMRAPKVVAKGVNLVAARI 370

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R++A EH++P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 371 RELAAEHHVPLLEAPPLARALYHNVELEREIPGTLYSAVAEVLAWVYQLK 420


>gi|254258153|ref|ZP_04949207.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei
           1710a]
 gi|254216842|gb|EET06226.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei
           1710a]
          Length = 401

 Score =  152 bits (385), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 105/353 (29%), Positives = 182/353 (51%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+  ++TEA + K+ E A  EG    SRE + F+ + A          P    + +
Sbjct: 1   MAE-DSDLDRTEAATPKRREKAREEGQVARSRELASFALLSAGFYGAWMLSGPIGEHLRT 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            LH    S  +    D + ++     LSL     + P L L  +  + + +     +++ 
Sbjct: 60  MLHTAF-SFDRAAAFDTNRMLSHAGTLSLEGLYALAPVLALTGVAALAAPMAMGGWLVST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
              +  F+R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +  
Sbjct: 119 KTFELKFERLNPITGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELLGLATQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            H+ L  A   V     M +  +  +  LD+ +   Q+  KL+M+K+EIK E +++ G+P
Sbjct: 179 LHAALADALHLVAVCCGMTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEIKREHRENEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM     A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A
Sbjct: 239 HVKGRIRQQQRAMARRRMMANVPTADVVVTNPTHFAVALKYTDGEMRAPKVVAKGVNLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EH++P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 299 ARIRELAAEHHVPLLEAPPLARALYHNVELEREIPGTLYSAVAEVLAWVYQLK 351


>gi|315452646|ref|YP_004072916.1| flagellar biosynthetic protein flhB [Helicobacter felis ATCC 49179]
 gi|315131698|emb|CBY82326.1| flagellar biosynthetic protein flhB [Helicobacter felis ATCC 49179]
          Length = 352

 Score =  152 bits (385), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 112/352 (31%), Positives = 185/352 (52%), Gaps = 15/352 (4%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
           A + KTE PS+KKIE A  EGN   S E   F  ++A    ++ FFS  +    S   + 
Sbjct: 2   AEEEKTELPSAKKIEKAREEGNVAKSLEVVGFLGLVAGFGGVMAFFSMWLDHFES---IF 58

Query: 66  LASATQRKLEDISH-IVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVK 124
             S     L+   H +  L   L    + +++P L L  +    + ++Q   + +   + 
Sbjct: 59  RQSLRWIALDFTPHNLHLLSLQLLKDVAWVLLPFLFLMFVVAFLANVVQFGLLFSPKAIV 118

Query: 125 PSFKRVSLREGIKRIYSINNLVN--FMKSFVKIILVGTIITISLTENYFTMLDFISANPH 182
           P F +++   G+K ++S+  L++   + + V I  V   + +SL       +  +     
Sbjct: 119 PKFSKINPINGLKNLFSLKKLLDGLLITAKVCIAFVLGFVVVSLFIGELAKIARVEIRDQ 178

Query: 183 SILYHAFFTVRKVLIMI--LLFIATL-TVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
           ++ +       K LI+I  LLF+  + ++LD      Q+ + LKM+KQE+KDE KQ  GN
Sbjct: 179 ALWFE-----HKALILIASLLFLFLVASLLDFLLKRRQYINSLKMTKQEVKDEYKQQEGN 233

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLI 299
           P IK + K +       KMM A   A +++TNPTHYA+ALR+ + ++ APV+VAKG   +
Sbjct: 234 PEIKAKIKQLMLKNSMSKMMAAIPSANVVVTNPTHYAVALRF-EEKDVAPVVVAKGIEHL 292

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           A +++ IA EH I I E P LAR L+K+V ++  IP + ++AVA +  ++ H
Sbjct: 293 AIRIKAIAREHEIEIIENPKLARELYKEVDVDEVIPKMLFEAVAIVFAQVAH 344


>gi|149377872|ref|ZP_01895601.1| Flagellar biosynthesis pathway, component FlhB [Marinobacter
           algicola DG893]
 gi|149357814|gb|EDM46307.1| Flagellar biosynthesis pathway, component FlhB [Marinobacter
           algicola DG893]
          Length = 378

 Score =  152 bits (384), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 101/366 (27%), Positives = 175/366 (47%), Gaps = 33/366 (9%)

Query: 2   SENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFF---FSPGIYSV 58
            END    KTE  + +++E A  +G    S+E +  + +LA    LL F       + S+
Sbjct: 3   EENDNSQEKTEEATPRRLEKAREDGQTARSKELATMAVLLAGAGGLLMFGASMGASLESI 62

Query: 59  TSDLHVLLASATQRKLEDISHIVFLLTHLSL----SASRLVIPGLLLFMM---------F 105
             D  VL  SA           +F   H+S+    SA    +    L ++          
Sbjct: 63  MRDSFVLERSA-----------IFDTRHMSVQLMASAKEAALSLAPLLILLLVAAVAGSI 111

Query: 106 GIGSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITIS 165
           GIG  L+      +   + P   R+   +G+KR++S+ +L+  +K+ +K+ LV  +  + 
Sbjct: 112 GIGGLLV------SGKAIAPKLNRMDPLKGLKRMFSMRSLIELVKAILKVGLVMAVAILI 165

Query: 166 LTENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMS 225
           L      +L        S + H  +T+     ++      +  +D+ +       KL+M+
Sbjct: 166 LNLRTDDLLSIAEEPARSAMEHVVWTMAWSFFILACATIVIAAIDVPFQIFDHQKKLRMT 225

Query: 226 KQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTE 285
           KQE+KDE K + G P +K + + + R   + +MM+    A ++ITNPTHYA+AL+Y Q  
Sbjct: 226 KQEVKDEYKDTEGKPEVKGKIRQLQREMAQRRMMQDVPGADVVITNPTHYAVALKYDQKN 285

Query: 286 NDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQL 345
             AP++VAKG +  A K+ +IA E+ + I   P LAR+++    I   IP   Y A+AQ+
Sbjct: 286 MAAPIVVAKGSDETAFKIMEIARENKVEILRTPPLARAVYHNTDIGGEIPDGLYMAIAQV 345

Query: 346 IYKIYH 351
           +  ++ 
Sbjct: 346 LAYVFQ 351


>gi|167740656|ref|ZP_02413430.1| flagellar biosynthesis protein FlhB [Burkholderia pseudomallei 14]
 gi|167826242|ref|ZP_02457713.1| flagellar biosynthesis protein FlhB [Burkholderia pseudomallei 9]
 gi|167896340|ref|ZP_02483742.1| flagellar biosynthesis protein FlhB [Burkholderia pseudomallei
           7894]
 gi|167904714|ref|ZP_02491919.1| flagellar biosynthesis protein FlhB [Burkholderia pseudomallei NCTC
           13177]
 gi|167912992|ref|ZP_02500083.1| flagellar biosynthesis protein FlhB [Burkholderia pseudomallei 112]
 gi|42766716|gb|AAS45441.1| FlhB [Burkholderia pseudomallei]
          Length = 405

 Score =  152 bits (384), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 102/350 (29%), Positives = 179/350 (51%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+  ++TEA + K+ E A  EG    SRE + F+ + A          P    + + LH
Sbjct: 7   EDSDLDRTEAATPKRREKAREEGQVARSRELASFALLSAGFYGAWMLSGPIGEHLRTMLH 66

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
               S  +    D + ++     LSL     + P L L  +  + + +     +++    
Sbjct: 67  AAF-SFDRAAAFDTNRMLSHAGTLSLEGLYALAPVLALTGVAALAAPMAMGGWLVSTKTF 125

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +  F+R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +   H+
Sbjct: 126 ELKFERLNPITGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELLGLATQPLHA 185

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            L  A   V     M +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P +K
Sbjct: 186 ALADALHLVAVCCGMTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEVKREHRENEGDPHVK 245

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R +   R+  R +MM     A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A ++
Sbjct: 246 GRIRQQQRAMARRRMMANVPTADVVVTNPTHFAVALKYTDGEMRAPKVVAKGVNLVAARI 305

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R++A EH++P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 306 RELAAEHHVPLLEAPPLARALYHNVELEREIPGTLYSAVAEVLAWVYQLK 355


>gi|222100640|ref|YP_002535208.1| Flagellar biosynthesis protein FlhB [Thermotoga neapolitana DSM
           4359]
 gi|221573030|gb|ACM23842.1| Flagellar biosynthesis protein FlhB [Thermotoga neapolitana DSM
           4359]
          Length = 315

 Score =  152 bits (384), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 99/307 (32%), Positives = 173/307 (56%), Gaps = 14/307 (4%)

Query: 51  FSP-GIYSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMF-GIG 108
           F P GI S+  D+   L+      LE+   ++  L +       L+I  L+LF M  GI 
Sbjct: 15  FGPQGIASIARDVSAFLS------LEETEDLLSALGYFK--DILLMIGALMLFTMAAGIL 66

