BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780690|ref|YP_003065103.1| flagellar biosynthesis protein
FlhB [Candidatus Liberibacter asiaticus str. psy62]
         (354 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|260598364|ref|YP_003210935.1| flagellar biosynthetic protein flhB [Cronobacter turicensis z3032]
 gi|260217541|emb|CBA31747.1| Flagellar biosynthetic protein flhB [Cronobacter turicensis z3032]
          Length = 392

 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 107/350 (30%), Positives = 184/350 (52%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  + E A  EG  P SRE +    +L  +  +    S     + + L 
Sbjct: 12  SDDSDDKTEAPTPHRREKAREEGQIPRSRELTSMLMLLVGVAVIWMGGSLLARQLAAMLS 71

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       + D   +V  ++ L   A   ++P ++  ++  + + ++    + N   V
Sbjct: 72  HGL-HFDHSIINDPKLVVGQISFLIKQALVALVPLIMGVVIVALFAPMLLGGLLFNTKAV 130

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
               ++++   GIKRI+S  +L   +K+ +K +LVG +    L  N+  M+  IS +P S
Sbjct: 131 AFKPEKLNPLPGIKRIFSSQSLAELLKAVLKSVLVGIVTGCFLWYNWPDMMRLISESPIS 190

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    I+I++ +  +   D+ W       KL+MS+Q+I+DE K   G+P +K
Sbjct: 191 AMRNAMNLVALCCILIVMGLVPMVGFDVFWQIVSHTKKLRMSRQDIRDEFKNQEGDPHVK 250

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R +   R   R +MM    +A +I+TNPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 251 GRIRQQQREAARRRMMADVPKADVIVTNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 310

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  EH IP+ E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 311 REIGNEHRIPMLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 360


>gi|311279222|ref|YP_003941453.1| flagellar biosynthetic protein FlhB [Enterobacter cloacae SCF1]
 gi|308748417|gb|ADO48169.1| flagellar biosynthetic protein FlhB [Enterobacter cloacae SCF1]
          Length = 387

 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 103/352 (29%), Positives = 190/352 (53%), Gaps = 1/352 (0%)

Query: 2   SENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSD 61
           ++N   ++KTEAP+ ++++ A  EG  P SRE +    +L  +  L F        + + 
Sbjct: 5   ADNSDSEDKTEAPTPQRLDKAREEGQIPRSRELTSLLILLVGVCVLWFGGESMARRLAAL 64

Query: 62  LHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLN 121
           L   L       + D + I+  +  L   A   ++P +   ++  I + ++    V +  
Sbjct: 65  LSSGL-HFDHSIVNDPNLILGQIILLIKQAMLALLPLITGVVVVAIVAPMMLGGLVFSPK 123

Query: 122 HVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANP 181
            +   F +++   GIKR++S  +    +K+ +K +LVG +    +  ++  M+  IS +P
Sbjct: 124 SLAFKFDKLNPLPGIKRLFSAQSAAELLKAILKSVLVGCVAGTYVWSHWPDMMRLISESP 183

Query: 182 HSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPI 241
            + + +A   V    +++ L +  +   D+ W  H    KL+MS+Q+I+DE KQ+ G+P 
Sbjct: 184 LAAMGNALNMVGLCAMLVALGVIPMVGFDVFWQIHSHIKKLRMSRQDIRDEFKQNEGDPH 243

Query: 242 IKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAK 301
           +K R + + R+  R +MM    +A +I+TNPTHY++AL+Y++ +  AP +VAKG  LIA 
Sbjct: 244 VKGRIRQMQRAAARRRMMGDVPKADVIVTNPTHYSVALQYVEGKMSAPKVVAKGAGLIAL 303

Query: 302 KMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           ++R+I  EH +P+ E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 304 RIREIGQEHRVPVLEAPPLARALYRHAEIGQQIPGTLYAAVAEVLAWVWQLK 355


>gi|168238548|ref|ZP_02663606.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|194734592|ref|YP_002114950.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|204931016|ref|ZP_03221842.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|194710094|gb|ACF89315.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197288673|gb|EDY28048.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|204320060|gb|EDZ05265.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|322616914|gb|EFY13822.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322618152|gb|EFY15044.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322625823|gb|EFY22642.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322626275|gb|EFY23085.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322632689|gb|EFY29434.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322639033|gb|EFY35726.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322640473|gb|EFY37126.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322646018|gb|EFY42535.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322649560|gb|EFY45992.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322655468|gb|EFY51776.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322660247|gb|EFY56485.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322662928|gb|EFY59135.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322668113|gb|EFY64272.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674127|gb|EFY70221.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322675519|gb|EFY71593.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322683067|gb|EFY79083.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322686761|gb|EFY82739.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323195348|gb|EFZ80528.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323199240|gb|EFZ84335.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323204035|gb|EFZ89050.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323207496|gb|EFZ92444.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323217480|gb|EGA02199.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323221971|gb|EGA06361.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323224718|gb|EGA08987.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323231502|gb|EGA15615.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323235944|gb|EGA20023.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323240514|gb|EGA24557.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323245406|gb|EGA29406.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323250177|gb|EGA34069.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323253625|gb|EGA37453.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323255054|gb|EGA38842.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323260286|gb|EGA43907.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323266878|gb|EGA50364.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323270708|gb|EGA54149.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
          Length = 383

 Score =  378 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 103/353 (29%), Positives = 189/353 (53%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  + D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        +  
Sbjct: 1   MAEE-SDDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVCIIWFGGESLARQLAG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L     R + D + I+  +  L  +A   ++P +   ++  + S ++    + + 
Sbjct: 60  MLSAGL-HFDHRMVNDPNLILGQIILLIKAAMMALLPLIAGVVLVALISPVMLGGLIFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K  LVG +    L  N+  M+  ++ +
Sbjct: 119 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAVLKSTLVGCVTGFYLWHNWPQMMRLMAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE K+S G+P
Sbjct: 179 PIVAMGNALDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + + R+  + +MME   +A +I+TNPTHY++AL+Y + +  AP +VAKG  LIA
Sbjct: 239 HVKGKIRQMQRAAAQRRMMEDVPKADVIVTNPTHYSVALQYDENKMSAPKVVAKGAGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  EH +P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 299 LRIREIGAEHRVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 351


>gi|16765256|ref|NP_460871.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|161613526|ref|YP_001587491.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167994220|ref|ZP_02575312.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168234020|ref|ZP_02659078.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168462551|ref|ZP_02696482.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|168820742|ref|ZP_02832742.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|194445536|ref|YP_002041180.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194472731|ref|ZP_03078715.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|197251527|ref|YP_002146107.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|238912509|ref|ZP_04656346.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|729522|sp|P40727|FLHB_SALTY RecName: Full=Flagellar biosynthetic protein flhB
 gi|633115|dbj|BAA06902.1| flagellar protein FlhB [Salmonella enterica subsp. enterica serovar
           Typhimurium]
 gi|16420451|gb|AAL20830.1| putative part of export apparatus for flagellar proteins
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. LT2]
 gi|161362890|gb|ABX66658.1| hypothetical protein SPAB_01246 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194404199|gb|ACF64421.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194459095|gb|EDX47934.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|195634185|gb|EDX52537.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197215230|gb|ACH52627.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|205327877|gb|EDZ14641.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205331965|gb|EDZ18729.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205342676|gb|EDZ29440.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|261247084|emb|CBG24905.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267993900|gb|ACY88785.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|312912908|dbj|BAJ36882.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|320085466|emb|CBY95247.1| Flagellar biosynthetic protein flhB [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|321224557|gb|EFX49620.1| Flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|332988807|gb|AEF07790.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 383

 Score =  378 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 102/353 (28%), Positives = 189/353 (53%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  + D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        +  
Sbjct: 1   MAEE-SDDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVCIIWFGGESLARQLAG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L     R + D + I+  +  L  +A   ++P +   ++  + S ++    + + 
Sbjct: 60  MLSAGL-HFDHRMVNDPNLILGQIILLIKAAMMALLPLIAGVVLVALISPVMLGGLIFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K  LVG +    L  ++  M+  ++ +
Sbjct: 119 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAVLKSTLVGCVTGFYLWHHWPQMMRLMAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE K+S G+P
Sbjct: 179 PIVAMGNALDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + + R+  + +MME   +A +I+TNPTHY++AL+Y + +  AP +VAKG  LIA
Sbjct: 239 HVKGKIRQMQRAAAQRRMMEDVPKADVIVTNPTHYSVALQYDENKMSAPKVVAKGAGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  EH +P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 299 LRIREIGAEHRVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 351


>gi|161502970|ref|YP_001570082.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160864317|gb|ABX20940.1| hypothetical protein SARI_01032 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 383

 Score =  378 bits (971), Expect = e-103,   Method: Composition-based stats.
 Identities = 102/353 (28%), Positives = 189/353 (53%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  + D+KTE P+  ++E A  EG  P SRE +    +L  +  + F        +  
Sbjct: 1   MAEE-SDDDKTEDPTPHRLEKAREEGQIPRSRELTSLLILLVGVCIIWFGGESLARQLAG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L     R + D + I+  +  L  +A   ++P +   ++  + S ++    + + 
Sbjct: 60  MLSAGL-HFDHRMVNDPNLILGQIILLIKAAMMALLPLIAGVVLVALISPVMLGGLIFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K  LVG +    L  N+  M+  ++ +
Sbjct: 119 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAVLKSTLVGCVTGSYLWHNWPQMMRLMAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE K+S G+P
Sbjct: 179 PITAMGNALNLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + + R+  + +MME   +A +I+TNPTHY++AL+Y + +  AP +VAKG  LIA
Sbjct: 239 HVKGKIRQMQRAAAQRRMMEDVPKADVIVTNPTHYSVALQYEENKMSAPKVVAKGAGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  EH +P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 299 LRIREIGAEHRVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 351


>gi|16760863|ref|NP_456480.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|29141445|ref|NP_804787.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|213163285|ref|ZP_03348995.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213426385|ref|ZP_03359135.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213583527|ref|ZP_03365353.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|289824043|ref|ZP_06543641.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|25322221|pir||AF0745 flagellar biosynthetic protein FlhB [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16503160|emb|CAD05665.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29137072|gb|AAO68636.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
          Length = 383

 Score =  378 bits (971), Expect = e-103,   Method: Composition-based stats.
 Identities = 102/353 (28%), Positives = 189/353 (53%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  + D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        +  
Sbjct: 1   MAEE-SDDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVCIIWFGGESLARQLAG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L     R + D + I+  +  L  +A   ++P +   ++  + S ++    + + 
Sbjct: 60  MLSAGL-HFDHRMVNDPNLILGQIILLIKAAMMALLPLIAGVVLVALISPVMLGGLIFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K  LVG +    L  ++  M+  ++ +
Sbjct: 119 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAVLKSTLVGCVTGFYLWNHWPQMMRLMAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE K+S G+P
Sbjct: 179 PIVAMGNALDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + + R+  + +MME   +A +I+TNPTHY++AL+Y + +  AP +VAKG  LIA
Sbjct: 239 HVKGKIRQMQRAAAQRRMMEDVPKADVIVTNPTHYSVALQYDENKMSAPKVVAKGAGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  EH +P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 299 LRIREIGAEHRVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 351


>gi|283832722|ref|ZP_06352463.1| flagellar biosynthetic protein FlhB [Citrobacter youngae ATCC
           29220]
 gi|291072402|gb|EFE10511.1| flagellar biosynthetic protein FlhB [Citrobacter youngae ATCC
           29220]
          Length = 383

 Score =  378 bits (970), Expect = e-103,   Method: Composition-based stats.
 Identities = 98/353 (27%), Positives = 187/353 (52%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  + D+KTEAP+  ++E A  EG  P S+E +    +L  +  +          +  
Sbjct: 1   MAEE-SDDDKTEAPTPHRLEKAREEGQIPRSKELTSLLILLVGVCIIWIGGESLARRLAG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L       + D + I+  +  L   A   ++P +   ++  + S ++    + + 
Sbjct: 60  MLSAGLR-FDHSMVNDPNLILSQIILLIKDAMIALLPLITGVVLVALISPVMLGGLIFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K  LVG++    L  N+  M+  ++ +
Sbjct: 119 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAILKSTLVGSVAGFYLWHNWPEMMRLVAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L +  +   D+ +  +    KL+MS+Q+I+DE KQS G+P
Sbjct: 179 PITAMGNALDLVGMCALLVVLGVIPMVGFDVFFQIYSHLKKLRMSRQDIRDEFKQSEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + + R+  + +MM    +A +I+TNPTHY++AL+Y + +  AP +VAKG   +A
Sbjct: 239 HVKGKIRQMQRAAAQRRMMADVPKADVIVTNPTHYSVALQYDENKMSAPKVVAKGAGPVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  EH +P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 299 LRIREIGAEHRVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 351


>gi|323977935|gb|EGB73021.1| flagellar biosynthetic protein FlhB [Escherichia coli TW10509]
          Length = 382

 Score =  378 bits (970), Expect = e-103,   Method: Composition-based stats.
 Identities = 102/350 (29%), Positives = 188/350 (53%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVCVIWFGGVSLARRLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       + D + I+  +  L   A   ++P +   ++  + S ++    V +   +
Sbjct: 62  AGL-HFDHNIINDPNLILGQIILLIREAMLGLLPLISGVVLVALISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFYLWHHWPQMMRLMAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRIRQMQRAAARRRMMNDVPKADVIVNNPTHYSVALQYDEHKMSAPKVVAKGAGLVALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|167552446|ref|ZP_02346199.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|168241547|ref|ZP_02666479.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|168259807|ref|ZP_02681780.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|194451224|ref|YP_002045968.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|200389783|ref|ZP_03216394.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|207856565|ref|YP_002243216.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|194409528|gb|ACF69747.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|199602228|gb|EDZ00774.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|205322918|gb|EDZ10757.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205339229|gb|EDZ25993.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205350661|gb|EDZ37292.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|206708368|emb|CAR32672.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
          Length = 383

 Score =  378 bits (970), Expect = e-103,   Method: Composition-based stats.
 Identities = 102/353 (28%), Positives = 189/353 (53%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  + D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        +  
Sbjct: 1   MAEE-SDDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVCIIWFGGESLARQLAG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L     R + D + I+  +  L  +A   ++P +   ++  + S ++    + + 
Sbjct: 60  MLSAGL-HFDHRMVNDPNLILGQIILLIKAAMMALLPLIAGVVLVALISPVMLGGLIFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K  LVG +    L  ++  M+  ++ +
Sbjct: 119 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAVLKSTLVGCVTGFYLWYHWPQMMRLMAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE K+S G+P
Sbjct: 179 PIVAMGNALDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + + R+  + +MME   +A +I+TNPTHY++AL+Y + +  AP +VAKG  LIA
Sbjct: 239 HVKGKIRQMQRAAAQRRMMEDVPKADVIVTNPTHYSVALQYDENKMSAPKVVAKGAGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  EH +P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 299 LRIREIGAEHRVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 351


>gi|62180491|ref|YP_216908.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|224583582|ref|YP_002637380.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|62128124|gb|AAX65827.1| putative part of export apparatus for flagellar proteins
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|224468109|gb|ACN45939.1| flagellar biosynthesis protein [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|322714967|gb|EFZ06538.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
          Length = 383

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 101/353 (28%), Positives = 189/353 (53%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  + D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        +  
Sbjct: 1   MAEE-SDDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVCIIWFGGESLARQLAG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L     R + D + I+  +  L  +A   ++P +   ++  + S ++    + + 
Sbjct: 60  MLSAGL-HFDHRMVNDPNLILGQIILLIKAAMMALLPLIAGVVLVALISPVMLGGLIFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K  LVG +    L  ++  M+  ++ +
Sbjct: 119 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAVLKSTLVGCVTGFYLWHHWPQMMRLMAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE K+S G+P
Sbjct: 179 PIVAMGNALDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + + R+  + +MME   +A +I+TNPTHY++AL+Y + +  AP +VAKG  LIA
Sbjct: 239 HVKGKIRQMQRAAAQRRMMEDVPKADVIVTNPTHYSVALQYDENKMSAPKVVAKGAGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++  EH +P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 299 LRIRELGAEHRVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 351


>gi|261340264|ref|ZP_05968122.1| flagellar biosynthetic protein FlhB [Enterobacter cancerogenus ATCC
           35316]
 gi|288317353|gb|EFC56291.1| flagellar biosynthetic protein FlhB [Enterobacter cancerogenus ATCC
           35316]
          Length = 382

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 102/353 (28%), Positives = 189/353 (53%), Gaps = 3/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E++    KTEAP+  ++E A  EG  P SRE +    ++  +  + +        +  
Sbjct: 1   MAEDNDD--KTEAPTPHRLEKAREEGQVPRSRELTSLLILVVGVCIIWWGGESFARRLAG 58

