PSIBLAST alignment of GI: 254780690 and protein with PDB id: 3bzx

>gi|185177897|pdb|3BZX|B Chain B, Crystal Structure Of The Mutated H265a Escu C-Terminal Domain Length = 83
 Score = 93.0 bits (230), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 27/76 (35%), Positives = 44/76 (57%)

Query: 272 PTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPIN 331
           PT  A+ L Y   E   P+++  G++  A ++ K+A  ++IP+ E+  LARSL+K +   
Sbjct: 1   PTAIAICLYYKLGETPLPLVIETGKDAKALQIIKLAELYDIPVIEDIPLARSLYKNIHKG 60

Query: 332 SAIPPVFYKAVAQLIY 347
             I   F++ VAQLI 
Sbjct: 61  QYITEDFFEPVAQLIR 76