Query: 109 SYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTE 168
              IQ   +L    ++P   R++  EG KR++S+ ++V  +K+ +K++++G ++   L +
Sbjct: 67  VGAIQTRFLLAFKTLRPDLNRINPVEGFKRLFSLRSVVELLKAVMKVVVIGVVVYQVLKD 126

Query: 169 NYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQW-YSK-LKMSK 226
            ++ M+            + +    +V +   + +  L V D  ++Y +W Y K ++M+K
Sbjct: 127 RWYEMVLLSDMELEDAFLNLWDVASEVSLKSGIALLALAVFD--YAYQRWDYEKSIRMTK 184

Query: 227 QEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEN 286
           QE+KDE K+  GNP +K RQ+ +    +R +MME   +A ++ITNPTH+A+AL+Y     
Sbjct: 185 QEVKDEFKEVEGNPEVKRRQRQMMYDILRRRMMEEVPKADVVITNPTHFAVALKYDPDTM 244

Query: 287 DAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           +AP +VAKG + +A K+ +IA E+ + I   PSLAR+L+ +V I   IP  FY+ VA+++
Sbjct: 245 NAPTVVAKGVDHLALKIIEIARENGVAIVRNPSLARTLYYRVEIGEEIPVEFYRIVAEVL 304

Query: 347 YKIYHKK 353
             +Y +K
Sbjct: 305 VYVYTRK 311


>gi|294500921|ref|YP_003564621.1| flagellar biosynthetic protein FlhB [Bacillus megaterium QM B1551]
 gi|294350858|gb|ADE71187.1| flagellar biosynthetic protein FlhB [Bacillus megaterium QM B1551]
          Length = 360

 Score =  152 bits (384), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 105/349 (30%), Positives = 185/349 (53%), Gaps = 13/349 (3%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE  + KK +D+  +G    S++ +  ++++  +++L F F  G       +  LL  
Sbjct: 14  EKTEKATPKKKQDSRKKGQVAKSQDVT--TALILLMVFLYFLF--GAKQFLQQMMKLLRE 69

Query: 69  ATQR-KLEDIS--HIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           A Q   LE+++   +  +  HL  S +    P +L   +  +G+  +Q   + +   ++P
Sbjct: 70  AFQTYMLEEVTAERVFAMFKHLLPSIALAAGPVMLAAFIAALGANYMQVGILFSTEALQP 129

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
             ++++   G KRI+++  LV  +KS +KI+ +G +    L   +  + D ++ +  SI 
Sbjct: 130 KLEKINPISGAKRIFAMRALVELIKSTLKIMCIGAVTFFIL---WIHIEDVLNLSQKSIG 186

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYS---KLKMSKQEIKDEIKQSYGNPII 242
                  + V  M L     L  L +    +Q +     ++MSKQ+IKDE K   G+P+I
Sbjct: 187 DSLVVLSKLVFQMGLAASLMLLFLSLLDYLYQKFDFEKNIRMSKQDIKDEHKNIEGDPLI 246

Query: 243 KNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKK 302
           K++ K   R     +MM+   +A +IITNPTHYA+AL+Y + + DAP +VA G + IA+K
Sbjct: 247 KSKIKQKQREMAMSRMMQEVPKADVIITNPTHYAIALKYDEEKMDAPYVVASGVDFIAQK 306

Query: 303 MRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           ++ IA  H I + E   LAR+LF Q  +  A+P  F+KAVA+++  +Y 
Sbjct: 307 IKGIAKSHEIIMVENRRLARALFDQTKVGDAVPEEFFKAVAEILAYVYR 355


>gi|121533743|ref|ZP_01665570.1| flagellar biosynthetic protein FlhB [Thermosinus carboxydivorans
           Nor1]
 gi|121307734|gb|EAX48649.1| flagellar biosynthetic protein FlhB [Thermosinus carboxydivorans
           Nor1]
          Length = 376

 Score =  152 bits (384), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 110/364 (30%), Positives = 193/364 (53%), Gaps = 38/364 (10%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFS-PGIY---SVTSDLH 63
             KTE  + K+ E+A  +G   +++   L S++  CL+   F     G Y    + S + 
Sbjct: 29  QEKTEEATPKRREEARKKGQ--VAKSVELGSAL--CLLAAFFTIKLTGTYIYEQLASYMQ 84

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
            L +  T+  +   S   F L  L+L   ++V+P +L+ +   +    +Q     ++  +
Sbjct: 85  FLFSRFTKEDMTIASSYRFFL-DLALIFLKIVLPIMLVILAVSLLVNFMQVGFTFSVEPL 143

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           KP   R++   G++R++S  +LV  +KS  K+ ++          +YF +  FI     +
Sbjct: 144 KPQLSRINPLAGMQRLFSKRSLVELVKSLFKVAII----------SYF-IYQFIIEETLN 192

Query: 184 ILYHAFFTVRKVLIMI--LLF---------IATLTVLDIGWSYHQWYS---KLKMSKQEI 229
           I   +   +R  L +I  L F         I  L +LD    Y+QW+     LKM+KQE+
Sbjct: 193 IALLSRLALRDSLAVIAALTFDLAFRIGVVILVLAILDY---YYQWWEHNQNLKMTKQEV 249

Query: 230 KDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAP 289
           K+E KQ+ GNP IK++ K   R+    +MM+   +A +++TNPTH+A+AL Y +T   AP
Sbjct: 250 KEEFKQTEGNPQIKSKIKERQRALAMRRMMQEVPKADVVVTNPTHFAIALLYEKTMT-AP 308

Query: 290 VLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKI 349
           +++AKGQ+ +A++++ +A E+ + I E  +LAR+L+  V I   +PP  YKAVA+++  +
Sbjct: 309 MVIAKGQDFMAERIKLVAKENGVAIVENKALARALYDTVEIGETVPPELYKAVAEVLAYV 368

Query: 350 YHKK 353
           Y  K
Sbjct: 369 YRLK 372


>gi|167721674|ref|ZP_02404910.1| flagellar biosynthesis protein FlhB [Burkholderia pseudomallei
           DM98]
          Length = 405

 Score =  152 bits (384), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 102/350 (29%), Positives = 179/350 (51%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+  ++TEA + K+ E A  EG    SRE + F+ + A          P    + + LH
Sbjct: 7   EDSDLDRTEAATPKRREKAREEGQVARSRELASFALLSAGFYGAWMLSGPIGEHLRTMLH 66

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
               S  +    D + ++     LSL     + P L L  +  + + +     +++    
Sbjct: 67  AAF-SFDRAAAFDTNRMLSHAGTLSLEGLYALAPVLALTGVAALAAPMAMGGWLVSTKTF 125

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +  F+R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +   H+
Sbjct: 126 ELKFERLNPITGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELLGLATQPLHA 185

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            L  A   V     M +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P +K
Sbjct: 186 ALADALHLVAVCCGMTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEVKREHRENEGDPHVK 245

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R +   R+  R +MM     A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A ++
Sbjct: 246 GRIRQQQRAMARRRMMANVPTADVVVTNPTHFAVALKYTDGEMRAPKVVAKGVNLVAARI 305

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R++A EH++P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 306 RELAAEHHVPLLEAPPLARALYHNVELEREIPGTLYSAVAEVLAWVYQLK 355


>gi|46581635|ref|YP_012443.1| flagellar biosynthesis protein FlhB [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120601206|ref|YP_965606.1| flagellar biosynthesis protein FlhB [Desulfovibrio vulgaris DP4]
 gi|46451058|gb|AAS97703.1| flagellar biosynthetic protein FlhB [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120561435|gb|ABM27179.1| flagellar biosynthetic protein FlhB [Desulfovibrio vulgaris DP4]
 gi|311235277|gb|ADP88131.1| flagellar biosynthetic protein FlhB [Desulfovibrio vulgaris RCH1]
          Length = 357

 Score =  152 bits (384), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 100/350 (28%), Positives = 183/350 (52%), Gaps = 10/350 (2%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++ D   ++TE  + K++  A N+GN   S+E S   +  A L+ + F    G+  +  
Sbjct: 1   MAQKDP--SRTEQATRKRLNKARNKGNVAKSQEVSKAVTTFAGLVAITFML--GV--LNE 54

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  +      R  +   +   + + L  SA  L I  L + +  G+ +++  R+ V  L
Sbjct: 55  HMQEVFRFFLSRPHDFTPNEQTVYSLLLWSAGELAIMLLPIMLFIGLAAFIAMRLQVGKL 114

Query: 121 ---NHVKPSFKRVSLREGIKRIY-SINNLVNFMKSFVKIILVGTIITISLTENYFTMLDF 176
                 K  + R ++   +KR++ S   L+   KS ++ + +G    I L +    +L  
Sbjct: 115 WTTEVFKLDWSRFNVINALKRMFISPQTLIRLGKSLLQAVFIGIAPIIVLKQEMLNLLPL 174