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L       + D + I+  +  L  +A   ++P +   ++  + S ++    V + 
Sbjct: 59  MLSAGLR-FDHSMVNDPNLILSQIILLVKNAMIALLPLISGVVLVALVSPVMLGGLVFSG 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GI +++S       +K+ +K  L+G+     L  ++  M+  IS +
Sbjct: 118 KSLQPKFSKLNPLPGIAKMFSAQTGAELVKAILKSALMGSTAGFFLWHHWPEMMRLISES 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L I  +   D+ +  +  + KL+MS+Q+I+DE KQ  G+P
Sbjct: 178 PFNAMNNAMNLVGLCALLVVLSIIPMVGFDVIFQMYSHFKKLRMSRQDIRDEYKQMEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R+  R +MME   +A +I+TNPTHY++ALRY + +  AP +VAKG  LIA
Sbjct: 238 HVKGRIRQMQRAAARRRMMEDVPKADVIVTNPTHYSVALRYDENKMSAPKVVAKGAGLIA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  E+ +PI E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 298 LRIREIGTENRVPILEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|237731916|ref|ZP_04562397.1| flagellar biosynthesis protein FlhB [Citrobacter sp. 30_2]
 gi|226907455|gb|EEH93373.1| flagellar biosynthesis protein FlhB [Citrobacter sp. 30_2]
          Length = 383

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 99/353 (28%), Positives = 188/353 (53%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  + D+KTEAP+  ++E A  EG  P S+E +    +L  +  +          +  
Sbjct: 1   MAEE-SDDDKTEAPTPHRLEKAREEGQIPRSKELTSLLILLVGVCIIWIGGESLARRLAG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L       + D + I+  +  L   A   ++P +   ++  + S ++    + + 
Sbjct: 60  MLSAGLR-FDHSMVNDPNLILSQIILLIKDAMIALLPLITGVVLVALISPVMLGGLIFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K  LVG++    L  N+  M+  ++ +
Sbjct: 119 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAILKSTLVGSVAGFYLWHNWPAMMRLMAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L +  +   D+ +  +    KL+MS+Q+I+DE KQS G+P
Sbjct: 179 PITAMGNALDLVGMCALLVVLGVIPMVGFDVFFQIYSHVKKLRMSRQDIRDEFKQSEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + + R+  + +MM    +A +I+TNPTHY++AL+Y + +  AP +VAKG  L+A
Sbjct: 239 HVKGKIRQMQRAAAQRRMMADVPKADVIVTNPTHYSVALKYDENKMSAPKVVAKGAGLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  EH +P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 299 LRIREIGAEHRVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 351


>gi|198245714|ref|YP_002215169.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|197940230|gb|ACH77563.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
          Length = 383

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 102/353 (28%), Positives = 190/353 (53%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  + D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        +  
Sbjct: 1   MAEE-SDDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVCIIWFGGESLARQLAG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L     R + D + I+  +  L  +A   ++P +   ++  + S ++    + + 
Sbjct: 60  MLSAGL-HFDHRMVNDPNLILGQIILLIKAAMMALLPLIAGVVLVALISPVMLGGLIFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K  LVG +    L  ++  M+  ++ +
Sbjct: 119 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAVLKSTLVGCVTGFYLWYHWPQMMRLMAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE K+S G+P
Sbjct: 179 PIVAMGNALDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + + R+  + +MME   +A +I+TNPTHY++AL+Y +++  AP +VAKG  LIA
Sbjct: 239 HVKGKIRQMQRAAAQRRMMEDVPKADVIVTNPTHYSVALQYDESKMSAPKVVAKGAGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  EH +P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 299 LRIREIGAEHRVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 351


>gi|56413166|ref|YP_150241.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197362092|ref|YP_002141729.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|56127423|gb|AAV76929.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197093569|emb|CAR59032.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
          Length = 383

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 103/353 (29%), Positives = 189/353 (53%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  + D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        +  
Sbjct: 1   MAEE-SDDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVCIIWFGGESLARQLAG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L     R + D + I+  +  L  +A   ++P +   ++  + S ++    + + 
Sbjct: 60  MLSAGL-HFDHRMVNDPNLILGQIILLIKAAMMALLPLIAGVVLVALISPVMLGGLIFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K  LVG +    L  ++  M+  ++ +
Sbjct: 119 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAVLKSTLVGCVTGFYLWHHWPQMMRLMAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE K+S G+P
Sbjct: 179 PIVAMGNALDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + + R+  + +MME   +A +I+TNPTHY++AL+Y + +  AP +VAKG  LIA
Sbjct: 239 HVKGKIRQMQRAAAQRRMMEDVPKADVIVTNPTHYSVALQYDENKMSAPKVVAKGAGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  EH +P  E P LAR+L++   I   IP   Y AVA+++  I+  K
Sbjct: 299 LRIREIGAEHRVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWIWQLK 351


>gi|271500057|ref|YP_003333082.1| flagellar biosynthetic protein FlhB [Dickeya dadantii Ech586]
 gi|270343612|gb|ACZ76377.1| flagellar biosynthetic protein FlhB [Dickeya dadantii Ech586]
          Length = 383

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 104/353 (29%), Positives = 183/353 (51%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++ D+   KTEAP+ ++ E A  EG  P S+E +    ++A L  L  + S     ++ 
Sbjct: 1   MAD-DSDLEKTEAPTPQRTEKAREEGQIPRSKELTSVFMLIAGLAILWGYGSSMAGRLSD 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L       + D   I+  +  L   A   ++P L   ++  +G+ ++    + + 
Sbjct: 60  MMAKGLI-FDHGFINDERLIISHVGTLLEQAVLALVPILFGLVLVALGAPILLGGLIFST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +   F +++   G+KR++S   L    K+ +K ++VG I    L  N+ +ML  +S  
Sbjct: 119 KAISFDFGKMNPLSGLKRMFSTQVLAELFKAILKAVIVGLITFWFLRHNWNSMLHLVSEP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               +  A          ++L +  +   D+ W       +L+MSKQEI+DE K+  G+P
Sbjct: 179 MGMAIKDALNIAFLCCFWVILGLFPMVGFDVAWQIWSHIKRLRMSKQEIRDEYKEHEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IKNR +   R+  + +MM    +A +I+TNPTHYA+AL+Y + +  AP ++AKG + IA
Sbjct: 239 HIKNRIRQQQRAMAQRRMMSDVPKADVIVTNPTHYAVALKYDEKKMSAPRVLAKGADRIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +++R++  E+ IPI E P LAR+L++   I   IP   Y AVA+++  +Y  K
Sbjct: 299 QRIRELGTENRIPILEAPPLARALYRHTEIGQQIPTGLYAAVAEVLSWVYQLK 351


>gi|326622917|gb|EGE29262.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
          Length = 383

 Score =  376 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 102/353 (28%), Positives = 190/353 (53%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  + D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        +  
Sbjct: 1   MAEE-SDDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVCIIWFGGESLARQLAG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L     R + D + I+  +  L  +A   ++P +   ++  + S ++    + + 
Sbjct: 60  MLSAGL-HFDHRMVNDPNLILGQIILLIKAAMMALLPLIAGVVLVALISPVMLGGLIFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K  LVG +    L  ++  M+  ++ +
Sbjct: 119 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAVLKSTLVGCVTGFYLWYHWPQMMRLMAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE K+S G+P
Sbjct: 179 PIVAMGNALDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + + R+  + +MME   +A +I+TNPTHY++AL+Y +++  AP +VAKG  LIA
Sbjct: 239 HVKGKIRQMQRAAAQRRMMEDVPKADVIVTNPTHYSVALQYDESKMSAPKVVAKGAGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  EH +P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 299 LRIREIGAEHRVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLSWVWQLK 351


>gi|301158434|emb|CBW17943.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|323130198|gb|ADX17628.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
          Length = 383

 Score =  376 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 102/353 (28%), Positives = 189/353 (53%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  + D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        +  
Sbjct: 1   MAEE-SDDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVCIIWFGGESLARQLAG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L     R + D + I+  +  L  +A   ++P +   ++  + S ++    + + 
Sbjct: 60  MLSAGL-HFDHRMVIDPNLILGQIILLIKAAMMALLPLIAGVVLVALISPVMLGGLIFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K  LVG +    L  ++  M+  ++ +
Sbjct: 119 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAVLKSTLVGCVTGFYLWHHWPQMMRLMAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE K+S G+P
Sbjct: 179 PIVAMGNALDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + + R+  + +MME   +A +I+TNPTHY++AL+Y + +  AP +VAKG  LIA
Sbjct: 239 HVKGKIRQMQRAAAQRRMMEDVPKADVIVTNPTHYSVALQYDENKMSAPKVVAKGAGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  EH +P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 299 LRIREIGAEHRVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 351


>gi|197265115|ref|ZP_03165189.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197243370|gb|EDY25990.1| flagellar biosynthetic protein FlhB [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
          Length = 383

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 102/353 (28%), Positives = 189/353 (53%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  + D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        +  
Sbjct: 1   MAEE-SEDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVCIIWFGGESLARQLAG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L     R + D + I+  +  L  +A   ++P +   ++  + S ++    + + 
Sbjct: 60  MLSAGL-HFDHRMVNDPNLILGQIILLIKAAMMALLPLIAGVVLVALISPVMLGGLIFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K  LVG +    L  ++  M+  ++ +
Sbjct: 119 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAVLKSTLVGCVTGFYLWHHWPQMMRLMAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE K+S G+P
Sbjct: 179 PIVAMGNALDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + + R+  + +MME   +A +I+TNPTHY++AL+Y + +  AP +VAKG  LIA
Sbjct: 239 HVKGKIRQMQRAAAQRRMMEDVPKADVIVTNPTHYSVALQYDENKMSAPKVVAKGAGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  EH +P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 299 LRIREIGAEHRVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 351


>gi|307131618|ref|YP_003883634.1| flagellar biosynthesis protein flhB [Dickeya dadantii 3937]
 gi|306529147|gb|ADM99077.1| Flagellar biosynthesis protein flhB [Dickeya dadantii 3937]
          Length = 383

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 106/353 (30%), Positives = 182/353 (51%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++ D+   KTEAP+ ++ E A  EG  P SRE +    ++A L  L    S     +T 
Sbjct: 1   MAD-DSDLEKTEAPTPQRTEKAREEGQIPRSRELTSVLMLIAGLAILWGSGSGMAARLTD 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L       + D   I+  +  L   A   ++P L   ++  + + ++    + + 
Sbjct: 60  MMAKGLI-FDHNFISDERLIISHVGSLIEQAVMALVPILFGLVLVALAAPVLLGGLIFST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +   F +++   G+KR++S + L    K+ +K ++VG I    L  N+ +ML  +S  
Sbjct: 119 KAISFDFGKMNPLSGLKRMFSTHVLAELFKAILKAVIVGCITFWFLKHNWNSMLHLVSEP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             S +  A          ++L +  +   D+GW       +L+MSKQEI+DE K+  G+P
Sbjct: 179 LGSAIKDALNIAFLCCFWVILGLFPMVAFDVGWQIWSHIKRLRMSKQEIRDEYKEHEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  + +MM    +A +I+TNPTHYA+AL+Y + +  AP ++AKG + IA
Sbjct: 239 HVKGRVRQQQRAMAQRRMMADVPKADVIVTNPTHYAVALKYDEKKMHAPKVLAKGADQIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++  EH IPI E P LAR+L++   I   IP   Y AVA+++  +Y  K
Sbjct: 299 LRIRELGSEHRIPILEAPPLARALYRHTEIGHHIPTGLYAAVAEVLSWVYQLK 351


>gi|157145338|ref|YP_001452657.1| flagellar biosynthesis protein FlhB [Citrobacter koseri ATCC
           BAA-895]
 gi|157082543|gb|ABV12221.1| hypothetical protein CKO_01078 [Citrobacter koseri ATCC BAA-895]
          Length = 383

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 98/353 (27%), Positives = 188/353 (53%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  + D+KTEAP+  ++E A  EG  P S+E +    +L  +  +          +  
Sbjct: 1   MAEE-SDDDKTEAPTPHRLEKAREEGQVPRSKELTSLLILLVGVCIIWIGGESLARRLAG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L       + D + I+  +  L   A   ++P +   ++  + S ++    + + 
Sbjct: 60  MLSAGLR-FDHSMVNDPNLILGQIILLIKEAMIALLPLITGVVLVALISPVMLGGLIFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K  LVG++    L  ++  M+  ++ +
Sbjct: 119 KSLQPKFSKLNPLSGIKRMFSAQTGAELLKAILKSTLVGSVAGFYLWHHWPEMMRLMAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L +  +   D+ +       KL+MS+++I+DE K+S G+P
Sbjct: 179 PVTAMGNALDLVGLCALLVVLGVIPMVAFDVVFQIFSHLKKLRMSRKDIRDEFKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK + + + R+  + +MME   +A +I+TNPTHY++AL+Y + +  AP +VAKG  L+A
Sbjct: 239 HIKGKIRQMQRAAAQRRMMEDVPKADVIVTNPTHYSVALQYDENKMSAPKVVAKGAGLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  EH +P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 299 LRIREIGAEHRVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 351


>gi|146312093|ref|YP_001177167.1| flagellar biosynthesis protein FlhB [Enterobacter sp. 638]
 gi|145318969|gb|ABP61116.1| flagellar biosynthetic protein FlhB [Enterobacter sp. 638]
          Length = 382

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 97/353 (27%), Positives = 188/353 (53%), Gaps = 3/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+  D  D+KTEAP+  +++ A  +G  P SRE +    ++  +  + F        +  
Sbjct: 1   MA--DDSDDKTEAPTPHRLDKAREDGQVPRSRELTSLLILIVGVCIIWFGGGAFANRLAG 58

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L       + D + I+  +  L  +A   ++P +   ++  + S ++    + + 
Sbjct: 59  MLSAGLR-FDHSIVNDQNLILSQIILLIKNAMIALLPLISGVVLVALVSPIMLGGLIFSG 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GI +++S       +K+ +K  L+G+     L  ++  M+  +S +
Sbjct: 118 KSLQPKFSKLNPFPGIAKMFSAQTGAELLKAILKSTLMGSTAGFYLWHHWPDMMRLLSES 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L I  +   D+ +  +    KL+MS+Q+++DE KQ  G+P
Sbjct: 178 PLTAMRNAMDLVGFCAVLVVLSIIPMVGFDVFFQIYSHIKKLRMSRQDLRDEYKQMEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R+  R +MME   +A +I+TNPTHY++AL+Y + +  AP +VAKG  LIA
Sbjct: 238 HVKGRIRQMQRAAARRRMMEDVPKADVIVTNPTHYSVALKYDENKMSAPKVVAKGAGLIA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  E+ +P+ E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 298 LRIREIGSENRVPVLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|218548562|ref|YP_002382353.1| flagellar biosynthesis protein FlhB [Escherichia fergusonii ATCC
           35469]
 gi|218356103|emb|CAQ88720.1| flagellar export pore protein [Escherichia fergusonii ATCC 35469]
 gi|324113614|gb|EGC07589.1| flagellar biosynthetic protein FlhB [Escherichia fergusonii B253]
 gi|325496979|gb|EGC94838.1| flagellar biosynthesis protein FlhB [Escherichia fergusonii ECD227]
          Length = 382

 Score =  375 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 101/350 (28%), Positives = 186/350 (53%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        + + L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSMLILLVGVCVIWFGGESLARQLAAMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       + D + I+  +  L   A   ++P +   ++  + S ++    + +   +
Sbjct: 62  AGL-HFDHHLINDPNLILGQIILLIKQAMMALLPLITGVVLVALISPVLLGGLIFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKR++S       +K+ +K  LVG +    L   +  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRMFSAQTGAELLKAILKSTLVGCVAGFYLWHKWPEMMRLMAQSPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNALDLVGLCALLVVLGVIPMVGFDVFYQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP ++AKG  L+A ++
Sbjct: 241 GRIRQMQRAAARRRMMNDVPQADVIVNNPTHYSVALQYDENKMSAPKVIAKGAGLVALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+IA EH+IP  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIAAEHHIPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|220934507|ref|YP_002513406.1| flagellar biosynthetic protein FlhB [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995817|gb|ACL72419.1| flagellar biosynthetic protein FlhB [Thioalkalivibrio sp. HL-EbGR7]
          Length = 384

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 94/354 (26%), Positives = 176/354 (49%), Gaps = 2/354 (0%)

Query: 1   MSENDAP-DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVT 59
           M+END     K+E P+ K++ +A  +G    SRE +    +LA    +L      +  + 
Sbjct: 1   MAENDDSSQEKSEQPTPKRLREAREKGQVARSRELNTTLVLLAGAGAMLVLGGGMLSRIQ 60

Query: 60  SDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLN 119
             +        +  + D S +  +L      +  +++P   + ++  +   +       +
Sbjct: 61  EMVRGSFV-LEREAIFDASTMQAMLILRISESLLMLLPLFGILLVAAVAGPIAMGGGGFS 119

