PSIBLAST alignment of GI: 254780690 and protein with PDB id: 2jlj

>gi|222446919|pdb|2JLJ|A Chain A, Crystal Structure Of The Cytoplasmic Domain Of Yersinia Pestis Yscu N263a P264a Mutant Length = 144
 Score =  142 bits (358), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 39/131 (29%), Positives = 71/131 (54%)

Query: 219 YSKLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALA 278
             +LKMSK EIK E K+  G+P IK++++   +      M E   R+++++   TH A+ 
Sbjct: 1   IKELKMSKDEIKREYKEMEGSPEIKSKRRQFHQEIQSRNMRENVKRSSVVVAAATHIAIG 60

Query: 279 LRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVF 338
           + Y + E   P++  K  +   + +RKIA E  +PI +   LAR+L+    ++  IP   
Sbjct: 61  ILYKRGETPLPLVTFKYTDAQVQTVRKIAEEEGVPILQRIPLARALYWDALVDHYIPAEQ 120

Query: 339 YKAVAQLIYKI 349
            +A A+++  +
Sbjct: 121 IEATAEVLRWL 131