Query: 177 ISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQS 236
             A+   I  +   T  +++   L+ +  +  +D+ ++   +   LKM+K E+KDE KQ+
Sbjct: 175 YFADMSGIAVYMLETGARMVKYALVPMVIIAAVDLWYTRWDYNENLKMTKDEVKDERKQA 234

Query: 237 YGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQ 296
            G+P++K++Q+      +  +M++    A ++ITNPTH A+ALRY  T   AP++VA G 
Sbjct: 235 EGDPVVKSQQRQKMMKVMAQRMLKEVPTADVVITNPTHIAVALRYDVTAAPAPIVVAMGA 294

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           + +AK++R++A EHN+PI E   LAR+L+K V +   IP   YKAVA ++
Sbjct: 295 DHLAKRIREVAREHNVPIRENKPLARALYKSVEVGDMIPAELYKAVAAIL 344


>gi|53720905|ref|YP_109891.1| flagellar biosynthesis protein FlhB [Burkholderia pseudomallei
           K96243]
 gi|53724312|ref|YP_104358.1| flagellar biosynthesis protein FlhB [Burkholderia mallei ATCC
           23344]
 gi|167817864|ref|ZP_02449544.1| flagellar biosynthesis protein FlhB [Burkholderia pseudomallei 91]
 gi|167847750|ref|ZP_02473258.1| flagellar biosynthesis protein FlhB [Burkholderia pseudomallei
           B7210]
 gi|52211319|emb|CAH37308.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei
           K96243]
 gi|52427735|gb|AAU48328.1| flagellar biosynthetic protein FlhB [Burkholderia mallei ATCC
           23344]
          Length = 405

 Score =  152 bits (384), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 102/350 (29%), Positives = 179/350 (51%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+  ++TEA + K+ E A  EG    SRE + F+ + A          P    + + LH
Sbjct: 7   EDSDLDRTEAATPKRREKAREEGQVARSRELASFALLSAGFYGAWMLSGPIGEHLRTMLH 66

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
               S  +    D + ++     LSL     + P L L  +  + + +     +++    
Sbjct: 67  TAF-SFDRAAAFDTNRMLSHAGTLSLEGLYALAPVLALTGVAALAAPMAMGGWLVSTKTF 125

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +  F+R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +   H+
Sbjct: 126 ELKFERLNPITGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELLGLATQPLHA 185

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            L  A   V     M +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P +K
Sbjct: 186 ALADALHLVAVCCGMTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEVKREHRENEGDPHVK 245

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R +   R+  R +MM     A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A ++
Sbjct: 246 GRIRQQQRAMARRRMMANVPTADVVVTNPTHFAVALKYTDGEMRAPKVVAKGVNLVAARI 305

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R++A EH++P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 306 RELAAEHHVPLLEAPPLARALYHNVELEREIPGTLYSAVAEVLAWVYQLK 355


>gi|91223558|ref|ZP_01258823.1| flagellar biosynthesis protein B [Vibrio alginolyticus 12G01]
 gi|269965690|ref|ZP_06179803.1| Flagellar biosynthetic protein flhB [Vibrio alginolyticus 40B]
 gi|91191644|gb|EAS77908.1| flagellar biosynthesis protein B [Vibrio alginolyticus 12G01]
 gi|269829758|gb|EEZ83994.1| Flagellar biosynthetic protein flhB [Vibrio alginolyticus 40B]
          Length = 376

 Score =  152 bits (384), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 108/362 (29%), Positives = 191/362 (52%), Gaps = 20/362 (5%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFF---FSPGIYS 57
           M+E+D    +TE  + ++++ A  +G    S+E +  S ++   I L++F    +  ++S
Sbjct: 1   MAESDG-QERTEEATPRRLQQAREKGQVARSKELASASVLIVGAISLMWFGEALARSLFS 59

Query: 58  VTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLL----LFMMFGIGSYLIQ 113
           + S L  L     QR  E+I     L      + S L+ P  L    LF    IG+  + 
Sbjct: 60  IMSRLFDL-----QR--EEIFDTAKLFDIALGAMSDLLFPLFLVLATLFTAAMIGAAGVG 112

Query: 114 RIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTM 173
            I   +     P   +++   G+KR+  + + V  +KS +K++LV T + I L +     
Sbjct: 113 GIS-FSAQAAMPKLSKMNPLSGLKRMVGMQSWVELIKSILKVVLV-TGVAIYLIQASQAD 170

Query: 174 LDFISAN--PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKD 231
           L  +S +  P +I +HA   +   +++I   +  +  +DI +   Q   +LKM+KQE+KD
Sbjct: 171 LIQLSMDVYPQNI-FHALDILLNFILLISCSLLIVVAIDIPFQIWQHADQLKMTKQEVKD 229

Query: 232 EIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVL 291
           E K++ G P +K R + + R   + +MM    +A +I+TNP H+++ALRY Q  + APV+
Sbjct: 230 EYKETEGKPEVKGRIRMLQREAAQRRMMADVPQADVIVTNPEHFSVALRYKQKTDRAPVV 289

Query: 292 VAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           +AKG + +A K+R++A EH+I I   P LAR+L+    +   IP   + AVAQ++  ++ 
Sbjct: 290 IAKGTDHMAMKIREVAREHDITIVPAPPLARALYHTTELEQEIPDGLFTAVAQVLAFVFQ 349

Query: 352 KK 353
            K
Sbjct: 350 LK 351


>gi|317129190|ref|YP_004095472.1| flagellar biosynthetic protein FlhB [Bacillus cellulosilyticus DSM
           2522]
 gi|315474138|gb|ADU30741.1| flagellar biosynthetic protein FlhB [Bacillus cellulosilyticus DSM
           2522]
          Length = 359

 Score =  152 bits (384), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 107/353 (30%), Positives = 189/353 (53%), Gaps = 21/353 (5%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE  + KK +++  +G   +S+ + + +S +   ++L F+   G +SV   + +   S
Sbjct: 13  EKTEKATPKKRKESRQKGQ--VSKSSDVNTSFILLFVFLAFWLM-GSFSVDQLIGITRYS 69

Query: 69  ATQRKLEDIS--HIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
             +  L +++  ++  +  + S+ A+ +V P + + M+  I S  +Q   +     +K  
Sbjct: 70  FQEYLLMELTEANVYSMFINFSIQAAIVVGPFMFIAMLAAIFSNYLQVGILFAPEAIKMK 129

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVG----TIITISLTENYFTMLDFISANPH 182
             ++   +G KRI+S+  LV F+KS +KI+ VG    T+I I++ +    ML   S    
Sbjct: 130 LSKLDPIQGAKRIFSVRALVEFLKSLLKIVCVGFAGFTVIWIAIDD--ILMLSLYSVGES 187

Query: 183 SILYHAFFTVRKVLIMILLFIATL----TVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYG 238
             L      +  +LIM+ L +A L    +V D  +  +     +KMSKQ++KDE K++ G
Sbjct: 188 VRL------IGNLLIMMGLAVAFLLIFLSVFDYLYQKYDHEKNIKMSKQDVKDEYKKTEG 241

Query: 239 NPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL 298
           +P+IK++ K   R     +MM    +A ++ITNPTHYA+AL+Y      AP++VAKG + 
Sbjct: 242 DPLIKSKIKEKQRQMAMSRMMAEVPKADVVITNPTHYAIALKYDDQNMAAPIIVAKGVDF 301

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           IA K+  IA  +N+   E   LAR+L+ Q  I   +P   +KAVA+++  +Y 
Sbjct: 302 IALKVINIAKNNNVMTVENRPLARALYAQADIGDPVPEDLFKAVAEVLAYVYR 354


>gi|126454601|ref|YP_001068145.1| flagellar biosynthesis protein FlhB [Burkholderia pseudomallei
           1106a]
 gi|134281603|ref|ZP_01768311.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei 305]
 gi|167920930|ref|ZP_02508021.1| flagellar biosynthesis protein FlhB [Burkholderia pseudomallei
           BCC215]
 gi|217423909|ref|ZP_03455409.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei 576]
 gi|226193093|ref|ZP_03788703.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei
           Pakistan 9]
 gi|237814235|ref|YP_002898686.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei
           MSHR346]
 gi|242317683|ref|ZP_04816699.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei
           1106b]
 gi|254183876|ref|ZP_04890467.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei
           1655]
 gi|254298802|ref|ZP_04966253.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei
           406e]
 gi|126228243|gb|ABN91783.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei
           1106a]
 gi|134247270|gb|EBA47356.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei 305]
 gi|157808470|gb|EDO85640.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei
           406e]
 gi|184214408|gb|EDU11451.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei
           1655]
 gi|217392972|gb|EEC32994.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei 576]
 gi|225934693|gb|EEH30670.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei
           Pakistan 9]
 gi|237506461|gb|ACQ98779.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei
           MSHR346]
 gi|242140922|gb|EES27324.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei
           1106b]
          Length = 401