Query: 120 LNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISA 179
              + P + +++   G+KRI+S   L+ F K+  K  L+  I    L     ++L     
Sbjct: 120 GKAMAPKWNKLNPIAGLKRIFSWQGLMEFGKTLAKFALITAIAGSLLWGLSDSLLGLGYQ 179

Query: 180 NPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
           +    L  A + V    +++   +  + ++D+ +       +L+M+KQ++KDE K++ G 
Sbjct: 180 SLEQGLGRAAWIVGWTFLLLAASLILVALVDVPFQLWNHQKQLRMTKQQVKDEYKETEGK 239

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLI 299
           P +K+R +       R +MM A  +A +++TNPTHYA+ALRY Q  + AP +VAKG +L+
Sbjct: 240 PEVKSRIRQTQMEIARRRMMAAVPKADVVVTNPTHYAVALRYDQNGSGAPKVVAKGADLV 299

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A ++R+ A E  +P+F  P LAR++F    ++  IP   Y AVAQ++  +Y  K
Sbjct: 300 AAEIRERAREAGVPLFPAPPLARAIFYSTRLDQEIPAGLYVAVAQVLAYVYQLK 353


>gi|170725986|ref|YP_001760012.1| flagellar biosynthesis protein FlhB [Shewanella woodyi ATCC 51908]
 gi|169811333|gb|ACA85917.1| flagellar biosynthetic protein FlhB [Shewanella woodyi ATCC 51908]
          Length = 377

 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 86/353 (24%), Positives = 169/353 (47%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+END+   KTE  + ++ E A  +G    S+E    + +LA  +  +        ++ S
Sbjct: 1   MAENDSSQEKTEEATPRRREQAREKGQVARSKELGTSAVLLASAVGFVMAGPGIAKALAS 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L  +  + ++ D + +  +   + L  +  ++  +    +      ++      ++
Sbjct: 61  IMTNLF-TIDRAQVFDTNEMFLIWKFIGLELAFPILSLIAFLAVVSFIGNIVLGGITFSV 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   ++S  +G KR++ +  LV   K   K  +V       L+  +  +L     +
Sbjct: 120 KAFMPKPDKMSPVKGFKRMFGVQALVELTKGIAKFSVVALAAYFLLSFYFDDILALSREH 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               +YH+   +  + I++      + V+D+ +       +LKM+KQEIKDE K + G P
Sbjct: 180 LPGNVYHSLDLLAWMFILLCSSTLLIVVIDVPFQIWNHNKQLKMTKQEIKDEYKDTEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + + R   + +MM     A +I+ NP HYA+A++Y   ++ AP ++AKG + +A
Sbjct: 240 EVKGKVRQMQREMAQRRMMSEVPNADVIVVNPEHYAVAVKYDVMKSTAPYVLAKGVDDVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA EH I I   P LAR+++    I   IP   + AVAQ++  ++  +
Sbjct: 300 FKIREIAREHEIAIVSAPPLARAIYHTTKIEQEIPEGLFTAVAQVLAYVFQLR 352


>gi|127512310|ref|YP_001093507.1| flagellar biosynthesis protein FlhB [Shewanella loihica PV-4]
 gi|126637605|gb|ABO23248.1| flagellar biosynthetic protein FlhB [Shewanella loihica PV-4]
          Length = 377

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 83/353 (23%), Positives = 169/353 (47%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++ND    KTE  + ++ E A  +G    S+E    + +++  +           S+ S
Sbjct: 1   MADNDTSQEKTEEATPRRREQAREKGQVARSKELGTSAVLMSAAVGFAVIGPSLGQSLMS 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L  + +++++ D + +  +   +    +  +   +L          ++      + 
Sbjct: 61  VMTKLF-TMSRQEIYDTNSLFNIWMMVFKELAIPMASFVLFLAFIAFLGNVVLGGITFSA 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   +++   G KR++ +  LV   K   K  +V  +  + L+  +  +L     +
Sbjct: 120 KAFMPKGNKMNPISGFKRMFGVQALVELTKGIAKFSVVALMAYLLLSYYFNDILTLSQGH 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               +Y+A   +  + I++      + V+D+ +       +L+M+KQEIKDE K + G P
Sbjct: 180 LPGNVYNALDLLVWMFIVLCSSTVIIVVIDVPFQIWNHNKQLRMTKQEIKDEYKDTEGQP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM     A +I+ NP HYA+A++Y  T+  AP ++AKG + +A
Sbjct: 240 EVKGRVRQMQREMAQRRMMAEVPNADVIVVNPEHYAVAVKYDVTKAAAPYVLAKGVDDVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA EH++ I   P LAR+++    I+  IP   + AVAQ++  ++  +
Sbjct: 300 FKIREIAREHDVAIVSAPPLARAIYHTTKIDQEIPEGLFTAVAQVLAYVFQLR 352


>gi|251789159|ref|YP_003003880.1| flagellar biosynthesis protein FlhB [Dickeya zeae Ech1591]
 gi|247537780|gb|ACT06401.1| flagellar biosynthetic protein FlhB [Dickeya zeae Ech1591]
          Length = 383

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 99/353 (28%), Positives = 182/353 (51%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++ D+   KTEAP+ ++ E A  EG  P S+E +    ++A L  L  + S     +T 
Sbjct: 1   MAD-DSDLEKTEAPTPQRTEKAREEGQIPRSKELTSVFMLIAGLAILWGYGSSMAGKLTD 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L       + D    +  +  L   A   ++P L   ++  + + ++    + + 
Sbjct: 60  MMAKGLI-FDHNLISDERLFISHVGALLKQAMLAIVPILFGLVLVALAAPVLLGGLIFST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +   F +++   G+KR++S + L    K+ +K ++VG I    L  N+ +ML  +S  
Sbjct: 119 KAISFDFGKLNPLSGLKRMFSTHVLAELFKAILKAVIVGCITYWFLLHNWNSMLHLVSEP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               +  A          +++ +  +   D+ W       +L+MSKQEI+DE K+  G+P
Sbjct: 179 MGIAIKDALNIAFLCCFWVIMGLFPMVAFDVAWQIWSHIKRLRMSKQEIRDEYKEHEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R +   R+  + +MM    +A +I+TNPTHYA+AL+Y + + +AP ++AKG + +A
Sbjct: 239 HIKGRIRQQQRAMAQRRMMADVPKADVIVTNPTHYAVALKYDEKKMNAPKVLAKGADRVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +++R++  E+ +PI E P LAR+L++   I   IP   Y AVA+++  +Y  K
Sbjct: 299 QRIRELGAENRVPILEAPPLARALYRHTEIGQQIPAGLYAAVAEVLSWVYQLK 351


>gi|295678071|ref|YP_003606595.1| flagellar biosynthetic protein FlhB [Burkholderia sp. CCGE1002]
 gi|295437914|gb|ADG17084.1| flagellar biosynthetic protein FlhB [Burkholderia sp. CCGE1002]
          Length = 411

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 96/353 (27%), Positives = 180/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   KTE+ + ++++ A  EG    SRE S F+ + A    +          + +
Sbjct: 1   MAE-DSDLEKTESATPRRLQKAREEGQIVRSRELSTFALLAAGFYGVWGMSGNIGEHLQN 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L       + D + ++             ++P L +  +  + + +      L+ 
Sbjct: 60  MVRASLM-FNHASVFDTNRMLIGAGTAGREGLYALVPVLGVTGLAALLAPMALGGWQLSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F R++  EG  R++SIN  +    S  K ++VG I   ++   +   L   +  
Sbjct: 119 KGLEPKFNRLNPIEGFGRMFSINGPIQLGMSLAKTLVVGLIGGTAIWNRHEQFLALATQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            +  L ++   +     M +  +  +  LD+ +    ++ KL+M+K+E+K E ++S G+P
Sbjct: 179 LNVALANSMHLIAVCCGMTVAGMFAVAALDVPYQLWSYHKKLRMTKEEVKREHRESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK + +   R+  R +MM    +A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A
Sbjct: 239 HIKGKIRQQQRAIARRRMMAQVPKADVVVTNPTHFAVALQYTDGEMRAPKVVAKGVNLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+IA E+N+P+ E P LAR+L+  V +N  IP   Y AVA+++  +Y  +
Sbjct: 299 ARIREIATENNVPLLEAPPLARALYHNVDLNREIPGPLYGAVAEVLAWVYQLR 351


>gi|209522058|ref|ZP_03270713.1| flagellar biosynthetic protein FlhB [Burkholderia sp. H160]
 gi|209497504|gb|EDZ97704.1| flagellar biosynthetic protein FlhB [Burkholderia sp. H160]
          Length = 411

 Score =  373 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 99/353 (28%), Positives = 181/353 (51%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+  D+   KTE+ + ++++ A  EG    SRE S F+ + A    +            +
Sbjct: 1   MA-GDSDLEKTESATPRRLQKAREEGQVARSRELSTFALLAAGFYGVWGMSGSIGDHFQN 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L +       D S ++      S      ++P L L  +  + + +     +L+ 
Sbjct: 60  MLRASL-TFNHASTFDTSRMLIGAGAASREGLYALLPILALTGLAALLAPMALGGWLLST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F R++  EG+ R++SIN  +    S  K ++VG I   ++   +   L   +  
Sbjct: 119 KALEPKFSRLNPIEGLSRMFSINGPIQLGMSLAKTLVVGLIGGTAIWNRHEQFLALATQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            +  L ++   +     M +  +  L  LD+ +    ++ KL+M+K+E+K E ++S G+P
Sbjct: 179 LNLALANSVHLIAVCCGMTVAGMFVLAALDVPYQLWTFHKKLRMTKEEVKREHRESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK + +   R+  R +MM    +A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A
Sbjct: 239 HIKGKIRQQQRAIARRRMMAQVPKADVVVTNPTHFAVALQYTDGEMRAPKVVAKGVNLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A E+N+P+ E P LAR+L+  V +N  IP   Y AVA+++  +Y  +
Sbjct: 299 ARIRELAAENNVPLLEAPPLARALYHNVDLNREIPGPLYGAVAEVLAWVYQLR 351


>gi|78064847|ref|YP_367616.1| flagellar biosynthesis protein FlhB [Burkholderia sp. 383]
 gi|77965592|gb|ABB06972.1| Flagellar biosynthetic protein FlhB [Burkholderia sp. 383]
          Length = 398

 Score =  373 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 99/353 (28%), Positives = 178/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++  +  +KTEA + ++ E A  EG    SRE + F+ + A          P    + +
Sbjct: 1   MADE-SDLDKTEAATPRRREKAREEGQVARSRELASFALLAAGFYGAWLLAGPSGGHLQA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L     +  +    D + ++      SL     ++P L L  +  + + +     +++ 
Sbjct: 60  MLRGAF-TFDRATAFDTNRMLSAAGSASLEGFAALLPILALTGVAALLAPMALGGWLISS 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
              +  F R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +  
Sbjct: 119 KTFELKFDRLNPISGLGRIFSIQGPIQLGMSLAKTLVVGGIGGIAIWRSKDELLGLATQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               L  A   V       +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P
Sbjct: 179 LGVALPDALHLVAVCCGTTVAGMLVVAALDVPYQIWQYNKKLRMTKEEVKREHRENEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM A  +A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A
Sbjct: 239 HVKGRIRQQQRAIARRRMMAAVPKADVVVTNPTHFAVALQYTDGEMRAPKVVAKGVNLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EHN+P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 299 ARIRELAAEHNVPLLEAPPLARALYHNVELEREIPGSLYSAVAEVLAWVYQLK 351


>gi|114562373|ref|YP_749886.1| flagellar biosynthesis protein FlhB [Shewanella frigidimarina NCIMB
           400]
 gi|114333666|gb|ABI71048.1| flagellar biosynthetic protein FlhB [Shewanella frigidimarina NCIMB
           400]
          Length = 377

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 84/353 (23%), Positives = 172/353 (48%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+D+   +TE P+SK++E +  +G    S+E    + +LA  +           S+ +
Sbjct: 1   MAESDSGQERTEDPTSKRLEQSREKGQVARSKELGTAAVLLAASVGFSMTGPAIAKSLYN 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  +  S  + ++ D + +  +   +    +  +I  + L         ++      ++
Sbjct: 61  IMKQIF-SMERDQIFDTNSMFRVWGVVGSELAGPLISFIALLAFVSFLGNIVLGGMSFSV 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   +++   G KR++    LV   K   K  +V       L   ++ +L   S +
Sbjct: 120 KAFMPKGSKLNPMNGFKRMFGTQALVELTKGIAKFSVVALSAYFLLKFYFYDILTLSSDH 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               +YHA   +  + I++   +  + ++D+ +       +LKM+KQE+KDE K + G P
Sbjct: 180 LPGNVYHALDLLIWMFILLCSSMLLIVIIDVPFQIWNHKKQLKMTKQEVKDEYKDTEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + +   + +MM     A +I+ NP HYA+A++Y  + + AP L+AKG + +A
Sbjct: 240 EVKGRIRQMQQEMAQRRMMTEVPNADVIVVNPEHYAVAVKYDVSRSSAPFLIAKGVDDVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+IA EHN+ I   P LAR+++    ++  +P   + AVAQ++  ++  +
Sbjct: 300 FRIREIAREHNVAIVSAPPLARAIYHTTKVDQQVPEGLFTAVAQVLAYVFQLR 352


>gi|296101781|ref|YP_003611927.1| flagellar biosynthesis protein FlhB [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295056240|gb|ADF60978.1| flagellar biosynthesis protein FlhB [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 382

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 102/353 (28%), Positives = 187/353 (52%), Gaps = 3/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E +    KTEAP+  ++E A  EG  P SRE +    ++  +  + +        +  
Sbjct: 1   MAEENDD--KTEAPTPHRLEKAREEGQIPRSRELTSLLILIVGVCIIWWGGESLARKLAG 58

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L       + D + I+  +  L   A   ++P +   ++  + S ++    V + 
Sbjct: 59  MLSAGLR-FDHSMVNDPNLILSQIIQLIKGAMVALLPLITGVVLVALISPVMLGGLVFST 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GI +++S       +K+ +K  L+G+     L  N+  M+  IS +
Sbjct: 118 KSLQPKFSKLNPLSGIAKMFSAQTGAELLKAILKAALMGSAAGFYLWHNWPEMMRLISES 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + +A   V    ++++L I  +   D+ +  +  + KL+MS+Q+I+DE KQ  G+P
Sbjct: 178 PLTAMSNALNLVGLCALLVVLSIIPMVGFDVIFQLYSHFKKLRMSRQDIRDEYKQMEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R+  R +MME   +A +I+TNPTHY++AL+Y + +  AP +VAKG  LIA
Sbjct: 238 HVKGRIRQMQRAAARRRMMEDVPKADVIVTNPTHYSVALQYDENKMSAPKVVAKGAGLIA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  E+ +PI E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 298 LRIREIGTENRVPILEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|302878260|ref|YP_003846824.1| flagellar biosynthetic protein FlhB [Gallionella capsiferriformans
           ES-2]
 gi|302581049|gb|ADL55060.1| flagellar biosynthetic protein FlhB [Gallionella capsiferriformans
           ES-2]
          Length = 379

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 115/353 (32%), Positives = 186/353 (52%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   KTE PS ++++ A  +G    S E S FS +LA    L F  +     +  
Sbjct: 1   MAE-DSDLEKTEQPSQRRLDQAKEKGQVARSTELSTFSILLAGGATLWFMGASLNAHMVR 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            LH  L    Q  +     ++  L  LS+       P LL+ ++  +G+ LI    + + 
Sbjct: 60  LLHDALI-FNQDVVFKPELMIPRLYDLSMDMLITFAPVLLMMLITALGAPLILNGWLFST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++   GI RI S N+LV  +K+  K  +VG + T  +  +   ++   S +
Sbjct: 119 EALVPQFSRMNPITGIGRIISTNSLVELVKALGKATIVGGVATWVIWHHRDDVIQLASLS 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             + +    + V    + I+  +  +  +D+ +       KL M+K+EI+ E K++ GNP
Sbjct: 179 VTTAISQTGYLVCGSFLAIVSGMLLIVAIDVPFQLWSHNKKLMMTKEEIRQESKETDGNP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +S+ R   R +MM A   A +++TNPTHY++AL+Y      APV+VAKG +LIA
Sbjct: 239 EVKGRIRSMQREAARRRMMSAIPTADVVVTNPTHYSVALKYSDKGMSAPVVVAKGSHLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+IA E+N+PI E P LAR+L K   I  AIP   Y AVA+++  +Y  K
Sbjct: 299 HRIREIAQENNVPILEAPPLARALHKHTEIGDAIPEALYTAVAEVLAYVYQLK 351


>gi|294140216|ref|YP_003556194.1| flagellar biosynthetic protein FlhB [Shewanella violacea DSS12]
 gi|293326685|dbj|BAJ01416.1| flagellar biosynthetic protein FlhB [Shewanella violacea DSS12]
          Length = 377

