PSIBLAST alignment of GI: 254780690 and protein with PDB id: 3bzl

>gi|185177885|pdb|3BZL|C Chain C, Crystal Structural Of Native Escu C-Terminal Domain Length = 83
>gi|185177887|pdb|3BZL|D Chain D, Crystal Structural Of Native Escu C-Terminal Domain Length = 83
>gi|185177889|pdb|3BZO|B Chain B, Crystal Structural Of Native Escu C-Terminal Domain Length = 83
>gi|185177903|pdb|3C00|B Chain B, Crystal Structural Of The Mutated G247t EscuSPAS C- Terminal Domain Length = 83
 Score = 94.9 bits (235), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/76 (36%), Positives = 45/76 (59%)

Query: 272 PTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPIN 331
           PTH A+ L Y   E   P+++  G++  A ++ K+A  ++IP+ E+  LARSL+K +   
Sbjct: 1   PTHIAICLYYKLGETPLPLVIETGKDAKALQIIKLAELYDIPVIEDIPLARSLYKNIHKG 60

Query: 332 SAIPPVFYKAVAQLIY 347
             I   F++ VAQLI 
Sbjct: 61  QYITEDFFEPVAQLIR 76