 Score =  152 bits (384), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 104/353 (29%), Positives = 182/353 (51%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+  ++TEA + K+ E A  EG    SRE + F+ + A          P    + +
Sbjct: 1   MAE-DSDLDRTEAATPKRREKAREEGQVARSRELASFALLSAGFYGAWMLSGPIGEHLRT 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            LH    S  +    D + ++     LSL     + P L L  +  + + +     +++ 
Sbjct: 60  MLHAAF-SFDRAAAFDTNRMLSHAGTLSLEGLYALAPVLALTGVAALAAPMAMGGWLVST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
              +  F+R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +  
Sbjct: 119 KTFELKFERLNPITGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELLGLATQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            H+ L  A   V     M +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P
Sbjct: 179 LHAALADALHLVAVCCGMTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEVKREHRENEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM     A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A
Sbjct: 239 HVKGRIRQQQRAMARRRMMANVPTADVVVTNPTHFAVALKYTDGEMRAPKVVAKGVNLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EH++P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 299 ARIRELAAEHHVPLLEAPPLARALYHNVELEREIPGTLYSAVAEVLAWVYQLK 351


>gi|90411036|ref|ZP_01219050.1| flagellar biosynthesis protein [Photobacterium profundum 3TCK]
 gi|90328249|gb|EAS44560.1| flagellar biosynthesis protein [Photobacterium profundum 3TCK]
          Length = 376

 Score =  152 bits (384), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 97/361 (26%), Positives = 195/361 (54%), Gaps = 18/361 (4%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+D  + +TE  +++K+E A  +G    S+E +  + ++   + L+++   G+    +
Sbjct: 1   MAESDGQE-RTEDATARKLEQAREKGQVARSKELASVAVLVMGAVSLMWY-GEGLGKALA 58

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIP-GLLLFMMFG---IGSYLIQRIP 116
           ++   + S ++ ++ D++ +  ++     S   +V P GL+L ++F    IG+  +  + 
Sbjct: 59  EIMTQMFSLSREEIYDLNRLFSIMLTAIWS---VVFPLGLVLIVLFTAALIGAAGLGGVS 115

Query: 117 VLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITI----SLTENYFT 172
             +     P   +++   G KR++ + + V  +KS +K++LV  +       SL + +  
Sbjct: 116 -FSAEAAMPKLSKMNPMSGFKRMFGMQSWVELIKSILKVLLVTGVAAYLMYSSLNDFFLL 174

Query: 173 MLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDE 232
            L+   +N    ++HA   + + +++I   +  +  +D+ +   Q   +LKM+KQE+KDE
Sbjct: 175 SLEIYPSN----IFHALDILMQFILLICCSLLVIVAIDVPYQIWQHNEQLKMTKQEVKDE 230

Query: 233 IKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLV 292
            K + G P +K R + + R   + +MM    +A +IITNP H+++ALRY    + AP+++
Sbjct: 231 YKDTEGKPEVKGRIRMLQREMAQRRMMADVPQADVIITNPEHFSVALRYDPKLDSAPIVI 290

Query: 293 AKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
           AKG +  A K+R+IA +HNI I   P LAR+++    +   IP   + AVAQ++  I+  
Sbjct: 291 AKGVDHAALKIREIANKHNIDIVPAPPLARAIYHTTELEQHIPDGLFVAVAQVLAYIFQL 350

Query: 353 K 353
           K
Sbjct: 351 K 351


>gi|121601443|ref|YP_994701.1| flagellar biosynthesis protein FlhB [Burkholderia mallei SAVP1]
 gi|124383615|ref|YP_001027675.1| flagellar biosynthesis protein FlhB [Burkholderia mallei NCTC
           10229]
 gi|126450428|ref|YP_001082647.1| flagellar biosynthesis protein FlhB [Burkholderia mallei NCTC
           10247]
 gi|238563575|ref|ZP_00438645.2| flagellar biosynthetic protein FlhB [Burkholderia mallei GB8 horse
           4]
 gi|251767891|ref|ZP_02268743.2| flagellar biosynthetic protein FlhB [Burkholderia mallei PRL-20]
 gi|254175097|ref|ZP_04881758.1| flagellar biosynthetic protein FlhB [Burkholderia mallei ATCC
           10399]
 gi|254186354|ref|ZP_04892871.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254194732|ref|ZP_04901163.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei S13]
 gi|254201433|ref|ZP_04907797.1| flagellar biosynthetic protein FlhB [Burkholderia mallei FMH]
 gi|254206775|ref|ZP_04913126.1| flagellar biosynthetic protein FlhB [Burkholderia mallei JHU]
 gi|254357202|ref|ZP_04973476.1| flagellar biosynthetic protein FlhB [Burkholderia mallei
           2002721280]
 gi|121230253|gb|ABM52771.1| flagellar biosynthetic protein FlhB [Burkholderia mallei SAVP1]
 gi|124291635|gb|ABN00904.1| flagellar biosynthetic protein FlhB [Burkholderia mallei NCTC
           10229]
 gi|126243298|gb|ABO06391.1| flagellar biosynthetic protein FlhB [Burkholderia mallei NCTC
           10247]
 gi|147747327|gb|EDK54403.1| flagellar biosynthetic protein FlhB [Burkholderia mallei FMH]
 gi|147752317|gb|EDK59383.1| flagellar biosynthetic protein FlhB [Burkholderia mallei JHU]
 gi|148026266|gb|EDK84351.1| flagellar biosynthetic protein FlhB [Burkholderia mallei
           2002721280]
 gi|157934039|gb|EDO89709.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei
           Pasteur 52237]
 gi|160696142|gb|EDP86112.1| flagellar biosynthetic protein FlhB [Burkholderia mallei ATCC
           10399]
 gi|169651482|gb|EDS84175.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei S13]
 gi|238520421|gb|EEP83881.1| flagellar biosynthetic protein FlhB [Burkholderia mallei GB8 horse
           4]
 gi|243061442|gb|EES43628.1| flagellar biosynthetic protein FlhB [Burkholderia mallei PRL-20]
          Length = 401

 Score =  152 bits (384), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 102/350 (29%), Positives = 179/350 (51%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+  ++TEA + K+ E A  EG    SRE + F+ + A          P    + + LH
Sbjct: 3   EDSDLDRTEAATPKRREKAREEGQVARSRELASFALLSAGFYGAWMLSGPIGEHLRTMLH 62

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
               S  +    D + ++     LSL     + P L L  +  + + +     +++    
Sbjct: 63  TAF-SFDRAAAFDTNRMLSHAGTLSLEGLYALAPVLALTGVAALAAPMAMGGWLVSTKTF 121

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +  F+R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +   H+
Sbjct: 122 ELKFERLNPITGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELLGLATQPLHA 181

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            L  A   V     M +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P +K
Sbjct: 182 ALADALHLVAVCCGMTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEVKREHRENEGDPHVK 241

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R +   R+  R +MM     A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A ++
Sbjct: 242 GRIRQQQRAMARRRMMANVPTADVVVTNPTHFAVALKYTDGEMRAPKVVAKGVNLVAARI 301

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R++A EH++P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 302 RELAAEHHVPLLEAPPLARALYHNVELEREIPGTLYSAVAEVLAWVYQLK 351


>gi|310764894|gb|ADP09844.1| Flagellar biosynthetic protein FlhB [Erwinia sp. Ejp617]
          Length = 381

 Score =  152 bits (384), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 102/353 (28%), Positives = 186/353 (52%), Gaps = 13/353 (3%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLI-YLLFFFSPG--IYSVTS 60
            ++ + KTEAP+  +I  A  EG  P S+E    +++L  L+ + L   S G  + S+ S
Sbjct: 3   QESDNEKTEAPTPSRIAKAREEGQIPRSKE---LTTLLMLLVGWGLMLCSGGNLVRSLQS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            LH  L       L D + ++   + L   A   ++P +   ++  + +  +    +L+ 
Sbjct: 60  LLHNALIFDRLLVL-DPAQMLQRSSSLLGQAFMAIMPFVFGLLLTAVSAPPLIGGLILSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIIL--VGTIITISLTENYFTMLDFIS 178
             + P  K+++   GIKR++S       +K+ +K++L  +G  + + L +  F  L F  
Sbjct: 119 KSLAPKLKKLNPLSGIKRMFSAQMASEMVKAILKVLLATIGGGLYLLLNKEKFIRLIF-- 176