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 85/353 (24%), Positives = 171/353 (48%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+END+   KTE  + +++E A  +G    S+E    + +++  +           S+ +
Sbjct: 1   MAENDSSQEKTEEATPRRLEQAREKGQVARSKELGTSAVLVSAAVGFAMVGPSIAGSLVT 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L  +  + ++ D + +V + + +    +  +   +LL  +      ++      + 
Sbjct: 61  IMTTLF-TMDREQVFDTNQMVLIWSMIGRELAFPMASLMLLIALVAFIGNIVLGGITFST 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   +++   G KR++ +  LV   K   K ++V       L+  +  +L     +
Sbjct: 120 KAFMPKTDKMNPMAGFKRMFGVQALVELTKGIAKFLVVALSAYFLLSFFFDEILALSRDH 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               +YHA   +  + I++      + V+D+ +       +LKM+KQE+KDE K + G P
Sbjct: 180 LPGNVYHALDLLVWMFILLCSSTILIVVIDVPFQVWNHNKQLKMTKQEVKDEYKDTEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + + R   + +MM     A +I+ NP HYA+A++Y   ++ AP ++AKG + +A
Sbjct: 240 EVKGKIRQMQREIAQKRMMSEVPNADVIVVNPEHYAVAVKYDAMKSTAPYVLAKGVDEVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA EH I I   P LAR+++    I+  IP   + AVAQ++  ++  +
Sbjct: 300 FKIREIAREHEIAIVSAPPLARAIYHTTKIDQEIPEGLFTAVAQVLAYVFQLR 352


>gi|83647843|ref|YP_436278.1| flagellar biosynthesis protein FlhB [Hahella chejuensis KCTC 2396]
 gi|83635886|gb|ABC31853.1| Flagellar biosynthesis pathway, component FlhB [Hahella chejuensis
           KCTC 2396]
          Length = 378

 Score =  372 bits (955), Expect = e-101,   Method: Composition-based stats.
 Identities = 98/353 (27%), Positives = 183/353 (51%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+END    KTE P+ +KIE A  EG  P SRE +  + +LA  + LL F +    ++  
Sbjct: 1   MAENDTSQEKTEEPTPRKIEKAREEGQIPRSRELNTTAVLLAGAVGLLVFGTTIGKALEG 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
                  + T+ ++ D    +  L   +L  +  ++P +L+ ++  +   +     +++ 
Sbjct: 61  VFRASF-TLTREEVFDAHQPMIHLGMAALDMAISLVPFMLVLLVASLLGPIALGGWMMSA 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P F R++  EG+KR++S+ +L+   K   K ++VG +  I L  +   +L   S +
Sbjct: 120 KAAAPKFSRINPLEGLKRMFSLKSLMELFKGVAKTLVVGGVALIILNYSIPDLLAMGSED 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + HA   +    + +   +  + ++D+ +  +     L+M+ QEIKDE K + G P
Sbjct: 180 TMVSMAHACSLLAWSFLFLASSMILIALVDVPFQIYDNQKNLRMTMQEIKDEYKDTEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + +     R +M++   +A ++ITNPTHY++AL+Y   +  AP+++AKG + +A
Sbjct: 240 EVKRRVREVQYEMSRRRMLQDVPKADVVITNPTHYSVALKYDAKKMAAPIVLAKGADHMA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA  H I +   P L RS++    +   IP   Y AVAQ++  ++  +
Sbjct: 300 MKIREIANAHKIELVSAPPLTRSIYHHTEVGEEIPSGLYLAVAQVLAYVFQLR 352


>gi|157376185|ref|YP_001474785.1| flagellar biosynthesis protein FlhB [Shewanella sediminis HAW-EB3]
 gi|157318559|gb|ABV37657.1| flagellar biosynthetic protein FlhB [Shewanella sediminis HAW-EB3]
          Length = 377

 Score =  371 bits (954), Expect = e-101,   Method: Composition-based stats.
 Identities = 82/353 (23%), Positives = 167/353 (47%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+END+   KTE  + ++ E +  +G    S+E    + ++A  +           ++ +
Sbjct: 1   MAENDSSQEKTEEATPRRREQSREKGQVARSKELGTSAVLMAAAVGFAMTGPSIAKALYN 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  +L +  + ++ D + +  +   +    +  ++  + +  +      ++      + 
Sbjct: 61  IM-EMLFTLDRTQIFDTNALFLIWPVIGQQLAFPMLSFIAILTLMAFLGNIVLGGITFST 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   +++   G KR++ +  LV   K   K  +V       L+  +  +L     +
Sbjct: 120 KAFMPKTDKMNPINGFKRMFGVQALVELTKGIAKFSVVALSAYFLLSYYFNDILALSRDH 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               +YHA   +  + I++      + V+D+ +       +LKM+KQEIKDE K + G P
Sbjct: 180 LPGNVYHALDLLIWMFIILCSSTIIIVVIDVPFQIWNHNKQLKMTKQEIKDEYKDTEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + + R   + +MM     A +I+ NP HYA+A++Y   +  AP ++AKG + +A
Sbjct: 240 EVKGKVRQMQREMAQRRMMGEVPNADVIVVNPDHYAVAVKYDAMKATAPFVLAKGVDEVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA EH I I   P LAR+++    I+  IP   + AVAQ++  ++  +
Sbjct: 300 FKIREIAREHEIAIVSAPPLARAIYHTTKIDQEIPEGLFTAVAQVLAYVFQLR 352


>gi|33601532|ref|NP_889092.1| flagellar biosynthesis protein FlhB [Bordetella bronchiseptica
           RB50]
 gi|33575968|emb|CAE33047.1| flagellar biosynthetic protein FlhB [Bordetella bronchiseptica
           RB50]
          Length = 384

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 108/353 (30%), Positives = 180/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  +   K+EA S +++E A  EG    SRE   F  + A +  +    S     +T 
Sbjct: 1   MAEE-SDLEKSEAASPRRLEKAREEGQIARSRELGTFMMLAAGVAGVWLSGSMLYQGLTG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L     R  +D   +V    H +  A   V+P   +  +  + S ++    V + 
Sbjct: 60  VLRRGLG-FEPRVAQDPGVMVEQAVHGAGRALLTVLPMFGMLAVVAVLSAVLLGGFVFST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P+F ++SL  GIKR++S   +V  +K+  K  LVG +    +   +  ML  +   
Sbjct: 119 KPLEPNFSKLSLWSGIKRMFSAQTVVELVKALAKAALVGGVAVWVIWHYHDDMLGLMHVA 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + L  A   V     +I+  +  + +LD+ W       KL+M+K++++ E K+S G+P
Sbjct: 179 PSAALTSAMSLVALCSALIVGSLLFVVLLDVPWQIWNHLKKLRMTKEDVRQEHKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM     A +++TNPTHYA+AL+Y   E  AP +VAKG  LIA
Sbjct: 239 HVKGRIRQQQRAMARRRMMSEVPGADVVVTNPTHYAVALKYADGEAGAPRVVAKGTGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EH IP  E P LAR+L + V +   IP   Y AVA+++  ++  +
Sbjct: 299 ARIRELAAEHRIPTLEAPPLARALHQHVELGQEIPTALYTAVAEVLAWVFQLR 351


>gi|163750537|ref|ZP_02157775.1| flagellar biosynthesis protein [Shewanella benthica KT99]
 gi|161329692|gb|EDQ00681.1| flagellar biosynthesis protein [Shewanella benthica KT99]
          Length = 377

 Score =  369 bits (949), Expect = e-100,   Method: Composition-based stats.
 Identities = 86/353 (24%), Positives = 175/353 (49%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+END+   KTE  + +++E A  +G    S+E    + +++  + L         S+ +
Sbjct: 1   MAENDSSQEKTEEATPRRLEQAREKGQVARSKELGTSAVLVSAAVGLAMVGPSIASSLVT 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L     + ++ D + +V +   ++   +  +   +L   +      ++      + 
Sbjct: 61  IMTTLFTQ-DREQIFDTNQMVLVWGMIARELAFPMASLMLFIALVAFIGNILLGGITFST 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P  ++++  +G+KR++ +  LV   K   K ++V +     L+  +  +L     +
Sbjct: 120 KAFMPKTEKMNPMKGLKRMFGVQALVELTKGIAKFLVVASSAYFILSFFFNEILALSRDH 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             S +YHA   +  + I++      + V+D+ +       +LKM+KQEIKDE K + G P
Sbjct: 180 LPSNVYHALDLLVWMFILLCSSTILIVVIDVPFQIWNHNKQLKMTKQEIKDEYKDTEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + + R   + +MM     A +I+ NP HYA+A++Y   ++ AP ++AKG + +A
Sbjct: 240 EVKGKIRQMQREVAQRRMMAEVPSADVIVVNPEHYAVAVKYDAMKSTAPYVLAKGVDEVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA EH I I   P LAR+++    I+  IP   + A+AQ++  ++  +
Sbjct: 300 FKIREIAREHEIAIISAPPLARAIYHTTKIDQEIPEGLFTAIAQVLAYVFQLR 352


>gi|33596133|ref|NP_883776.1| flagellar biosynthesis protein FlhB [Bordetella parapertussis
           12822]
 gi|33573136|emb|CAE36781.1| flagellar biosynthetic protein FlhB [Bordetella parapertussis]
          Length = 384

 Score =  369 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 107/353 (30%), Positives = 180/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  +   K+EA S +++E A  EG    SRE   F  + A ++ +    S     +T 
Sbjct: 1   MAEE-SDLEKSEAASPRRLEKAREEGQIARSRELGTFMMLAAGVVGVWLSGSMLYQGLTG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L     R  +D   +V    H +  A   V+P   +  +  + S ++    V + 
Sbjct: 60  VLRRGLG-FEPRVAQDPGVMVEQAVHGAGRALLTVLPMFGMLAVVAVLSAVLLGGFVFST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P+F ++SL  GIKR++S   +V  +K+  K  LVG +    +   +  ML  +   
Sbjct: 119 KPLEPNFSKLSLWSGIKRMFSAQTVVELVKALAKAALVGGVAVWVIWHYHDDMLGLMHVA 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + L  A   V     +I+  +  + +LD+ W       KL+M+K++++ E K+S G+P
Sbjct: 179 PSAALTSAMSLVALCSALIVGSLLFVVLLDVPWQIWNHLKKLRMTKEDVRQEHKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM     A +++TNPTHYA+AL+Y      AP +VAKG  LIA
Sbjct: 239 HVKGRIRQQQRAMARRRMMSEVPGADVVVTNPTHYAVALKYADGAAGAPRVVAKGTGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EH IP  E P LAR+L + V +   IP   Y AVA+++  ++  +
Sbjct: 299 ARIRELAAEHRIPTLEAPPLARALHQHVELGQEIPTALYTAVAEVLAWVFQLR 351


>gi|114320141|ref|YP_741824.1| flagellar biosynthetic protein FlhB [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114226535|gb|ABI56334.1| flagellar biosynthetic protein FlhB [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 390

 Score =  369 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 99/354 (27%), Positives = 173/354 (48%), Gaps = 2/354 (0%)

Query: 1   MSEN-DAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVT 59
           M+E  +    KTE P+ K+++DA  +G  P SRE +    +L   + +L F       + 
Sbjct: 1   MAEESENGQEKTEQPTPKRLQDAKKKGQIPRSRELTTTLLMLFAALGMLMFGGYMGEGIV 60

Query: 60  SDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLN 119
             L        + ++ D    +  +         +V P + L M+  +   +       +
Sbjct: 61  GLLEWSF-QPGREQIFDPKEPIARVHEALGRGLLIVAPFVGLMMLVALIGPVALGGWTFS 119

Query: 120 LNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISA 179
              + P  ++++  +GIKRI+    L+   K   KI++VG +  +        +     A
Sbjct: 120 AQPMIPKPEKMNPVKGIKRIFGPKALIELAKGIAKILVVGAVAGVFFYLFQDELRSLALA 179

Query: 180 NPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
              S + HA         ++   +  +  +D+ +       KL+M++QE+KDE KQ+ G 
Sbjct: 180 PLQSAMAHAIELFFIAFFVLAASLIIVVAVDVPYQLWDHQKKLRMTRQEVKDEFKQTEGK 239

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLI 299
           P +K + + + R   + +MME    A +++TNPTHYA+AL+Y Q    AP +VA G++ +
Sbjct: 240 PEVKGKIRQLQREAAQRRMMEKVPEADVVVTNPTHYAVALQYDQLRMRAPRVVALGKDQV 299

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A ++R+IA EH IP+FE P LAR+L+    I+  IP   Y AVAQ++  IY  +
Sbjct: 300 ALRIREIAGEHGIPLFEAPPLARALYHTTDIDQEIPAGLYMAVAQVLAYIYQLR 353


>gi|291613025|ref|YP_003523182.1| flagellar biosynthetic protein FlhB [Sideroxydans lithotrophicus
           ES-1]
 gi|291583137|gb|ADE10795.1| flagellar biosynthetic protein FlhB [Sideroxydans lithotrophicus
           ES-1]
          Length = 381

 Score =  369 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 109/353 (30%), Positives = 190/353 (53%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   KTE+PS ++++ A  EG    SRE S F+ ++A    +          + S
Sbjct: 1   MAEQDSDLEKTESPSQRRLDQAREEGQVARSRELSTFAVLMAGGAGIWLMGGMLSQQLIS 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L +           +V  L  LS+S   + +P L L +     S L+    +  L
Sbjct: 61  LIREGL-TLDTGLAFHSELLVPRLHDLSMSTLLVFLPLLGLLLAVAAFSPLLLNGWLFTL 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P+F +++   GI R++S N+L+   K+  K ++VG I  + +  N   +L  +S  
Sbjct: 120 KPLQPNFGKLNPITGIGRMFSTNSLMELAKAIAKAVVVGGIGALVIWHNKNAVLLLVSEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             S + H    V      ++  +  +  +D+ +   +   KLKM+K+E++ E K++ G+P
Sbjct: 180 IASAIPHLGSLVWGSFAAVMGGLLLIVAVDVPFQLWEHNKKLKMTKEEVRQESKETEGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +S+ R   R +MM    +A +++TNPTHY++AL+Y  ++  APV+VAKG +L+A
Sbjct: 240 QVKARVRSMQREMARRRMMAEIPKADVVVTNPTHYSVALKYSDSKMRAPVVVAKGSHLMA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+++IA EHN+PI E P LAR+L K   +  AIP   Y AVA+++  +Y  +
Sbjct: 300 AKIKEIAKEHNVPILEAPPLARALHKHCELGEAIPEALYTAVAEVLAYVYQLR 352


>gi|296157469|ref|ZP_06840304.1| flagellar biosynthetic protein FlhB [Burkholderia sp. Ch1-1]
 gi|295892241|gb|EFG72024.1| flagellar biosynthetic protein FlhB [Burkholderia sp. Ch1-1]
          Length = 406

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 97/353 (27%), Positives = 176/353 (49%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   KTE+ + ++++ A  EG    SRE S F+ + A    +          +  
Sbjct: 1   MAE-DSDLEKTESATPRRLQKAREEGQIVRSRELSTFALLAAGFFGVWGMSGSIGEHLQG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L     +       +   ++      S      ++P L       + + +      L+ 
Sbjct: 60  MLRAAF-TFDHAGAFETRRMLIGAGVASREGLYALLPILAFTGAAALFAPMALGGWQLSS 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F R++   G+ +++SIN  +    S VK ++VG I   ++      +L   +  
Sbjct: 119 KGLEPKFDRLNPIAGLGKMFSINGPIQLGLSLVKTLVVGVIGGTAIWNRREEILALATQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               L +    +     M +  +  +  LD+ +   Q++ KL+MSK+E+K E ++S G+P
Sbjct: 179 LQLALANTVHLIAVCCGMTVAGMFVVAALDVPYQLWQFHKKLRMSKEEVKREHRESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A
Sbjct: 239 HVKGRIRQQQRAIARRRMMTNVPKADVVVTNPTHFAVALQYTDGEMRAPKVVAKGVNLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+IA E+N+P+ E P LAR+L+  V +N  IP   Y AVA+++  +Y  +
Sbjct: 299 ARIREIAAENNVPLLEAPPLARALYHNVELNREIPGPLYGAVAEVLAWVYQLR 351


>gi|157961202|ref|YP_001501236.1| flagellar biosynthesis protein FlhB [Shewanella pealeana ATCC
           700345]
 gi|157846202|gb|ABV86701.1| flagellar biosynthetic protein FlhB [Shewanella pealeana ATCC
           700345]
          Length = 377

