PSIBLAST alignment of GI: 254780690 and protein with PDB id: 2w0r

>gi|211939072|pdb|2W0R|A Chain A, Crystal Structure Of The Mutated N263d Yscu C-Terminal Domain Length = 144
 Score =  147 bits (371), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 40/131 (30%), Positives = 73/131 (55%)

Query: 219 YSKLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALA 278
             +LKMSK EIK E K+  G+P IK++++   +      M E   R+++++ +PTH A+ 
Sbjct: 1   IKELKMSKDEIKREYKEMEGSPEIKSKRRQFHQEIQSGNMRENVKRSSVVVADPTHIAIG 60

Query: 279 LRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVF 338
           + Y + E   P++  K  +   + +RKIA E  +PI +   LAR+L+    ++  IP   
Sbjct: 61  ILYKRGETPLPLVTFKYTDAQVQTVRKIAEEEGVPILQRIPLARALYWDALVDHYIPAEQ 120

Query: 339 YKAVAQLIYKI 349
            +A A+++  +
Sbjct: 121 IEATAEVLRWL 131