Query: 179 ANPHSI-LYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSY 237
             P  + L      +   L+ +++ +  +   D+ +  +  + KL+MS+QEIKDE K+  
Sbjct: 177 -EPLGMALTDISGLLLGCLLAVIMSLIPMVAFDVIYQLYSHWKKLRMSRQEIKDEFKKQE 235

Query: 238 GNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQN 297
           G+P IK R + + R+  + +MM     A +I+ NPTHY++AL+Y      AP +VAKG  
Sbjct: 236 GDPQIKGRVRQMQRAMAQRRMMTDVPDADVIVNNPTHYSVALKYQDGSLGAPKVVAKGSG 295

Query: 298 LIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           L+A ++R++A  H +P+ E P LAR+L++   I + IP   Y AVA+++  +Y
Sbjct: 296 LVALRIRELAENHKVPMLEAPPLARALYRHCEIGAPIPADLYHAVAEVLAWVY 348


>gi|78047537|ref|YP_363712.1| flagellar biosynthesis protein FlhB [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325925983|ref|ZP_08187349.1| flagellar biosynthetic protein FlhB [Xanthomonas perforans 91-118]
 gi|78035967|emb|CAJ23658.1| flagellar biosynthesis pathway component FlhB [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
 gi|325543579|gb|EGD14996.1| flagellar biosynthetic protein FlhB [Xanthomonas perforans 91-118]
          Length = 376

 Score =  152 bits (384), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 93/352 (26%), Positives = 182/352 (51%), Gaps = 3/352 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE++    +TE P+ K++ +A  +GN P SRE S  +++    ++ L   + GI    +
Sbjct: 1   MSESEDGGERTELPTEKRLREAREQGNIPQSRELST-AAVFGAGVFALMVLARGIGDGAA 59

Query: 61  DLHVLLASATQRKLEDISHIVFL-LTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLN 119
            + +  A +   KL +    +F     L L    +++P + + +  G+   L+      +
Sbjct: 60  -VWMKTALSPDPKLRETPMALFGHFGDLLLQLLWVMLPLIGICLAAGLAGPLMMSGLRFS 118

Query: 120 LNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISA 179
              + P   +++   GIKR++  N+L   +KS ++++ VG   +  +++    +   ++ 
Sbjct: 119 GKAIMPDLSKLNPANGIKRMWGSNSLAELIKSVLRLLFVGLAASFCISKGLHGLRSLVNQ 178

Query: 180 NPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
                + +     + +L      +  L  +D  +    W  KLKM+++EIK E+K+S G+
Sbjct: 179 PLEQAIGNGLDFTKSLLFYTAGALVLLAAIDAPYQKWNWLRKLKMTREEIKREMKESEGS 238

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLI 299
           P +K R + +     + +MMEA  +A +++ NPTHYA+AL+Y   +  AP++VAKG + +
Sbjct: 239 PEVKGRIRQMQMQMSQRQMMEAVPKADVVLMNPTHYAVALKYEGGKMRAPIVVAKGVDEM 298

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           A ++R+   +H + I   P LAR+L+++  I   IP   Y  VAQ++  +Y 
Sbjct: 299 AFRIREAGEQHRVAIVTAPPLARALYREAQIGKEIPVRLYSVVAQVLSYVYQ 350


>gi|126441654|ref|YP_001060838.1| flagellar biosynthesis protein FlhB [Burkholderia pseudomallei 668]
 gi|126221147|gb|ABN84653.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei 668]
          Length = 401

 Score =  152 bits (384), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 102/350 (29%), Positives = 179/350 (51%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+  ++TEA + K+ E A  EG    SRE + F+ + A          P    + + LH
Sbjct: 3   EDSDLDRTEAATPKRREKAREEGQVARSRELASFALLSAGFYGAWMLSGPIGEHLRTMLH 62

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
               S  +    D + ++     LSL     + P L L  +  + + +     +++    
Sbjct: 63  TAF-SFDRAAAFDTNRMLSHAGTLSLEGLYALAPVLALTGVAALATPMAMGGWLVSTKTF 121

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +  F+R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +   H+
Sbjct: 122 ELKFERLNPITGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELLGLATQPLHA 181

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            L  A   V     M +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P +K
Sbjct: 182 ALADALHLVAVCCGMTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEVKREHRENEGDPHVK 241

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R +   R+  R +MM     A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A ++
Sbjct: 242 GRIRQQQRAMARRRMMANVPTADVVVTNPTHFAVALKYTDGEMRAPKVVAKGVNLVAARI 301

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R++A EH++P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 302 RELAAEHHVPLLEAPPLARALYHNVELEREIPGTLYSAVAEVLAWVYQLK 351


>gi|295706267|ref|YP_003599342.1| flagellar biosynthetic protein FlhB [Bacillus megaterium DSM 319]
 gi|294803926|gb|ADF40992.1| flagellar biosynthetic protein FlhB [Bacillus megaterium DSM 319]
          Length = 360

 Score =  152 bits (383), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 105/349 (30%), Positives = 185/349 (53%), Gaps = 13/349 (3%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE  + KK +D+  +G    S++ +  ++++  +++L F F  G       +  LL  
Sbjct: 14  EKTEKATPKKKQDSRKKGQVAKSQDVT--TALILLMVFLYFLF--GAKQFLQQMMKLLRE 69

Query: 69  ATQR-KLEDIS--HIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           A Q   LE+++   +  +  HL  S +    P +L   +  +G+  +Q   + +   ++P
Sbjct: 70  AFQTYMLEEVTAERVFAMFKHLLPSIALAAGPVMLAAFIAALGANYMQVGILFSTEALQP 129

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
             ++++   G KRI+++  LV  +KS +KI+ +G +    L   +  + D ++ +  SI 
Sbjct: 130 KLEKINPISGAKRIFAMRALVELIKSTLKIMCIGAVTFFIL---WIHIEDVLNLSQKSIG 186

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYS---KLKMSKQEIKDEIKQSYGNPII 242
                  + V  M L     L  L +    +Q +     ++MSKQ+IKDE K   G+P+I
Sbjct: 187 DSLVVLSKLVFQMGLAASLMLLFLSLLDYLYQKFDFEKNIRMSKQDIKDEHKNIEGDPLI 246

Query: 243 KNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKK 302
           K++ K   R     +MM+   +A +IITNPTHYA+AL+Y + + DAP +VA G + IA+K
Sbjct: 247 KSKIKQKQREMAMSRMMQEVPKADVIITNPTHYAIALKYDEEKMDAPYVVASGVDFIAQK 306

Query: 303 MRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           ++ IA  H I + E   LAR+LF Q  +  A+P  F+KAVA+++  +Y 
Sbjct: 307 IKGIAKSHEIIMVENRPLARALFDQTKVGDAVPEEFFKAVAEILAYVYR 355


>gi|167620815|ref|ZP_02389446.1| flagellar biosynthesis protein FlhB [Burkholderia thailandensis
           Bt4]
          Length = 401

 Score =  152 bits (383), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 105/356 (29%), Positives = 185/356 (51%), Gaps = 8/356 (2%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   +TEA + K+ E A  EG    SRE + F+ +L+   Y  +  S     +  
Sbjct: 1   MAE-DSDLERTEAATPKRREKAREEGQVARSRELASFA-LLSAGFYGAWMLS---GPIGE 55

Query: 61  DLHVLLASATQRKLEDISHIVFLLTH---LSLSASRLVIPGLLLFMMFGIGSYLIQRIPV 117
            L  +L +A             +L+H   LSL     ++P L L  +  + + +     +
Sbjct: 56  HLRTMLHTAFSFDRATAFDTNRMLSHAGILSLEGLYALVPVLALTGVAALAAPMALGGWL 115

Query: 118 LNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFI 177
           ++    +  F+R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   
Sbjct: 116 VSTKTFELKFERLNPVAGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELLGLA 175

Query: 178 SANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSY 237
           +   H+ L  A   +     M +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ 
Sbjct: 176 TQPLHAALADALHLIAVCCGMTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEVKREHRENE 235

Query: 238 GNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQN 297
           G+P +K R +   R+  R +MM     A +++TNPTH+A+AL+Y   E  AP +VAKG N
Sbjct: 236 GDPHVKGRIRQQQRAMARRRMMANVPTADVVVTNPTHFAVALKYTDGEMRAPKVVAKGVN 295

Query: 298 LIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           L+A ++R++A EH++P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 296 LVAARIRELAAEHHVPLLEAPPLARALYHNVDLEREIPGTLYSAVAEVLAWVYQLK 351


>gi|189426336|ref|YP_001953513.1| flagellar biosynthesis protein FlhB [Geobacter lovleyi SZ]
 gi|189422595|gb|ACD96993.1| flagellar biosynthetic protein FlhB [Geobacter lovleyi SZ]
          Length = 357