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 84/353 (23%), Positives = 176/353 (49%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+END+   KTE  +S+K++ A ++G    S++    + ++A  + LL        ++ +
Sbjct: 1   MAENDSSQEKTEEATSRKLQQAKDKGQVARSKDLGTSAVLIAASVGLLMTGPNIAQAMFN 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            ++ +  + ++ ++ D + ++ +   +    +  ++  ++   +      +       ++
Sbjct: 61  IMNKMY-TLSRDEIFDTNQMMNVWGVVGSELAFPLLGFIVFLALIAFAGNIALGGISFSV 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           +   P   ++S   G KR++ +  +V   K   K  +V     + L+     +L     +
Sbjct: 120 SAFMPKASKMSPVAGFKRMFGVQAVVELAKGIAKFSVVAITAYLLLSIYLNDILLLSQEH 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               +YHA   +  + I++      + ++D+ +       +LKM+KQEIKDE K + G P
Sbjct: 180 LPGNIYHALDLIVWIFILLCASTLLIVMIDVPFQIWNHAKQLKMTKQEIKDEYKDTEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM     A +I+ NP HYA+A++Y    + AP +VAKG + +A
Sbjct: 240 EVKGRIRQLQREMAQRRMMGEVPNADVIVVNPEHYAVAVKYDAGRSTAPFVVAKGVDEVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA EH++ I   P LAR+++    I+  IP   + AVAQ++  ++  +
Sbjct: 300 FKIREIAREHDVAIVSAPPLARAIYHTTKIDQEIPEGLFTAVAQVLAYVFQLR 352


>gi|187925774|ref|YP_001897416.1| flagellar biosynthesis protein FlhB [Burkholderia phytofirmans
           PsJN]
 gi|187716968|gb|ACD18192.1| flagellar biosynthetic protein FlhB [Burkholderia phytofirmans
           PsJN]
          Length = 403

 Score =  368 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 96/353 (27%), Positives = 176/353 (49%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   KTE+ + ++++ A  EG    SRE S F+ + A    +          +  
Sbjct: 1   MAE-DSDLEKTESATPRRLQKAREEGQIVRSRELSTFALLAAGFFGVWGMSGSIGEHLQG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L     S       +   ++      S      ++P L    +  + + +      L+ 
Sbjct: 60  MLRAAF-SFDHAGAFETRRMMIGAGVASREGLYALLPILAFTGVAALFAPMALGGWQLSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F R++   G+ +++SIN  +    S  K ++VG I   ++      +L      
Sbjct: 119 KGLEPKFDRLNPIAGLGKMFSINGPIQLGMSLAKTLVVGVIGGTAIWNRREEILALAMQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            H  L +    +     M +  +  +  +D+ +   Q++ KL+M+K+E+K E ++S G+P
Sbjct: 179 LHLALANTVHLIAVCCGMTVAGMFVVAAMDVPYQLWQFHKKLRMTKEEVKREHRESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A
Sbjct: 239 HVKGRIRQQQRAIARRRMMTNVPKADVVVTNPTHFAVALQYTDGEMRAPKVVAKGVNLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+IA E+N+P+ E P LAR+L+  V +N  IP   Y AVA+++  +Y  +
Sbjct: 299 ARIREIAAENNVPLLEAPPLARALYHNVELNREIPGPLYGAVAEVLAWVYQLR 351


>gi|253688980|ref|YP_003018170.1| flagellar biosynthetic protein FlhB [Pectobacterium carotovorum
           subsp. carotovorum PC1]
 gi|251755558|gb|ACT13634.1| flagellar biosynthetic protein FlhB [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 383

 Score =  368 bits (944), Expect = e-100,   Method: Composition-based stats.
 Identities = 113/353 (32%), Positives = 189/353 (53%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++ D+   KTEAP+ +K E A  EG  P SRE +    ++A L  L          +  
Sbjct: 1   MAD-DSDLEKTEAPTPQKEEKAREEGQIPRSRELTSVLMMVAGLAILWIGGDAMAGRLAR 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L +     + D + ++  +  L   A+  +IP +   ++  + + L+    + + 
Sbjct: 60  IVSQSL-NFDYATIGDDTQMLRHVGSLLRQAASALIPIMFGAVLVALSAPLLLGGVLFST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K +FK++    G+KR++S  +L    K+ +K ++VG I T+ L  N+  +L  IS +
Sbjct: 119 KSLKVNFKKLDPISGLKRLFSAQSLAELFKAILKSVMVGIISTLFLIHNWPKILHLISES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P S L  A         +I++ +  +   D+ W       KL+MSKQEI+DE KQS G+P
Sbjct: 179 PISALGDALELAVMCGFLIIMGLIPMVAFDVFWQVWSHIKKLRMSKQEIRDEHKQSEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  + +MM    +A +I+TNPTHYA+ALRY + + +AP ++AKG   IA
Sbjct: 239 HVKGRIRQQQRAIAQRRMMADVPKADVIVTNPTHYAVALRYDEKKMNAPKVLAKGAGEIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++  EH +PI E P LAR+LF+   I   IP   Y AVA+++  +Y  K
Sbjct: 299 LRIRELGTEHRVPILEAPPLARALFRHSEIGEHIPAALYAAVAEVLAWVYQLK 351


>gi|91792697|ref|YP_562348.1| flagellar biosynthesis protein FlhB [Shewanella denitrificans
           OS217]
 gi|91714699|gb|ABE54625.1| flagellar biosynthetic protein FlhB [Shewanella denitrificans
           OS217]
          Length = 377

 Score =  368 bits (944), Expect = e-99,   Method: Composition-based stats.
 Identities = 83/353 (23%), Positives = 171/353 (48%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+END+   KTE P+ +++E A  +G    S+E    + +LA  +  +        S+  
Sbjct: 1   MAENDSSQEKTEEPTGRRLEQAREKGQIARSKELGTAAVLLASSVGFMMTGPALAKSLFR 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  +L +  + ++ D + +  +   +    +  ++  + +  +      ++      ++
Sbjct: 61  IMEQIL-TMERAQIFDTNSMFRVWGVIGTELAIPLLSFIGMLAVVSFLGNIVLGGINFSV 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   +++   G KR++    LV   K   K  +V       L   +  +L   + +
Sbjct: 120 KAFMPKGSKMNPMSGFKRMFGTQALVELTKGIAKFSVVAFSAYFLLDFYFVDILQLSNDH 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             +  YHA   +  + I++      + ++D+ +       +LKM+KQEIKDE K + G P
Sbjct: 180 LPNNAYHALDLLVWMFILLCSSTLLIVIIDVPFQIWNHNKQLKMTKQEIKDEYKDTEGQP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM    +A +I+ NP HYA+A++Y  + + AP +VAKG + +A
Sbjct: 240 EVKARVRQMQREMAQKRMMAEVPKADVIVVNPEHYAVAVKYDASRSTAPFVVAKGIDEVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R IA EH++ I   P LAR+++    ++  +P   + AVAQ++  ++  +
Sbjct: 300 FQIRAIAREHDVAIVSAPPLARAIYHTTKLDQQVPEGLFTAVAQVLAYVFQLR 352


>gi|307731376|ref|YP_003908600.1| flagellar biosynthetic protein FlhB [Burkholderia sp. CCGE1003]
 gi|307585911|gb|ADN59309.1| flagellar biosynthetic protein FlhB [Burkholderia sp. CCGE1003]
          Length = 401

 Score =  367 bits (943), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 99/353 (28%), Positives = 178/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  +   KTE+ + +++E A  EG    SRE S F+ + A    +          +  
Sbjct: 1   MAEE-SDLEKTESATPRRLEKAREEGQIARSRELSTFALLAAGFFGVWAMSGSIGQHLQD 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L     +     + +   ++      S      ++P L L     + + +      L+ 
Sbjct: 60  MLRTAF-TFDHATVFETRRMMTGAGTASREGLYALLPILALTGAAALLAPMALGGWQLST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F R++   G+ +I+SIN  V  + S  K ++VG I   ++      +L   +  
Sbjct: 119 KGLEPKFDRLNPIAGLGKIFSINGPVQLVMSIAKTLVVGIIGGTAIWNRREEILALSTQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            H  L +    +     M +  +  +  LD+ +   Q++ KL+MSK+E+K E ++S G+P
Sbjct: 179 LHLALANTVHLIAVCCAMTVAGMFVVAALDVPYQLWQFHKKLRMSKEEVKREHRESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A
Sbjct: 239 HVKGRIRQQQRAIARRRMMTQVPKADVVVTNPTHFAVALQYTDGEMRAPKVVAKGVNLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A E+N+P+ E P LAR+L+  V +N  IP   Y AVA+++  +Y  +
Sbjct: 299 ARIRELAAENNVPLLEAPPLARALYHNVELNREIPGQLYGAVAEVLAWVYQLR 351


>gi|91785647|ref|YP_560853.1| flagellar biosynthesis protein FlhB [Burkholderia xenovorans LB400]
 gi|91689601|gb|ABE32801.1| Flagellar biosynthetic protein FlhB [Burkholderia xenovorans LB400]
          Length = 406

 Score =  367 bits (943), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 96/353 (27%), Positives = 175/353 (49%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  +   KTE+ + ++++ A  EG    SRE S F+ + A    +          +  
Sbjct: 1   MAEE-SDLEKTESATPRRLQKAREEGQIVRSRELSTFALLAAGFFGVWGMSGSIGEHLQG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L     +       +   ++      S      ++P L       + + +      L+ 
Sbjct: 60  MLRAAF-TFDHAGAFETRRMLIGAGVASREGLYALLPILAFTGAAALFAPMALGGWQLSS 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F R++   G+ +++SIN  +    S VK ++VG I   ++      +L   +  
Sbjct: 119 KGLEPKFDRLNPIAGLGKMFSINGPIQLGLSLVKTLVVGVIGGTAIWNRREEILALATQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               L +    +     M +  +  +  LD+ +   Q++ KL+MSK+E+K E ++S G+P
Sbjct: 179 LQLALANTVHLIAVCCGMTVAGMFVVAALDVPYQLWQFHKKLRMSKEEVKREHRESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A
Sbjct: 239 HVKGRIRQQQRAIARRRMMTNVPKADVVVTNPTHFAVALQYTDGEMRAPKVVAKGVNLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+IA E+N+P+ E P LAR+L+  V +N  IP   Y AVA+++  +Y  +
Sbjct: 299 ARIREIAAENNVPLLEAPPLARALYHNVELNREIPGPLYGAVAEVLAWVYQLR 351


>gi|332284010|ref|YP_004415921.1| flagellar biosynthesis protein FlhB [Pusillimonas sp. T7-7]
 gi|330427963|gb|AEC19297.1| flagellar biosynthesis protein FlhB [Pusillimonas sp. T7-7]
          Length = 386

 Score =  367 bits (943), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 100/353 (28%), Positives = 178/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   KTE  S +++E A  EG    SRE + F  + A +  L    +     +T 
Sbjct: 1   MAE-DSDLEKTEPASPRRLEKAREEGQVARSRELNTFLLLAAGVATLWLSGAGLYEGLTD 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L     R   D   +V L    +L A   ++P   + +   I + +     +L+ 
Sbjct: 60  ILRAGL-WFDLRVGRDTDVMVALAATSALEAILTLLPLFGVLVAVAILASVALGGFLLSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F+R++  +G+ R++S   LV  +K+  K  ++G +  + ++     M+  + A 
Sbjct: 119 KALEPKFERLNPLKGMGRMFSAQTLVELIKTLAKASVIGIVAVMVMSHYLDQMISLMHAT 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               L      V     +I+  +  + ++D  W  +  Y K++MS++++K E K+S G+P
Sbjct: 179 VSEALTRGIGLVALCCALIVGGLILIVLIDAPWQIYSHYKKMRMSREDVKQEHKESDGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM     A +I+TNPTHYA+AL Y   +  AP +VAKG  L+A
Sbjct: 239 HVKGRIRQQQRAMARRRMMSEVPNADVIVTNPTHYAVALSYKDGQAGAPRVVAKGSGLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EH +P+   P LAR+L   V +   IP   Y AVA+++  ++  +
Sbjct: 299 ARIREVAQEHKVPMLSAPPLARALHHHVELGKEIPGDLYAAVAEVLAWVFQLR 351


>gi|227112512|ref|ZP_03826168.1| flagellar biosynthesis protein FlhB [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 383

 Score =  367 bits (942), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 111/353 (31%), Positives = 186/353 (52%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   KTEAP+ +K E A  EG  P SRE +    ++A L  L          +  
Sbjct: 1   MAE-DSDLEKTEAPTPQKEEKAREEGQIPRSRELTSVLMMVAGLAILWMGGEAMAGRLAR 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L +     + D + ++  +  L   A   +IP LL  ++  + + L+    + + 
Sbjct: 60  IVSQSL-NFDYATIGDDTQMLRHVGSLLRQAVSALIPILLGAVLVALSAPLLLGGILFST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K  FK++    G+KR++S  +L    K+ +K ++VG I T  L  N+  +L  +S  
Sbjct: 119 KSLKVDFKKLDPISGLKRLFSAQSLAELFKAILKSVMVGIISTFFLIHNWPKILHLVSEA 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + +  A         +I++ +  +   D+ W       KL+MSKQEI+DE KQ+ G+P
Sbjct: 179 PITAMGDALELAVMCGFLIIMGLIPMVAFDVFWQVWSHIKKLRMSKQEIRDEHKQNEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  + +MM    +A +I+TNPTHYA+ALRY + + +AP ++AKG   IA
Sbjct: 239 HVKGRIRQQQRAIAQRRMMADVPKADVIVTNPTHYAVALRYDEKKMNAPRVLAKGAGEIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++  EH +PI E P LAR+LF+   +   IP   Y AVA+++  +Y  K
Sbjct: 299 LRIRELGAEHRVPILEAPPLARALFRHSEVGQHIPAALYAAVAEVLAWVYQLK 351


>gi|269103165|ref|ZP_06155862.1| flagellar biosynthesis protein FlhB [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268163063|gb|EEZ41559.1| flagellar biosynthesis protein FlhB [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 376

 Score =  367 bits (942), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 92/353 (26%), Positives = 182/353 (51%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++D    +TE  + ++ + A  +G  P SRE +  + ++A  + L++F      ++ +
Sbjct: 1   MADSDD-QERTEDATPRRRQQAQEKGQVPRSRELASVAVLIAGAVGLMWFGGSLGQALAA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L  S T+ ++ D+  +  +++ +    +  +   L+   +              + 
Sbjct: 60  VMSRLF-SLTREEVFDLGAMSTVISEVIWGIAAPLTLVLVFLFVAAFIGAAGLGGVRFSS 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   +++   G KR++ + + V  +KS +K+ LV  +    + ++          +
Sbjct: 119 EAAMPKLSKMNPLSGFKRMFGMQSWVELIKSILKVGLVSGVAYYLMYDSLDDFFQLAQES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             + +YHA  T+   +++I   +  +  +D+ +  +Q+  +LKM+KQEIKDE K++ G P
Sbjct: 179 YPNNIYHALSTLLHFILLISCSLLVVVAIDVPFQIYQFNQQLKMTKQEIKDEYKETEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM    +A +IITNP HY++ALRY    + APV++AKG +  A
Sbjct: 239 EVKGRIRMLQREMAQRRMMADVPQADVIITNPEHYSVALRYDPKLDSAPVVIAKGVDHTA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA EHNI I   P LAR+++    +   IP   + AVAQ++  ++  K
Sbjct: 299 FKIREIAKEHNIDIVPVPPLARAIYHTTELEQQIPDGLFIAVAQVLAYVFQLK 351


>gi|283785619|ref|YP_003365484.1| flagellar biosynthesis protein FlhB [Citrobacter rodentium ICC168]
 gi|282949073|emb|CBG88678.1| flagellar biosynthesis protein FlhB [Citrobacter rodentium ICC168]
          Length = 382

 Score =  366 bits (941), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 102/353 (28%), Positives = 184/353 (52%), Gaps = 3/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE +    KTEAP+  ++E A  EG  P SRE +    +L  +  +          +++
Sbjct: 1   MSEENDD--KTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVCIIWIGGESLARRLSA 58

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L       + D S I+  +  L   A   ++P +   ++  + S ++    + + 
Sbjct: 59  MLSAGLR-FDHSMVNDPSLILGQIILLIKEAMIALLPLITGVVLVALISPVLLGGLIFSG 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S  +    +K+ +K  LVG +  + L   +  M+  ++ +
Sbjct: 118 KSLQPKFSKLNPLPGIKRMFSAQSGAELLKAVLKSTLVGGVTALYLWHKWPQMMRLMAES 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + +  A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P
Sbjct: 178 PITAMGDALDLVGLCALLVVLGVIPMVGFDVIFQIFSHLKKLRMSRQDIRDEFKQSEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R+  R +MM     A +I+TNPTHY++AL+Y + +  AP +VAKG  L+A
Sbjct: 238 HVKGRIRQMQRAAARQRMMSDVPNADVIVTNPTHYSVALQYDENKMSAPKVVAKGAGLVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+I  E+ IP  E P LAR+L++   I   IP   Y AVA+++  +   K
Sbjct: 298 LRIREIGAENKIPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVLQLK 350