 Score =  152 bits (383), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 99/360 (27%), Positives = 190/360 (52%), Gaps = 13/360 (3%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFS---PGIYS 57
           M+E+D   +KTE P+ +++E A  +G  P S+  S   ++LA ++ L    S    G+ S
Sbjct: 1   MAEDDDKHSKTEQPTGRRLEKAREKGAPPSSQMLSQSFTLLAGIVVLYLLGSYLMNGLKS 60

Query: 58  VTSDLHVLLAS--ATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRI 115
            T  ++  + +   T++ +  +   +F +  +      L+ P +L  M  GI ++++Q  
Sbjct: 61  TTVQVYSQIGTFELTEQNVYTMMLRIFGVLFM------LLAPVILAVMSTGILAHIVQDN 114

Query: 116 PVLNLNHVKPSFK--RVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTM 173
             L+    + +F   +++   G  ++++   LV  +KS +KI ++G I    L +    +
Sbjct: 115 GRLDFQWGRITFDISKLNFISGFGKLFNKEALVEILKSLIKIFVIGWIAYQVLRDELQNI 174

Query: 174 LDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEI 233
                ++ + IL +      K++      +  +++LD+ +   ++   LKM+KQE+KDE 
Sbjct: 175 TVLAESDVNGILSYTGHVAFKIVTHTCGIMIVISILDMAYVKWRYIENLKMTKQEVKDET 234

Query: 234 KQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVA 293
           K   GNP IK + K +     R ++ +    A ++ITNPTH+A+AL+Y ++   AP+++A
Sbjct: 235 KDMEGNPEIKGKIKRLQFQAARRRLTKIIPTADVVITNPTHFAVALKYDRSRMVAPMVIA 294

Query: 294 KGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           KG + +A  ++++A EH + + E   LAR L+ QV  N  IP   Y AVA+++  +Y  K
Sbjct: 295 KGADEMALAIKEMAREHKVTLVENRFLARELYDQVAENQEIPESLYAAVAEVLAYVYRLK 354


>gi|167582700|ref|ZP_02375574.1| flagellar biosynthesis protein FlhB [Burkholderia thailandensis
           TXDOH]
          Length = 405

 Score =  152 bits (383), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 103/353 (29%), Positives = 182/353 (51%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+   +TEA + K+ E A  EG    SRE + F+ +L+   Y  +  S     +   L 
Sbjct: 7   EDSDLERTEAATPKRREKAREEGQVARSRELASFA-LLSAGFYGAWMLS---GPIGEHLR 62

Query: 64  VLLASATQRKLEDISHIVFLLTH---LSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L +A             +L+H   LSL     ++P L L  +  + + +     +++ 
Sbjct: 63  TMLHTAFSFDRATAFDTNRMLSHAGILSLEGLYALVPVLALTGVAALAAPMALGGWLVST 122

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
              +  F+R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +  
Sbjct: 123 KTFELKFERLNPVAGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELLGLATQP 182

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            H+ L  A   +     M +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P
Sbjct: 183 LHAALADALHLIAVCCGMTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEVKREHRENEGDP 242

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM     A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A
Sbjct: 243 HVKGRIRQQQRAMARRRMMANVPTADVVVTNPTHFAVALKYTDGEMRAPKVVAKGVNLVA 302

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EH++P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 303 ARIRELAAEHHVPLLEAPPLARALYHNVDLEREIPGTLYSAVAEVLAWVYQLK 355


>gi|326791523|ref|YP_004309344.1| flagellar biosynthetic protein FlhB [Clostridium lentocellum DSM
           5427]
 gi|326542287|gb|ADZ84146.1| flagellar biosynthetic protein FlhB [Clostridium lentocellum DSM
           5427]
          Length = 372

 Score =  152 bits (383), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 110/358 (30%), Positives = 192/358 (53%), Gaps = 18/358 (5%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILA---CLIYLLFFFSPGIYSVTSDLHV 64
           + +TE  + KK EDA  +G   +++ A L +++L    C + LL     G Y + S +  
Sbjct: 18  EGRTEKATPKKKEDARKKGQ--VAKSAELNTAVLIVGFCAVSLLL----GGY-MLSGIQT 70

Query: 65  LLASATQRKLEDISHIV--FLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPV---LN 119
            + ++  R  E  + +   ++L     +   ++   L L++   I  +++  I V   ++
Sbjct: 71  SIITSMNRLSEVFNEVTSNYMLVVFRSAIFDILWICLPLWICLFIIGFIVSYIQVGYKVS 130

Query: 120 LNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISA 179
              +K  F +++   GIKRI S + +V+ + S  K+I++G I+   +       + F   
Sbjct: 131 FEPMKVKFSKMNPINGIKRIISKDMIVSLILSAAKVIVLGAIVYNIILSKIPIFMRFYEL 190

Query: 180 NPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
               IL     TV ++   +      L VLD  +  ++    +KM+KQEIK+E K + G+
Sbjct: 191 TIEQILNTIAMTVVQIGFFVGGAFLVLAVLDYVYQRYKHADSIKMTKQEIKEEYKNAEGD 250

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLI 299
           P IK++ K   R     +MM+A   A +IITNPTH+A+A++Y +++  APV+VAKG + +
Sbjct: 251 PQIKSKIKQKMREGSMRRMMQAIPEADVIITNPTHFAIAIKYDESKGTAPVVVAKGVDYV 310

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQL---IYKIYHKKI 354
           A+K+++ A EH+I I E   LAR+L+  V +N  IPP  Y AVA++   IY + HKK+
Sbjct: 311 AQKIKEKAKEHHIEIVENKPLARALYYTVDLNKEIPPELYGAVAEVLAFIYNLQHKKM 368


>gi|296133030|ref|YP_003640277.1| flagellar biosynthetic protein FlhB [Thermincola sp. JR]
 gi|296031608|gb|ADG82376.1| flagellar biosynthetic protein FlhB [Thermincola potens JR]
          Length = 368

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 112/366 (30%), Positives = 186/366 (50%), Gaps = 39/366 (10%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYL-LFF---------FSPGIYS 57
             KTE  ++KK + A  EG    S E +    +LA  I + LFF         F   IY 
Sbjct: 19  QEKTEKATAKKRQKARQEGQVLKSMEFNSAVVLLATFISIKLFFPYMLEQLSGFFREIYR 78

Query: 58  VTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPV 117
           +      +L + T  +L   +  V  +T         V+P   + ++ G+ + L+Q   +
Sbjct: 79  MWGSQDFVLNARTSHQLYFSTIKVSFMT---------VLPIAGIAVVSGVAANLLQSGFI 129

Query: 118 LNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFI 177
                +KP+   ++   GIKR++ + +LV  +KS VK+ +VG I        +      +
Sbjct: 130 FTTKPLKPNISALNPINGIKRMFGVRSLVELVKSLVKVAIVGYIAYTGYKSEFNKFPQLL 189

Query: 178 SANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSY-HQWYS---KLKMSKQEIKDEI 233
             N   I   + F  R +L M       L +   G+ Y +QW+     LKM+KQE+K+E+
Sbjct: 190 DMN---IRASSLFIGRLILNMAFKIAVCLLIFS-GFDYWYQWWEYERSLKMTKQEVKEEL 245

Query: 234 KQSYGNPIIK------NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEND 287
           KQ+ G+P +K       +Q S+AR      MM+A  +A ++ITNPTHYA+AL+Y      
Sbjct: 246 KQTEGDPKVKAAIRRKQQQMSVAR------MMQAVPKADVVITNPTHYAVALKYDADTMS 299

Query: 288 APVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIY 347
           AP +VAKGQ+ +A++++++A EH + + E   LA++L+  V I  +IP   Y+AVA+++ 
Sbjct: 300 APEVVAKGQDYLAQRIKQVAKEHGVVLVENKPLAQALYNAVEIGESIPAELYQAVAEVLA 359

Query: 348 KIYHKK 353
            +Y  K
Sbjct: 360 FVYKLK 365


>gi|161723151|ref|YP_443664.2| flagellar biosynthesis protein FlhB [Burkholderia thailandensis
           E264]
          Length = 405

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 103/353 (29%), Positives = 182/353 (51%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+   +TEA + K+ E A  EG    SRE + F+ +L+   Y  +  S     +   L 
Sbjct: 7   EDSDLERTEAATPKRREKAREEGQVARSRELASFA-LLSAGFYGAWMLS---GPIGEHLR 62

Query: 64  VLLASATQRKLEDISHIVFLLTH---LSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L +A             +L+H   LSL     ++P L L  +  + + +     +++ 
Sbjct: 63  TMLHTAFSFDRATAFDTNRMLSHAGILSLEGLYALVPVLALTGVAALAAPMALGGWLVST 122

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
              +  F+R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +  
Sbjct: 123 KTFELKFERLNPVAGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELLGLATQP 182

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            H+ L  A   +     M +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P
Sbjct: 183 LHAALADALHLIAVCCGMTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEVKREHRENEGDP 242