>gi|206558545|ref|YP_002229305.1| flagellar biosynthesis protein FlhB [Burkholderia cenocepacia
           J2315]
 gi|198034582|emb|CAR50448.1| flagellar biosynthetic protein FlhB [Burkholderia cenocepacia
           J2315]
          Length = 399

 Score =  366 bits (941), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 99/353 (28%), Positives = 178/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++  +  +KTEA + ++ E A  EG    SRE + F+ + A          P    + +
Sbjct: 1   MADE-SDLDKTEAATPRRREKAREEGQVARSRELASFALLAAGFYGAWLLAGPSGAHLQA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L     +  +    D   ++      SL     ++P L L  +  + + +     +++ 
Sbjct: 60  MLRGAF-TFDRATAFDTHRMLSAAGSASLEGFAALLPLLALTGVAALLAPMALGGWLISQ 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
              +  F R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +  
Sbjct: 119 KTFELKFDRLNPISGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELLGLATQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             + L  A   V       +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P
Sbjct: 179 LGAALPDALHLVAVCCGTTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEVKREHRENEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM A  +A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A
Sbjct: 239 HVKGRIRQQQRAIARRRMMAAVPKADVVVTNPTHFAVALQYTDGEMRAPKVVAKGVNLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EHN+P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 299 ARIRELAAEHNVPLLEAPPLARALYHNVELEREIPGSLYSAVAEVLAWVYQLK 351


>gi|33592472|ref|NP_880116.1| flagellar biosynthesis protein FlhB [Bordetella pertussis Tohama I]
 gi|33572118|emb|CAE41658.1| flagellar biosynthetic protein FlhB [Bordetella pertussis Tohama I]
 gi|332381889|gb|AEE66736.1| flagellar biosynthesis protein FlhB [Bordetella pertussis CS]
          Length = 384

 Score =  366 bits (941), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 106/353 (30%), Positives = 178/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  +   K+EA S +++E A  EG    SRE   F  + A +  +    S     +T 
Sbjct: 1   MAEE-SDLEKSEAASPRRLEKAREEGQIARSRELGTFMMLAAGVAGVWLSGSMLYQGLTG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L     R  +D   +V    H +  A   V+P   +  +  + S ++    V + 
Sbjct: 60  VLRRGLG-FEPRVAQDPGVMVEQAVHGAGRALLTVLPMFGMLAVVAVLSAVLLGGFVFST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P+F ++SL  GIKR++S   +V  +K+  K  LVG +    +   +  ML  +   
Sbjct: 119 KPLEPNFSKLSLWSGIKRMFSAQTVVELVKALAKAALVGGVAVWVIWHYHDDMLGLMHVA 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + L  A   V     +I+  +  + +LD+ W       KL+M+K++++ E K+  G+P
Sbjct: 179 PSAALTSAMSLVALCSALIVGSLLFVVLLDVPWQIWNHLKKLRMTKEDVRQEHKEGEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM     A +++TNPTHYA+AL+Y      AP +VAKG  LIA
Sbjct: 239 HVKGRIRQQQRAMARRRMMSEVPGADVVVTNPTHYAVALKYADGAAGAPRVVAKGTGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EH IP  E P LAR+L + V +   IP   Y AVA+++  ++  +
Sbjct: 299 ARIRELAAEHRIPTLEAPPLARALHQHVELGQEIPTALYTAVAEVLAWVFQLR 351


>gi|91776296|ref|YP_546052.1| flagellar biosynthetic protein FlhB [Methylobacillus flagellatus
           KT]
 gi|91710283|gb|ABE50211.1| flagellar biosynthetic protein FlhB [Methylobacillus flagellatus
           KT]
          Length = 381

 Score =  366 bits (941), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 106/353 (30%), Positives = 189/353 (53%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+  D+   KTE P+ ++IE A  +G+ P SRE S    ++A  + L+   S    ++ S
Sbjct: 1   MA-QDSDLEKTEQPTPRRIEKAREDGDVPRSREFSTCVVLMAGGLGLMMLGSRLNQAMLS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           ++   L   ++    D S ++  +    L       P +LL ++  +G+ ++      + 
Sbjct: 60  NMISSLR-ISREAAFDFSLLLSKIASGVLDLLIAFAPLILLLLVVIVGAPVLVGGWNFSN 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P F +++   GIK ++S N+LV  +K+ +K  LVGT+  + +  ++ T+L   +  
Sbjct: 119 KAFLPKFSKLNPLNGIKNLFSKNSLVELIKAILKAALVGTVSYMVMAHDFDTLLSLPTQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             + +      + K  + I+  +  + ++D+ +    + +KLKM+K+E+K E K+S GNP
Sbjct: 179 LETGIAQVDDILIKGFLFIVSALVLVALIDVPYQRWSYTNKLKMTKEEVKQEAKESDGNP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R +   R   R +MM    +A ++ITNPTHYA+A++Y      AP ++AKG + IA
Sbjct: 239 QIKGRIRQQQREMARRRMMAEIPKADVVITNPTHYAVAIKYDDQSMAAPRVIAKGADDIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA EHN+ I E P LAR+LF    +   IP   Y AVA+++  ++  +
Sbjct: 299 LKIREIAGEHNVAILESPKLARALFAHTELGDEIPQALYAAVAEILAYVFQLR 351


>gi|212634380|ref|YP_002310905.1| flagellar biosynthesis protein FlhB [Shewanella piezotolerans WP3]
 gi|212555864|gb|ACJ28318.1| Flagellar biosynthetic protein FlhB [Shewanella piezotolerans WP3]
          Length = 377

 Score =  366 bits (941), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 88/353 (24%), Positives = 173/353 (49%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+END+   KTE  +S+K++ A ++G    S++    + ++A  + L+    P I     
Sbjct: 1   MAENDSSQEKTEEATSRKLQQAKDKGQVARSKDLGTSAVLIAASVGLVMT-GPSIAKAMH 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L + T+ ++ D   ++ + + +    +  ++  +LL  +      +       + 
Sbjct: 60  TIMTNLFTLTRDEIFDTRQMMNIWSMVGSELAAPLLGFILLLAVIAFAGNVALGGMSFSA 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   ++S   G+KR++ +  +V   K   K  +V     + L      +L     +
Sbjct: 120 KACMPKPSKMSPVAGLKRMFGVQAVVELTKGIAKFSVVAITAYVVLKIYLNDILMLSQDH 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               +YHA   V  + I++      +  +D+ +       +LKM+KQE+KDE K + G P
Sbjct: 180 LPGNIYHALDLVSWIFILLCASTFIIVAIDVPYQIWHHAKQLKMTKQEVKDEYKDTEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + +   + +MM     A +I+ NP HYA+A++Y   ++ AP +VAKG + +A
Sbjct: 240 EVKGRIRQLQQEMAQRRMMGEVPNADVIVVNPEHYAVAVKYDAAKSTAPFVVAKGVDEVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA EH++ I   P LAR+++    I+  IP   + AVAQ++  ++  +
Sbjct: 300 FKIREIAREHDVAIVTAPPLARAIYHTTKIDQEIPEGLFTAVAQVLAYVFQLR 352


>gi|73539437|ref|YP_299804.1| flagellar biosynthesis protein FlhB [Ralstonia eutropha JMP134]
 gi|72122774|gb|AAZ64960.1| Flagellar biosynthetic protein FlhB [Ralstonia eutropha JMP134]
          Length = 380

 Score =  366 bits (940), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 101/353 (28%), Positives = 186/353 (52%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS+  +   KTE  S +++E A  EG    SRE + F  ++  +I L         S+ +
Sbjct: 1   MSDE-SDLEKTEPASPRRLEKAREEGQVVRSRELATFIMLMTGVIGLWTLGGTIGRSLDT 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L         D S ++    ++   +    +P LLLF +  + + L+      + 
Sbjct: 60  VMRQSLR-FEPATAFDTSRMLSRFANVIWESLLAFMPLLLLFGVAAVAAPLLMGGWTFST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P+F R+S   G+ R++S++++   +K+  K +LVG++    +       +  ++A 
Sbjct: 119 KALMPNFGRMSPMSGLGRMFSVHSVAELVKAIAKSLLVGSVGAWVVWHRLPDAIALMNAP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               L H    V +  + ++L +  +  +D+ W + + + KL+MSK+E+K E K+S G+P
Sbjct: 179 VQEALLHMLDMVLRCCVPVVLSLLLVAAIDVPWQFWEHFKKLRMSKEEVKQEFKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R +   R+  R +MM+   +A +++TNPTH+A+ALRY +    AP ++AKG + +A
Sbjct: 239 HIKGRIRQQQRAMARRRMMQEVPKADVVVTNPTHFAVALRYEEGRMSAPRVIAKGTDEVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EH IP+   P LAR+L + V +   IP   Y AVA+++  +Y  K
Sbjct: 299 ARIRELAAEHRIPLMSAPPLARALHRHVDLGQEIPAGLYTAVAEVLAWVYQLK 351


>gi|227328329|ref|ZP_03832353.1| flagellar biosynthesis protein FlhB [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 383

 Score =  366 bits (940), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 111/353 (31%), Positives = 188/353 (53%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   KTEAP+ +K E A  EG  P SRE +    ++A L  L          +  
Sbjct: 1   MAE-DSDLEKTEAPTPQKEEKAREEGQIPRSRELTSVLMMVAGLAILWMGGDAMAGRLAR 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L +     + D + ++  +  L   A+  +IP +L  ++  + + L+    + + 
Sbjct: 60  IVSQSL-NFDYATIGDDTQMLRHVGSLLRQAASALIPIMLGAVLVALSAPLLLGGILFST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K  FK++    G+KR++S  +L    K+ +K ++VG I T+ L  N+  +L  +S  
Sbjct: 119 KSLKVDFKKLDPISGLKRLFSAQSLAELFKAILKSVMVGIISTLFLIHNWPKILHLVSEA 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + +  A         +I++ +  +   D+ W       KL+MSKQEI+DE KQS G+P
Sbjct: 179 PIAAMGDALELAVMCGFLIIMGLIPMVAFDVFWQVWSHIKKLRMSKQEIRDEHKQSEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  + +MM    +A +I+TNPTHYA+ALRY + + +AP ++AKG   IA
Sbjct: 239 HVKGRIRQQQRAIAQRRMMADVPKADVIVTNPTHYAVALRYDEKKMNAPRVLAKGAGEIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++  EH +PI E P LAR+LF+   +   IP   Y AVA+++  +Y  K
Sbjct: 299 LRIRELGAEHRVPILEAPPLARALFRHSEVGQHIPAALYAAVAEVLAWVYQLK 351


>gi|323527726|ref|YP_004229879.1| flagellar biosynthetic protein FlhB [Burkholderia sp. CCGE1001]
 gi|323384728|gb|ADX56819.1| flagellar biosynthetic protein FlhB [Burkholderia sp. CCGE1001]
          Length = 401

 Score =  366 bits (940), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 96/353 (27%), Positives = 176/353 (49%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  +   KTE+ + ++++ A  EG    SRE S F+ + A    +          + +
Sbjct: 1   MAEE-SDLEKTESATPRRLQKAREEGQIVRSRELSTFALLAAGFFGVWGMSGSIGEHLQA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L     +       +   ++      S      ++P L       + + +      L+ 
Sbjct: 60  MLRAAF-TFDHASAFETHRMMAGAGAASREGLYALLPILAFTGAAALLAPMALGGWQLSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F R++   G+ +I+SIN  +    S  K ++VG I   ++      +L   +  
Sbjct: 119 KGLEPKFDRLNPIAGLGKIFSINGPIQLGMSLAKTLVVGVIGGTAIWNRREEILALATQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            H  L +    +     M +  +  +  LD+ +   Q++ KL+MSK+E+K E ++S G+P
Sbjct: 179 LHLALANTVHLIAVCCGMTVAGMFVVAALDVPYQLWQFHKKLRMSKEEVKREHRESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A
Sbjct: 239 HVKGRIRQQQRAIARRRMMTQVPKADVVVTNPTHFAVALQYTDGEMRAPKVVAKGVNLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A E+N+P+ E P LAR+L+  V +N  IP   Y AVA+++  +Y  +
Sbjct: 299 ARIRELAAENNVPLLEAPPLARALYHNVELNREIPGQLYGAVAEVLAWVYQLR 351


>gi|254246770|ref|ZP_04940091.1| Flagellar biosynthesis pathway, component FlhB [Burkholderia
           cenocepacia PC184]
 gi|124871546|gb|EAY63262.1| Flagellar biosynthesis pathway, component FlhB [Burkholderia
           cenocepacia PC184]
          Length = 414

 Score =  366 bits (940), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 98/350 (28%), Positives = 177/350 (50%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +++  +KTEA + ++ E A  EG    SRE + F+ + A          P    + + L 
Sbjct: 18  DESDLDKTEAATPRRREKAREEGQVARSRELASFALLAAGFYGAWLLAGPSGAHLQAMLR 77

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
               +  +    D   ++      SL     ++P L L  +  + + +     +++    
Sbjct: 78  GAF-TFDRATAFDTHRMLSAAGSASLEGFAALLPLLALTGVAALLAPMALGGWLISQKTF 136

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +  F R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +    +
Sbjct: 137 ELKFDRLNPISGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELLGLATQPLGA 196

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            L  A   V       +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P +K
Sbjct: 197 ALPDALHLVAVCCGTTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEVKREHRENEGDPHVK 256

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R +   R+  R +MM A  +A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A ++
Sbjct: 257 GRIRQQQRAIARRRMMAAVPKADVVVTNPTHFAVALQYTDGEMRAPKVVAKGVNLVAARI 316

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R++A EHN+P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 317 RELAAEHNVPLLEAPPLARALYHNVELEREIPGSLYSAVAEVLAWVYQLK 366


>gi|293395574|ref|ZP_06639857.1| flagellar biosynthetic protein FlhB [Serratia odorifera DSM 4582]
 gi|291421893|gb|EFE95139.1| flagellar biosynthetic protein FlhB [Serratia odorifera DSM 4582]
          Length = 391

 Score =  366 bits (940), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 102/350 (29%), Positives = 179/350 (51%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+   K+EAP+  ++E A  EG  P SRE +    ++A L  L    S     +   L 
Sbjct: 11  EDSDLEKSEAPTPHRVEKAREEGQIPRSRELTSILMLIAGLAILWVGGSNLARQLAQMLT 70

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       + +   ++  L  L   A   ++P +   ++  + + ++    + +   +
Sbjct: 71  DGL-HFDHGMVNNDRQMLHQLGMLLRQAVWALLPVMAGLVLVALTAPMLLGGILFSGKSL 129

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           K   KR++   G+KRI+S   L   +K  +K +LVG +  + L  N+  ML  ++  P  
Sbjct: 130 KFDLKRLNPLSGLKRIFSSQVLAELLKGVLKALLVGWVTGLFLWHNWAAMLHLVTQQPLD 189

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            L +A   V    ++++L +  +   D+ +       KLKM+KQ+I+DE K+  G+P +K
Sbjct: 190 ALANALQMVVFCGLLVVLGLVPMVAFDVFYQLWSHIKKLKMTKQDIRDEFKEQEGDPHVK 249

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R +   ++  R +MM    +A +I+TNPTHYA+AL+Y   +  AP ++AKG   IA ++
Sbjct: 250 GRIRQQQQAIARRRMMSDVPKADVIVTNPTHYAVALQYNDKQMSAPRVLAKGAGEIALRI 309

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R++A +H IP  E P LAR+L++   I   IP   Y AVA+++  +Y  +
Sbjct: 310 RELAAQHRIPTLEAPPLARALYRHSEIGQHIPTTLYAAVAEVLAWVYQLR 359


>gi|107024383|ref|YP_622710.1| flagellar biosynthesis protein FlhB [Burkholderia cenocepacia AU
           1054]
 gi|116688291|ref|YP_833914.1| flagellar biosynthesis protein FlhB [Burkholderia cenocepacia
           HI2424]
 gi|105894572|gb|ABF77737.1| flagellar biosynthetic protein FlhB [Burkholderia cenocepacia AU
           1054]
 gi|116646380|gb|ABK07021.1| flagellar biosynthetic protein FlhB [Burkholderia cenocepacia
           HI2424]
          Length = 399

 Score =  366 bits (940), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 99/353 (28%), Positives = 178/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++  +  +KTEA + ++ E A  EG    SRE + F+ + A          P    + +
Sbjct: 1   MADE-SDLDKTEAATPRRREKAREEGQVARSRELASFALLAAGFYGAWLLAGPSGAHLQA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L     +  +    D   ++      SL     ++P L L  +  + + +     +++ 
Sbjct: 60  MLRGAF-TFDRATAFDTHRMLSAAGSASLEGFAALLPLLALTGVAALLAPMALGGWLISQ 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
              +  F R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +  
Sbjct: 119 KTFELKFDRLNPISGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELLGLATQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             + L  A   V       +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P
Sbjct: 179 LGAALPDALHLVAVCCGTTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEVKREHRENEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM A  +A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A
Sbjct: 239 HVKGRIRQQQRAIARRRMMAAVPKADVVVTNPTHFAVALQYTDGEMRAPKVVAKGVNLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EHN+P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 299 ARIRELAAEHNVPLLEAPPLARALYHNVELEREIPGSLYSAVAEVLAWVYQLK 351