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM     A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A
Sbjct: 243 HVKGRIRQQQRAMARRRMMANVPTADVVVTNPTHFAVALKYTDGEMRAPKVVAKGVNLVA 302

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EH++P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 303 ARIRELAAEHHVPLLEAPPLARALYHNVDLEREIPGTLYSAVAEVLAWVYQLK 355


>gi|294664739|ref|ZP_06730068.1| flagellar protein [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 10535]
 gi|292605493|gb|EFF48815.1| flagellar protein [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 10535]
          Length = 376

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 91/351 (25%), Positives = 177/351 (50%), Gaps = 1/351 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE++    +TE P+ K++ +A  +GN P SRE S  +++    ++ L   + GI    +
Sbjct: 1   MSESEDGGERTELPTEKRLREAREQGNIPQSRELST-AAVFGAGVFALMVLARGIGDGAA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
                  S   +  E+   +      L L    +++P + + +  G+   L+      + 
Sbjct: 60  VWMKTALSPDPKMRENPMALFGHFGDLLLQLLWVMLPLIGICLAAGLAGPLMMSGLRFSG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   +++   GIKR++  N+L   +KS ++++ VG   +  ++     +   ++  
Sbjct: 120 KAIMPDLTKLNPANGIKRMWGSNSLAELIKSVLRLLFVGLAASFCISRGLHGLRSLVNQP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + +     + +L      +  L  +D  +    W  KLKM+++EIK E+K+S G+P
Sbjct: 180 LEQAIGNGLDFTKSLLFYTAGALVLLAAIDAPYQKWNWLRKLKMTREEIKREMKESEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + +     + +MMEA  +A +++ NPTHYA+AL+Y   +  AP++VAKG + +A
Sbjct: 240 EVKGRIRQMQMQMSQRQMMEAVPKADVVLMNPTHYAVALKYEGGKMRAPIVVAKGVDEMA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            ++R+   +H + I   P LAR+L+++  I   IP   Y  VAQ++  +Y 
Sbjct: 300 FRIREAGEQHRVAIVTAPPLARALYREAQIGKEIPVRLYSVVAQVLSYVYQ 350


>gi|254519406|ref|ZP_05131462.1| flagellar biosynthetic protein FlhB [Clostridium sp. 7_2_43FAA]
 gi|226913155|gb|EEH98356.1| flagellar biosynthetic protein FlhB [Clostridium sp. 7_2_43FAA]
          Length = 614

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 94/345 (27%), Positives = 189/345 (54%), Gaps = 1/345 (0%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
             D KTE  + KK  D+  +G    S++  L  +++A ++ ++      + S+  ++   
Sbjct: 261 GADEKTEEATPKKKSDSRKKGQIARSKDVGLAITMIATVLVVVALSGFIVSSLKDNVVYF 320

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           L      ++ + + I  + T +   A+ +++P +L  M+ G+ + L+Q   ++  + +KP
Sbjct: 321 LGDMGSMEVTE-NSIKGINTLIISKAAMVIMPVILPIMIAGVAASLVQSGFLVVKDAIKP 379

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
           SF +++   G K ++S  +LV  +K+ + I +V  I    + +N+  ++   +    ++ 
Sbjct: 380 SFGKLNPINGFKNMFSKKSLVELIKNLILIAIVIFIAYSYIRDNFDKIMQIGNLYLPTLG 439

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
                 +  + + I + +  + ++D    Y  +   ++M+KQEIK+E KQ  G+P IK++
Sbjct: 440 IEVKSLIVGIFVKICILLVVIAIIDYVVQYMLFQKDIRMTKQEIKEEYKQMEGDPQIKSK 499

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
            K   R   + +MM++   AT++ITNPTH A+A++Y + + +AP +VAKG + IA K+++
Sbjct: 500 IKQRQREMSQRRMMQSVGDATVVITNPTHLAVAIKYEEGKTEAPKVVAKGADTIAIKIKE 559

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
            A E  +PI E   LAR +F+ V I+  IP   Y+AVA+++  +Y
Sbjct: 560 KAIESKVPIIENKPLARMIFESVEIDKEIPQDMYQAVAEVLAMVY 604


>gi|315180495|gb|ADT87409.1| flagellar biosynthetic protein [Vibrio furnissii NCTC 11218]
          Length = 372

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 101/350 (28%), Positives = 185/350 (52%), Gaps = 13/350 (3%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS  D    KTE  SS+K++ A  +G    S+E   FSS +  ++ + +F++    S++ 
Sbjct: 1   MSSGD----KTEQASSQKLDKARKQGQIARSKE---FSSAIMLMVCIGYFYANA-DSLSG 52

Query: 61  DLHVLLASA---TQRKLEDISHIVFLLTHLSLSASRLVIPGLLL-FMMFGIGSYLIQRIP 116
               L   +   T     D  HI+ L+T       ++  P ++  F+   I + L+    
Sbjct: 53  HFMQLFEVSFRFTAESQSDHDHILHLITQSLYLMIKVFAPLIIFQFIASAIATCLLGGFH 112

Query: 117 VLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDF 176
             NL+ + P F +++   GIKRI+S   LV F+K+  KI L+  ++   ++ N+  +   
Sbjct: 113 -FNLSLLAPKFSKINPLSGIKRIFSKQTLVEFLKNVAKISLIFALLYYMISTNFHMIGSL 171

Query: 177 ISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQS 236
           + A+  + ++ +   V ++L M++L      V+DI +    + +++KM+KQE+K E K+ 
Sbjct: 172 VRASFQTTIHFSLQYVLELLGMLILIAILFGVIDIPYQKMTFGTQMKMTKQEVKQEHKEQ 231

Query: 237 YGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQ 296
            G P IK+R + I     R    +    A +++ NPTH+A+AL+Y  T+ +AP +VAKG+
Sbjct: 232 EGRPEIKSRIRQIQMQNARRSASQTVPTADVVLMNPTHFAVALKYDLTKAEAPFVVAKGK 291

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           N +A  +R +A +H + +   P + RS++    +N  IP   + AVAQ++
Sbjct: 292 NEVAFYIRTLAEQHQVEVLVVPEITRSIYHTTQLNQMIPNQLFLAVAQIL 341


>gi|21242681|ref|NP_642263.1| flagellar biosynthesis protein FlhB [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|21108153|gb|AAM36799.1| flagellar protein [Xanthomonas axonopodis pv. citri str. 306]
          Length = 376

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 91/351 (25%), Positives = 177/351 (50%), Gaps = 1/351 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE++    +TE P+ K++ +A  +GN P SRE S  +++    ++ L   + GI    +
Sbjct: 1   MSESEDGGERTELPTEKRLREAREQGNIPQSRELST-AAVFGAGVFALMVLARGIGDGAA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
                  S   +  E+   +      L L    +++P + + +  G+   L+      + 
Sbjct: 60  VWMKTALSPDPKMRENPMALFGHFGDLLLQLLWVMLPLIGICLAAGLAGPLMMSGLRFSG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   +++   GIKR++  N+L   +KS ++++ VG   +  ++     +   ++  
Sbjct: 120 KAIMPDLTKLNPANGIKRMWGSNSLAELIKSVLRLLFVGLAASFCISRGLHGLRSLVNQP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + +     + +L      +  L  +D  +    W  KLKM+++EIK E+K+S G+P
Sbjct: 180 LEQAIGNGLDFTKSLLFYTAGALVLLAAIDAPYQKWNWLRKLKMTREEIKREMKESEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + +     + +MMEA  +A +++ NPTHYA+AL+Y   +  AP++VAKG + +A
Sbjct: 240 EVKGRIRQMQMQMSQRQMMEAVPKADVVLMNPTHYAVALKYEGGKMRAPIVVAKGVDEMA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            ++R+   +H + I   P LAR+L+++  I   IP   Y  VAQ++  +Y 
Sbjct: 300 FRIREAGEQHRVAIVTAPPLARALYREAQIGKEIPVRLYSVVAQVLSYVYQ 350


>gi|134300232|ref|YP_001113728.1| flagellar biosynthetic protein FlhB [Desulfotomaculum reducens
           MI-1]
 gi|134052932|gb|ABO50903.1| flagellar biosynthetic protein FlhB [Desulfotomaculum reducens
           MI-1]
          Length = 354

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 94/351 (26%), Positives = 189/351 (53%), Gaps = 6/351 (1%)

Query: 5   DAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACL--IYLLFFFSPGIYSVTSDL 62
           +    KTE  + +++++A  +G  P  + A L  +IL  +  ++ L +    I  + +  
Sbjct: 3   EGSQEKTEQATPRRLQEARRKGQVP--KSADLNGAILLLITGLFALLYKDNLITHMQTYF 60