>gi|50120630|ref|YP_049797.1| flagellar biosynthesis protein FlhB [Pectobacterium atrosepticum
           SCRI1043]
 gi|49611156|emb|CAG74602.1| flagellar biosynthetic protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 383

 Score =  366 bits (939), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 109/353 (30%), Positives = 185/353 (52%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   KTEAP+ +K E A  EG  P SRE +    ++A L  L          +  
Sbjct: 1   MAE-DSDLEKTEAPTPQKEEKAREEGQIPRSRELTSVLMMVAGLAILWIGGDVMAGRLAR 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L +     + D + ++  +  L   A   ++P +L  ++  + + ++    + + 
Sbjct: 60  IVSQSL-NFDYATIGDDTQMLRHVGSLLRQAVSALVPIMLGAVLVALSAPMLLGGILFST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K  FK++    G+KR++S   L    K+ +K ++VG I T+ L  N+  +L  +S  
Sbjct: 119 KSLKVDFKKLDPISGLKRLFSSQALAELFKAILKSVIVGIISTLFLIHNWPKILHLVSEA 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + L  A         +I++ +  +   D+ W       KL+M+KQEI+DE KQS G+P
Sbjct: 179 PIAALGDALELAVMCGFLIIIGLIPMVAFDVFWQVWSHIKKLRMTKQEIRDEHKQSEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  + +MM    +A +I+TNPTHYA+ALRY   + +AP ++AKG   IA
Sbjct: 239 HVKGRIRQQQRAMAQRRMMADVPKADVIVTNPTHYAVALRYDDKKMNAPKVLAKGAGDIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++  EH +PI E P LAR+LF+   +   IP   Y AVA+++  +Y  K
Sbjct: 299 LRIRELGTEHRVPILEAPPLARALFRHSEVGQHIPAALYAAVAEVLAWVYQLK 351


>gi|303240269|ref|ZP_07326788.1| flagellar biosynthetic protein FlhB [Acetivibrio cellulolyticus
           CD2]
 gi|302592179|gb|EFL61908.1| flagellar biosynthetic protein FlhB [Acetivibrio cellulolyticus
           CD2]
          Length = 400

 Score =  366 bits (939), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 105/349 (30%), Positives = 185/349 (53%), Gaps = 1/349 (0%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
              +KTE  + KK E A  EG    SRE +    +L   I +          + +   ++
Sbjct: 46  DSGDKTEKATPKKREKAREEGQVLQSREMTAAIVLLCLFITVKIAGGYMYEQIYAYFKIV 105

Query: 66  LASATQR-KLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVK 124
            A  ++   L  +  ++ L   L L   ++V P   + ++ GI S   Q   +     + 
Sbjct: 106 FADYSKLTDLFTVEGLIKLFIDLLLRFLKIVAPVFAVALITGIVSGYAQVGFLFTTKTLA 165

Query: 125 PSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSI 184
             F R++   G KRI+S+ ++   +KS +KI+++G I    L +    +L+ ++ +  SI
Sbjct: 166 FKFSRINPLSGFKRIFSLRSVTELVKSILKIVVIGYIGYSYLADEAKNILNTMNMDVISI 225

Query: 185 LYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKN 244
             +   T   V I + + +  L VLD G+ + ++   LKMSKQEIK E K++ GNP +K 
Sbjct: 226 AAYICVTSINVAIRMCIAMLILGVLDYGYQWWEYEKSLKMSKQEIKQENKEAEGNPEVKA 285

Query: 245 RQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMR 304
           + +   R     +M++   +A ++ITNPTH+A+A++Y    +DAP+++AKGQ+ IA +++
Sbjct: 286 KIRQKQRQIALRRMLQDIPKADVVITNPTHFAVAIKYDPKVSDAPIVIAKGQDYIALRIK 345

Query: 305 KIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +IA E+ + I E   LAR+L+  V I   IPP  ++AVA+++  +Y  K
Sbjct: 346 EIAKENKVEIVENKPLARTLYASVDIGERIPPELFQAVAEVLAFVYSLK 394


>gi|170731604|ref|YP_001763551.1| flagellar biosynthesis protein FlhB [Burkholderia cenocepacia
           MC0-3]
 gi|169814846|gb|ACA89429.1| flagellar biosynthetic protein FlhB [Burkholderia cenocepacia
           MC0-3]
          Length = 399

 Score =  366 bits (939), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 99/353 (28%), Positives = 177/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++  +  +KTEA + ++ E A  EG    SRE + F+ + A          P    + +
Sbjct: 1   MADE-SDLDKTEAATPRRREKAREEGQVARSRELASFALLAAGFYGAWLLAGPSGAHLQA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L     +  +    D   ++      SL     ++P L L  +  + + +     +++ 
Sbjct: 60  MLRGAF-TFDRATAFDTHRMLSAAGSASLEGFAALLPLLALTGVAALLAPMALGGWLISQ 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
              +  F R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +  
Sbjct: 119 KTFELKFDRLNPISGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELLGLATQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               L  A   V       +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P
Sbjct: 179 LGVALPDALHLVAVCCGTTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEVKREHRENEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM A  +A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A
Sbjct: 239 HVKGRIRQQQRAIARRRMMAAVPKADVVVTNPTHFAVALQYTDGEMRAPKVVAKGVNLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EHN+P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 299 ARIRELAAEHNVPLLEAPPLARALYHNVELEREIPGSLYSAVAEVLAWVYQLK 351


>gi|170694379|ref|ZP_02885533.1| flagellar biosynthetic protein FlhB [Burkholderia graminis C4D1M]
 gi|170140802|gb|EDT08976.1| flagellar biosynthetic protein FlhB [Burkholderia graminis C4D1M]
          Length = 401

 Score =  365 bits (938), Expect = 5e-99,   Method: Composition-based stats.
 Identities = 96/353 (27%), Positives = 178/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  +   KTE+ + ++++ A  EG    SRE S F+ + A    +          + +
Sbjct: 1   MAEE-SDLEKTESATPRRLQKAREEGQIARSRELSTFALLAAGFFGVWGMSDSIGEHLQA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L     +       +   ++      S      ++P L +     + + +      L+ 
Sbjct: 60  MLRAAF-TFDHAGAFETHRMMIGAGAASREGLYALLPILAVTGAAALLAPMALGGWQLST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F+R++   G+ +I+SIN  +    S  K ++VG I   ++      +L   +  
Sbjct: 119 KGLEPKFERLNPIAGLGKIFSINGPIQLAMSLAKTLVVGIIGGTAIWNRREEILALATQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            H  L +    +     M +  +  +  LD+ +   Q++ KL+MSK+E+K E ++S G+P
Sbjct: 179 LHLALANTVHLIAVCCGMTVAGMFVVAALDVPYQLWQFHKKLRMSKEEVKREHRESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A
Sbjct: 239 HVKGRIRQQQRAIARRRMMTQVPKADVVVTNPTHFAVALQYTDGEMRAPKVVAKGVNLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A E+N+P+ E P LAR+L+  V +N  IP   Y AVA+++  +Y  +
Sbjct: 299 ARIRELAAENNVPLLEAPPLARALYHNVELNREIPGQLYGAVAEVLAWVYQLR 351


>gi|125973005|ref|YP_001036915.1| flagellar biosynthetic protein FlhB [Clostridium thermocellum ATCC
           27405]
 gi|256004802|ref|ZP_05429777.1| flagellar biosynthetic protein FlhB [Clostridium thermocellum DSM
           2360]
 gi|281417216|ref|ZP_06248236.1| flagellar biosynthetic protein FlhB [Clostridium thermocellum JW20]
 gi|125713230|gb|ABN51722.1| flagellar biosynthetic protein FlhB [Clostridium thermocellum ATCC
           27405]
 gi|255991252|gb|EEU01359.1| flagellar biosynthetic protein FlhB [Clostridium thermocellum DSM
           2360]
 gi|281408618|gb|EFB38876.1| flagellar biosynthetic protein FlhB [Clostridium thermocellum JW20]
 gi|316940759|gb|ADU74793.1| flagellar biosynthetic protein FlhB [Clostridium thermocellum DSM
           1313]
          Length = 392

 Score =  365 bits (937), Expect = 6e-99,   Method: Composition-based stats.
 Identities = 109/349 (31%), Positives = 178/349 (51%), Gaps = 1/349 (0%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
               KTE  + +K   A  EG    SRE +    +L+  + L  F       +   L V 
Sbjct: 39  DNGEKTEKATPRKRSKAREEGQVLQSRELNSAIVLLSAFVTLRIFGQYMYEEILKCLKVA 98

Query: 66  LA-SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVK 124
           +        L  I  +  L     ++  ++  P L++ ++ GIGS   Q   +     + 
Sbjct: 99  ITVYPLNDGLFTIDGLFELYGETVITFLKIATPVLMVVLIAGIGSAYAQVGFLFTTKTLG 158

Query: 125 PSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSI 184
               R++  +G KRI+S+ +LV  +KS +KI LVG I    +      +L  +  +  S 
Sbjct: 159 IKLSRINPLKGFKRIFSLKSLVELLKSIIKIALVGYIGYGYIKGEMTNVLGMMDVDVVSS 218

Query: 185 LYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKN 244
                 T+    I + +    + V D G+ + ++   L+MSKQEIK+E K+  GNP IK+
Sbjct: 219 ASFLGSTILNAAIRMCIAFVVIGVADYGYQWWEYEKSLRMSKQEIKEENKEVEGNPEIKS 278

Query: 245 RQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMR 304
           R +   R     +M++   +A ++ITNPTHYA+A++Y   E DAPV+VAKGQ+ +A +++
Sbjct: 279 RIRQKQRQMSMRRMLQDIPKADVVITNPTHYAVAIKYDPKEADAPVVVAKGQDYMALRIK 338

Query: 305 KIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +IA EH + I E   LA++L+K V I   IPP  Y+AVA+++  +Y  K
Sbjct: 339 EIAKEHKVEIVENKPLAQTLYKTVEIGGKIPPELYQAVAEVLAFVYSLK 387


>gi|152983829|ref|YP_001349232.1| flagellar biosynthesis protein FlhB [Pseudomonas aeruginosa PA7]
 gi|150958987|gb|ABR81012.1| flagellar biosynthetic protein FlhB [Pseudomonas aeruginosa PA7]
          Length = 378

 Score =  365 bits (937), Expect = 6e-99,   Method: Composition-based stats.
 Identities = 93/353 (26%), Positives = 187/353 (52%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+++  +KTE P+ K+  +A  +G  P SRE +  + ++A    LL + +    ++  
Sbjct: 1   MAESESGQDKTEEPTEKRRREAREKGQLPRSRELNTLAILMAGAGGLLIYGADLAAAMLR 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +       ++  + +   ++ LL      A++ + P LL+ ++  I   +     + ++
Sbjct: 61  LMRSSFE-LSRETVLNTESMLQLLGASGYLAAQGLWPILLMLLVAAIVGPIALGGWLFSM 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + ++P F R++   G+KR++S  +L+   K+ +K ++V  +  + L+ +   +L      
Sbjct: 120 DALQPKFSRLNPLSGLKRMFSAKSLLELSKALIKFLVVLAVALLVLSADRDALLALAHQP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V      +   +  +  +D+ +       KL M+KQE++DE K S G P
Sbjct: 180 LEQAILHSAQVVGWSAFWMACSLLLIAAVDVPYQIWDNRQKLMMTKQEVRDEYKDSEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K++ + + R   + +MM A   A ++ITNPTH+A+AL+Y      AP+L+AKG + +A
Sbjct: 240 EVKSKIRQMQREMAQRRMMAAVPEADVVITNPTHFAVALKYDPAGGGAPLLLAKGNDFLA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++A EH + + E P+LAR+++    ++  IP   Y AVAQ++  +Y  K
Sbjct: 300 LKIREVAREHKVMVMESPALARAVYYSTELDQEIPAGLYLAVAQVLAYVYQLK 352


>gi|254785483|ref|YP_003072912.1| flagellar biosynthesis protein FlhB [Teredinibacter turnerae T7901]
 gi|237686236|gb|ACR13500.1| flagellar biosynthetic protein FlhB [Teredinibacter turnerae T7901]
          Length = 377

 Score =  364 bits (934), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 91/353 (25%), Positives = 174/353 (49%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   KTE  + +++E A  EG  P SRE +  + +LA  I L+ F      +   
Sbjct: 1   MAEQDSSQEKTEEATPRRLEKAREEGQVPRSRELTTTAVLLAGTISLVLFGGVMANAQLE 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            + +      +  + D   +   L      A   ++P   + ++  I   +     + + 
Sbjct: 61  IMRLNFDLP-REVIFDPELMFAQLGASFKEALLSLMPLFAVILVAAIAGPVALGGWLFSS 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   R+   +G+ R++S+ +L+  +KS  K+ +V  +  + L++    +L      
Sbjct: 120 KALAPKLNRMDPIKGLGRMFSMKSLIELVKSIGKVAIVVGVAFVLLSQMKTALLGLSQEG 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+        +++      +  +DI +       KLKMS+Q+I+DE+K + G P
Sbjct: 180 LEQAIIHSLTLSLWAAVLLSASTIVIAAMDIPFQIWDHSKKLKMSRQDIRDEMKDTEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K++ + + +   +++MM A   A ++ITNPTHY++ALRY       PV+VAKG + +A
Sbjct: 240 EVKSKIRQMQQEMAQNRMMSAVPEADVVITNPTHYSIALRYDPKTMSTPVVVAKGIDFVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA E+ I   + P LAR+++    +   IP   Y AVAQ++  ++  +
Sbjct: 300 MKIREIARENKIEFVQAPLLARAIYATTDLEDEIPEGLYVAVAQVLAYVFQLR 352


>gi|116694207|ref|YP_728418.1| flagellar biosynthesis protein FlhB [Ralstonia eutropha H16]
 gi|113528706|emb|CAJ95053.1| flagellar biosynthesis protein [Ralstonia eutropha H16]
          Length = 380

 Score =  364 bits (934), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 106/353 (30%), Positives = 180/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE  +   KTE  S +++E A  EG    SRE + F  ++A +  L         S+  
Sbjct: 1   MSEE-SDLEKTEPASPRRLEKAREEGQVVRSRELATFVMLIAGVTGLWTLGGHLGRSLNQ 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L         D S ++     +   +    +P L LF +  + + L+    V + 
Sbjct: 60  VMQGALR-FEPATAFDTSRMLSRFAMMVWDSLLAFLPLLFLFGVAALAAPLLLGGWVFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P F R+S   G+ R++S ++LV  +K+  K +LVG++    L       +  ++A 
Sbjct: 119 KSFAPQFSRLSPLAGLGRMFSAHSLVELLKAVAKSLLVGSVGAWVLWRRLPEAIALMNAP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               L H    V    +++ L +  +  +D+ W Y +++ KL+M+K+E+K E K+S G+P
Sbjct: 179 VQEALLHMVDLVMYCCLVVSLSLLVVAAIDVPWQYWEFFKKLRMTKEEVKQEFKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R +   R+  R +MM    +A +++TNPTH+A+ALRY +    AP +VAKG   IA
Sbjct: 239 HIKGRIRQQQRAMARRRMMTEVPKADVVVTNPTHFAVALRYEEGRMGAPRVVAKGTGDIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EH +P+   P LAR+L + V +   IP   Y AVA+++  +Y  K
Sbjct: 299 ARIRELAAEHRVPLMSAPPLARALHRHVELGQEIPAGLYTAVAEVLAWVYQLK 351


>gi|119476304|ref|ZP_01616655.1| Flagellar biosynthesis pathway, component FlhB [marine gamma
           proteobacterium HTCC2143]
 gi|119450168|gb|EAW31403.1| Flagellar biosynthesis pathway, component FlhB [marine gamma
           proteobacterium HTCC2143]
          Length = 386