Query: 63  HVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNH 122
                +  +++ +D S++V +L    ++   +  P  +L M+  +G  L Q   +     
Sbjct: 61  FTYFNNFVKQQQQD-SYLVQILIDFMINVFVVFTPLFILLMVVALGVNLAQVGFLFAPEA 119

Query: 123 VKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPH 182
           +KP   +++   G+K ++S   +   +KS +KI +VG ++  ++      +L    + P 
Sbjct: 120 IKPKLDKLNPINGLKNMFSGRAMFELVKSLLKITIVGWVVYAAVRGEMANLLAIFHSPPR 179

Query: 183 SILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPII 242
           ++L        KV++   +    + +LD+ +  + +  +++MSKQE+K+E KQ+ G+P I
Sbjct: 180 TLLNQVLTIALKVILWGAVVYLGIALLDLLYQRYAFQKQMRMSKQEVKEEYKQTEGDPQI 239

Query: 243 KNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKK 302
           K   +   R  + +   +   +AT+++TNPTHYA+AL+Y Q   DAPV+VAKG + +A++
Sbjct: 240 KGWLRRRQRQLLANLARKEVPQATVVVTNPTHYAVALKYEQP-MDAPVVVAKGTDHMARQ 298

Query: 303 MRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +R+IA ++ +P+ E   +AR L+  V I  AIP   ++AVA+++  +Y  K
Sbjct: 299 IREIARKNEVPVIENVEVARFLYANVEIGHAIPMEMFQAVAEILAMVYRMK 349


>gi|254228444|ref|ZP_04921870.1| flagellar biosynthetic protein FlhB [Vibrio sp. Ex25]
 gi|262393601|ref|YP_003285455.1| flagellar biosynthesis protein FlhB [Vibrio sp. Ex25]
 gi|151939032|gb|EDN57864.1| flagellar biosynthetic protein FlhB [Vibrio sp. Ex25]
 gi|262337195|gb|ACY50990.1| flagellar biosynthesis protein FlhB [Vibrio sp. Ex25]
          Length = 376

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 107/362 (29%), Positives = 191/362 (52%), Gaps = 20/362 (5%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFF---FSPGIYS 57
           M+E+D    +TE  + ++++ A  +G    S+E +  S ++   I L++F    +  ++S
Sbjct: 1   MAESDG-QERTEEATPRRLQQAREKGQVARSKELASASVLIVGAISLMWFGEALARSLFS 59

Query: 58  VTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLL----LFMMFGIGSYLIQ 113
           + S L  L     QR  E+I     L      + + L+ P  L    LF    IG+  + 
Sbjct: 60  IMSRLFDL-----QR--EEIFDTAKLFDIALGAMTDLLFPLFLVLATLFTAAMIGAAGVG 112

Query: 114 RIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTM 173
            I   +     P   +++   G+KR+  + + V  +KS +K++LV T + I L +     
Sbjct: 113 GIS-FSAQAAMPKLSKMNPLSGLKRMVGMQSWVELIKSILKVVLV-TGVAIYLIQASQAD 170

Query: 174 LDFISAN--PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKD 231
           L  +S +  P +I +HA   +   +++I   +  +  +DI +   Q   +LKM+KQE+KD
Sbjct: 171 LIQLSMDVYPQNI-FHALDILLNFILLISCSLLIVVAIDIPFQIWQHADQLKMTKQEVKD 229

Query: 232 EIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVL 291
           E K++ G P +K R + + R   + +MM    +A +I+TNP H+++ALRY Q  + APV+
Sbjct: 230 EYKETEGKPEVKGRIRMLQREAAQRRMMADVPQADVIVTNPEHFSVALRYKQKTDRAPVV 289

Query: 292 VAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           +AKG + +A K+R++A EH+I I   P LAR+L+    +   IP   + AVAQ++  ++ 
Sbjct: 290 IAKGTDHMAMKIREVAREHDITIVPAPPLARALYHTTELEQEIPDGLFTAVAQVLAFVFQ 349

Query: 352 KK 353
            K
Sbjct: 350 LK 351


>gi|83654182|gb|ABC38245.1| flagellar biosynthetic protein FlhB [Burkholderia thailandensis
           E264]
          Length = 459

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 103/353 (29%), Positives = 182/353 (51%), Gaps = 7/353 (1%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+   +TEA + K+ E A  EG    SRE + F+ +L+   Y  +  S     +   L 
Sbjct: 61  EDSDLERTEAATPKRREKAREEGQVARSRELASFA-LLSAGFYGAWMLS---GPIGEHLR 116

Query: 64  VLLASATQRKLEDISHIVFLLTH---LSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +L +A             +L+H   LSL     ++P L L  +  + + +     +++ 
Sbjct: 117 TMLHTAFSFDRATAFDTNRMLSHAGILSLEGLYALVPVLALTGVAALAAPMALGGWLVST 176

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
              +  F+R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +  
Sbjct: 177 KTFELKFERLNPVAGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELLGLATQP 236

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            H+ L  A   +     M +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P
Sbjct: 237 LHAALADALHLIAVCCGMTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEVKREHRENEGDP 296

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM     A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A
Sbjct: 297 HVKGRIRQQQRAMARRRMMANVPTADVVVTNPTHFAVALKYTDGEMRAPKVVAKGVNLVA 356

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EH++P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 357 ARIRELAAEHHVPLLEAPPLARALYHNVDLEREIPGTLYSAVAEVLAWVYQLK 409


>gi|325295424|ref|YP_004281938.1| flagellar biosynthetic protein FlhB [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065872|gb|ADY73879.1| flagellar biosynthetic protein FlhB [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 347

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 117/352 (33%), Positives = 188/352 (53%), Gaps = 20/352 (5%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
           +KTE  + ++ + A  EG    S++  +  ++L     LL+F+ P  Y     L      
Sbjct: 6   SKTEKATPRRRQKAKEEGQVLKSQDIPIAFTLLITST-LLYFYIPFAYKKLLQLFTFDFR 64

Query: 69  ATQRKLEDISHIVFLLTHLSLSA---SRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
                    S+ V L  +  +SA   + L++P  L+  + GI S +IQ   + +L  + P
Sbjct: 65  T--------SNNVNLWNNYLVSAKTFALLILPVFLVLFLGGIFSNIIQFGFLFSLKPLLP 116

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIIL---VGTIITISLTENYFTMLDFISANPH 182
               ++  +G+ R++S+  L    ++ +K+I+   VG      +  ++F+ L FIS N  
Sbjct: 117 KLDNINPIKGLGRLFSLKTLFETFRNTLKLIIALAVGYFSGKYILSDFFS-LSFISLNNQ 175

Query: 183 SILYHAFFTVRKVLIMILLF-IATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPI 241
            IL   +  +   +  +L   IA    L   W Y +    LKMSK+EIK+E KQ  G+P+
Sbjct: 176 IILMLKYTLLLFFIFGLLSLPIAAADFLFRRWEYEE---NLKMSKEEIKEERKQYEGHPL 232

Query: 242 IKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAK 301
           IK+  +   R     +MM    +A ++ITNPTHYA+ALRY + +  AP ++AKG + IA 
Sbjct: 233 IKSAIRRKQREIAMKRMMAEIPKADVVITNPTHYAVALRYERGKMHAPKVIAKGVDNIAL 292

Query: 302 KMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           K++KIA EHNIPI E P LAR L++   I S IP  FY+A+A+++ K+Y KK
Sbjct: 293 KIKKIALEHNIPIEENPYLARVLYESCDIGSFIPEEFYQAIAKILAKVYKKK 344


>gi|301165899|emb|CBW25472.1| flagellar biosynthetic protein [Bacteriovorax marinus SJ]
          Length = 361

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 116/372 (31%), Positives = 195/372 (52%), Gaps = 38/372 (10%)

Query: 2   SENDAPDNKTEAPSSKKIEDALNEGNAPISREAS----LFSSILACLIYLLFFFSPGIYS 57
            END+   KTE PS+ +IE+    G    S+E +    L  S++   + +++     +Y 
Sbjct: 4   DENDSDAEKTEDPSAHRIEEFRKRGEVASSKELTSVLVLAGSLMTLGLSMVY-----MYE 58

Query: 58  VTSDL-----HVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLI 112
           V S+      H+ +++A   K   ++ IV  L  +SL +   V P  L+ +  G+ + + 
Sbjct: 59  VLSEFIEWLYHLDVSTAYTAK--SMNTIVNKLVTVSLKS---VAPIFLVTLSIGVAANMA 113

Query: 113 QRIPVL---NLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTEN 169
           Q I VL   ++   KP   R++  +GIKR++S+ +LV  +K   K I +  I+   L + 
Sbjct: 114 Q-IGVLFSPDVLEWKPD--RINPLQGIKRLFSMKSLVEAIKGVFKFIFILGIVYFFLKDE 170

Query: 170 YFTM-----LDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKM 224
             T      LDF      S LY   F +R +   I