 Score =  363 bits (933), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 99/353 (28%), Positives = 179/353 (50%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+END    KTE  + K++E +  EG    S+E      +LA +  L+ +      ++  
Sbjct: 1   MAENDNGQEKTEEATPKRLEKSREEGQVARSKELGTALILLAGVGGLIVYGGDFGQALMG 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +     S  +    D S ++  L + S+     ++P   L  +  +   +     +L+ 
Sbjct: 61  VMRFNF-SMPRDVAFDESLMLRHLGNTSIFIIETMLPFFALIAVAAVVGPVALGGFILSG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   R+   +GIKRI+S+ +LV  +KS  K+++VG++   +L      +LD   A 
Sbjct: 120 KALVPKLTRLDPIKGIKRIFSLTSLVELLKSICKVLVVGSMAYFTLRNAEMDLLDLAHAE 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               +      V   ++ +   +  + ++D+ +       KLKM+ QE+KDE+K S G P
Sbjct: 180 LQPAIVQMLTIVAWSVLAVSASMILIVLIDVPFQIFDHSKKLKMTLQEVKDEMKDSEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MMEA   A ++ITNP H+++AL+Y      AP+LVAKG + +A
Sbjct: 240 EVKGRIRQLQREMAQRRMMEAVPEADVVITNPEHFSIALKYDVEGGGAPILVAKGVDFLA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA  +++ I   P LAR+++    I+  IP   Y AVAQ++  ++  +
Sbjct: 300 IKIREIANANDVMILAAPPLARAIYFTTEIDDEIPNTLYLAVAQVLAYVFQLR 352


>gi|167623392|ref|YP_001673686.1| flagellar biosynthesis protein FlhB [Shewanella halifaxensis
           HAW-EB4]
 gi|167353414|gb|ABZ76027.1| flagellar biosynthetic protein FlhB [Shewanella halifaxensis
           HAW-EB4]
          Length = 377

 Score =  363 bits (933), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 89/353 (25%), Positives = 173/353 (49%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+END+   KTE  +S+K++ A ++G    S+E    + ++A  + LL        ++ +
Sbjct: 1   MAENDSSQEKTEEATSRKLQQAKDKGQVARSKELGTSAVLIAASVGLLMTGPDIAQAMHN 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L  + ++ ++ D   ++ +   +    +  ++  ++   +      +       ++
Sbjct: 61  IMTKLF-TMSRDEIFDTKQMMNVWGVIGTELALPLMGFIVFLALIAFAGNVALGGISFSV 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   ++S   G KR++ +  LV   K   K  +V     + L+     +L     +
Sbjct: 120 KAFMPKASKMSPMAGFKRMFGVQALVELTKGIAKFSVVAITAFLLLSTYLNDILMLSQDH 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               +YHA   V  + I++      + V+D+ +       +LKM+KQE+KDE K + G P
Sbjct: 180 LPGNIYHALDIVVWIFILLCASTFLIVVIDVPFQIWNHAKQLKMTKQEVKDEYKDTEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + +     + +MM     A +I+ NP HYA+A++Y  T + AP +VAKG + +A
Sbjct: 240 EVKGRIRQLQHEMSQRRMMGEVPNADVIVVNPEHYAVAVKYDATRSTAPFVVAKGVDEVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA EH++ I   P LAR++F    I+  IP   + AVAQ++  ++  +
Sbjct: 300 FKIREIAREHDVAIVSAPPLARAIFHTTKIDQEIPEGLFTAVAQVLAYVFQLR 352


>gi|15596646|ref|NP_250140.1| flagellar biosynthesis protein FlhB [Pseudomonas aeruginosa PAO1]
 gi|107100883|ref|ZP_01364801.1| hypothetical protein PaerPA_01001913 [Pseudomonas aeruginosa PACS2]
 gi|116049394|ref|YP_791803.1| flagellar biosynthesis protein FlhB [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218892678|ref|YP_002441547.1| flagellar biosynthesis protein FlhB [Pseudomonas aeruginosa LESB58]
 gi|254234548|ref|ZP_04927871.1| flagellar biosynthetic protein FlhB [Pseudomonas aeruginosa C3719]
 gi|254239799|ref|ZP_04933121.1| flagellar biosynthetic protein FlhB [Pseudomonas aeruginosa 2192]
 gi|296390184|ref|ZP_06879659.1| flagellar biosynthesis protein FlhB [Pseudomonas aeruginosa PAb1]
 gi|313106448|ref|ZP_07792679.1| flagellar biosynthetic protein FlhB [Pseudomonas aeruginosa 39016]
 gi|9947400|gb|AAG04838.1|AE004574_9 flagellar biosynthetic protein FlhB [Pseudomonas aeruginosa PAO1]
 gi|115584615|gb|ABJ10630.1| flagellar biosynthetic protein FlhB [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126166479|gb|EAZ51990.1| flagellar biosynthetic protein FlhB [Pseudomonas aeruginosa C3719]
 gi|126193177|gb|EAZ57240.1| flagellar biosynthetic protein FlhB [Pseudomonas aeruginosa 2192]
 gi|218772906|emb|CAW28718.1| flagellar biosynthetic protein FlhB [Pseudomonas aeruginosa LESB58]
 gi|310879181|gb|EFQ37775.1| flagellar biosynthetic protein FlhB [Pseudomonas aeruginosa 39016]
          Length = 378

 Score =  363 bits (933), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 93/353 (26%), Positives = 187/353 (52%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+++  +KTE P+ K+  +A  +G  P SRE +  + ++A    LL + +    ++  
Sbjct: 1   MAESESGQDKTEEPTEKRRREAREKGQLPRSRELNTLAILMAGAGGLLIYGADLAGALLR 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +       ++    +   ++ LL   +  A++ + P LL+ ++  I   +     + ++
Sbjct: 61  LMRSNFE-LSRETAMNTESMLQLLGASAYLAAQGLWPILLMLLVAAIVGPIALGGWLFSM 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + ++P F R++   G+KR++S  +L+   K+ +K ++V  +  + L+ +   +L      
Sbjct: 120 DALQPKFSRLNPLSGLKRMFSAKSLLELSKALIKFLVVLAVALLVLSADRDALLALAHQP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V      +   +  +  +D+ +       KL M+KQE++DE K S G P
Sbjct: 180 LEQAILHSVRVVGWSAFWMACSLLLIAAVDVPYQIWDNRQKLLMTKQEVRDEYKDSEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K++ + + R   + +MM A   A ++ITNPTH+A+AL+Y      AP+L+AKG + +A
Sbjct: 240 EVKSKIRQMQREMAQRRMMAAVPEADVVITNPTHFAVALKYDPAGGGAPLLLAKGNDFLA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++A EH + + E P+LAR+++    ++  IP   Y AVAQ++  +Y  K
Sbjct: 300 LKIREVAQEHKVMVMESPALARAVYYSTELDQEIPAGLYLAVAQVLAYVYQLK 352


>gi|261821144|ref|YP_003259250.1| flagellar biosynthesis protein FlhB [Pectobacterium wasabiae
           WPP163]
 gi|261605157|gb|ACX87643.1| flagellar biosynthetic protein FlhB [Pectobacterium wasabiae
           WPP163]
          Length = 383

 Score =  363 bits (932), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 109/353 (30%), Positives = 187/353 (52%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   KTEAP+ +K E A  EG  P SRE +    ++A L  L          +  
Sbjct: 1   MAE-DSDLEKTEAPTPQKEEKAREEGQVPRSRELTSVLMMVAGLAILWMGGDAMAGRLAV 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L +     + D + ++  +  L   A+  +IP +L  ++  + + ++    + + 
Sbjct: 60  IVAQSL-NFDYATIGDDTQMLRHVGSLLHQAASALIPIMLGSVLVALSAPMLLGGILFST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K  FK++    G+KR++S  +L    K+ +K ++VG I T+ L  N+  +L  +S  
Sbjct: 119 KSLKVDFKKLDPISGLKRLFSAQSLAELFKAILKSVMVGVISTLFLIHNWPKILHLVSEA 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + L  A         +I++ +  +   D+ W       KL+M+KQEI+DE KQS G+P
Sbjct: 179 PIAALGDALELAVMCGFLIIMGLIPMVAFDVFWQVWSHIKKLRMTKQEIRDEHKQSEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  + +MM    +A +I+TNPTHYA+ALRY   + +AP ++AKG   IA
Sbjct: 239 HVKGRIRQQQRAMAQRRMMADVPKADVIVTNPTHYAVALRYDDKKMNAPKVLAKGAGEIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++  +H +PI E P LAR+LF+   +   IP   Y AVA+++  +Y  K
Sbjct: 299 LRIRELGIDHRVPILEAPPLARALFRHSEVGEHIPAALYAAVAEVLAWVYQLK 351


>gi|94312630|ref|YP_585839.1| flagellar biosynthetic protein FlhB [Cupriavidus metallidurans
           CH34]
 gi|93356482|gb|ABF10570.1| flagellar biosynthetic protein FlhB [Cupriavidus metallidurans
           CH34]
          Length = 380

 Score =  363 bits (932), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 104/353 (29%), Positives = 180/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE  +   KTE  +++++E A  EG    SRE   F+ ++  +I L          + +
Sbjct: 1   MSEE-SDLEKTEPATARRLEKAREEGQVVRSRELGTFAMLMTGVIGLWATGGVLGRKLDA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +H  LA        D + ++     +   A    +P LL+F +  + + L     + + 
Sbjct: 60  VMHAGLA-FEPATAFDTNRMLSQFAAIVWDALLAFLPLLLMFGVAALVTPLALGGWMFST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P F R+S   G+ R++S ++LV   K+  K +LVG +    +       +  + A 
Sbjct: 119 KSFSPDFSRMSPISGLGRLFSAHSLVELAKAIAKSLLVGGVGAWMIWRKLPEAIALMDAP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               L H    V  V  ++   +  +  LD+ W  + ++ KL+M+K+EIK E+K++ G+P
Sbjct: 179 IQEALLHMMELVLYVSGVVAGSLILVAALDVPWQLYTFHKKLRMTKEEIKQEMKETDGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R +   R+  R +MM    +A +++TNPTHYA+ALRY +    AP +VAKG + +A
Sbjct: 239 HIKARIRQQQRAIARRRMMAEVPKADVVVTNPTHYAVALRYEEGRMGAPRVVAKGADEVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EH +P+   P LAR+L + V +   IP   Y AVA+++  +Y  K
Sbjct: 299 ARIRELAAEHRVPMLSAPPLARALHRHVELGHEIPAGLYTAVAEVLAWVYQLK 351


>gi|188592105|ref|YP_001796703.1| flagellar biosynthesis protein flhb [Cupriavidus taiwanensis LMG
           19424]
 gi|170938479|emb|CAP63466.1| FlhB: Flagellar biosynthetic protein. flhB/hrpN/yscU/spaS family
           [Cupriavidus taiwanensis LMG 19424]
          Length = 380

 Score =  362 bits (930), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 106/353 (30%), Positives = 180/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE  +   KTE  S +++E A  EG    SRE + F  ++A +  L         S+  
Sbjct: 1   MSEE-SDLEKTEPASPRRLEKAREEGQVVRSRELATFVMLIAGVTGLWTLGGHLGRSLNQ 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L         D + ++     +   +    +P LLLF +  + + L+    V + 
Sbjct: 60  VMQGALR-FEPATAFDPARMLSRFALMVWDSLLAFLPLLLLFGVAALAAPLLLGGWVFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P F R+S   G+ R++S ++LV  +K+  K +LVG +    L       +  ++A 
Sbjct: 119 KSFAPQFSRLSPIAGLGRMFSAHSLVELLKAVAKSLLVGAVGAWVLWRRLPEAIALMNAP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               L H    V    +++ L +  +  +D+ W Y +++ KL+M+K+E+K E K+S G+P
Sbjct: 179 VQEALLHMVDLVMFCCLVVSLSLLVVAAIDVPWQYWEFFKKLRMTKEEVKQEFKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IKNR +   R+  R +MM    +A +++TNPTH+A+ALRY +    AP +VAKG   +A
Sbjct: 239 HIKNRIRQQQRAMARRRMMTEVPKADVVVTNPTHFAVALRYEEGRMGAPRVVAKGTGEVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R +A EH +P+   P LAR+L + V +   IP   Y AVA+++  +Y  K
Sbjct: 299 ARIRALAAEHRVPLMSAPPLARALHRHVELGQEIPAGLYTAVAEVLAWVYQLK 351


>gi|78485088|ref|YP_391013.1| flagellar biosynthetic protein FlhB [Thiomicrospira crunogena
           XCL-2]
 gi|78363374|gb|ABB41339.1| flagellar biosynthetic protein FlhB [Thiomicrospira crunogena
           XCL-2]
          Length = 381

 Score =  362 bits (929), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 103/353 (29%), Positives = 187/353 (52%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+    K+E PS KK+ +A  +G  P S+E +     L   ++L FF +  +    +
Sbjct: 1   MAENEDGTEKSEEPSEKKLREAREKGQVPRSKELTTLLMTLGAAVFLYFFGAQMMQDFET 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
                L S  +    D      L+  L + +  +++P LLL ++  + S ++      + 
Sbjct: 61  LFIKGL-SFDRSHAYDFQMATNLVLGLVVHSIYMMVPFLLLMVLIAVVSPMLLGGWNFST 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   +++   GIK+++S+N L+   K+F K  LV  +    L  +Y  ++      
Sbjct: 120 QALAPKISKLNPVSGIKKMFSMNALMELFKAFAKFTLVSVVAGFFLWYSYEEIISIGIEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   L HA   + +  I + L +  +  +D+ +  HQ  ++LKM+KQE+K+E KQ  G+P
Sbjct: 180 PKQALAHAGQLIVEAFIFVSLSLILIAAIDVPFQIHQHVTQLKMTKQEVKEEHKQQEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM+    A ++ITNPTH+A+AL+Y   E   P+++A G + +A
Sbjct: 240 EVKGRIRQLQREMSQKRMMQKVPEADVVITNPTHFAVALKYAPDEMAEPMVLALGSDFMA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R +A EHNIP+ E P LAR+L+    ++  IP   ++AVA ++  +Y  +
Sbjct: 300 AQIRTLAKEHNIPLIEAPPLARALYYNAEVDRPIPYELFRAVAAILAYVYQLR 352


>gi|218778857|ref|YP_002430175.1| flagellar biosynthetic protein FlhB [Desulfatibacillum alkenivorans
           AK-01]
 gi|218760241|gb|ACL02707.1| Flagellar biosynthetic protein FlhB [Desulfatibacillum alkenivorans
           AK-01]
          Length = 358

 Score =  362 bits (929), Expect = 6e-98,   Method: Composition-based stats.
 Identities = 104/353 (29%), Positives = 181/353 (51%), Gaps = 3/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++   ++KTE P+ KK +DA  +G    SR+ S    ++A L  +  F     Y +TS
Sbjct: 1   MADSPN-EDKTEQPTPKKRDDARKKGQVAKSRDLSSVVVLMAGLGIMYMFGPYMHYHITS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  +    T      +  I  L   +      ++ P L    + G  S  +Q     + 
Sbjct: 60  LMENIFT--TDVSAWGVEEINTLGREMVREFLFILAPILAGVFVVGFASAAVQVGFYFSW 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P F +++   G  R++S   LV   KS  K+ +VG I  +++      ++     +
Sbjct: 118 EAAAPKFSKINPISGFGRMFSKQALVELAKSLAKLFIVGFISYLTIEAEMDNLILLGQVD 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             + L +    + K+ I + + +  + VLD  +       +LKM+KQE+KDE KQ+ G+P
Sbjct: 178 AANTLAYVLKIILKLFIRVGIIMVFVAVLDFAFQKWHHEQQLKMTKQEVKDEYKQTDGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           ++K R + I     R +MME   +A +++TNPTH ALA++Y      AP++VAKG   IA
Sbjct: 238 MVKARIRRIQMEAARRRMMEEVPKADVVVTNPTHLALAIKYNALTMGAPLIVAKGAGPIA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +K++++A E+++PI E   LAR+L+K V I   +P   Y+AVA+++  +Y  K
Sbjct: 298 QKIKEVARENDVPIVENKELARALYKVVDIGDEVPVALYEAVAEVLAYVYGLK 350


>gi|167587841|ref|ZP_02380229.1| flagellar biosynthesis protein FlhB [Burkholderia ubonensis Bu]
          Length = 403

 Score =  361 bits (928), Expect = 7e-98,   Method: Composition-based stats.
 Identities = 95/353 (26%), Positives = 177/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++  +  +KTEA + ++ E A  EG    SRE + F+ + +          P    + +
Sbjct: 1   MADE-SDLDKTEAATPRRREKAREEGQVARSRELASFALLASGFYGTWLLAGPIGRHLQT 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L     +  +    D + ++     +SL     + P L +  +  + + +     +++ 
Sbjct: 60  MLRGAF-TFDRGIAFDTNRMLTSAGSVSLEGLAALAPLLAMMGVAALLAPMALGGWLISS 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
              +    R++   G+ RI+S+   +    S  K ++VG I  I++  +   +L      
Sbjct: 119 KTFELKLDRLNPITGLGRIFSVQGPIQLGMSLAKTLVVGGIGGIAIWRSKDELLGLAMQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            H+ L  A   V       +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P
Sbjct: 179 LHAALADALHLVAVCCGTTVAGMLVVAALDVPYQLWQYNKKLRMTKEEVKREHRENEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM A  +A +++TNPTH+A+AL+Y      AP +VAKG NL+A
Sbjct: 239 HVKGRIRQQQRAIARRRMMAAVPKADVVVTNPTHFAVALQYTDGAMRAPKVVAKGVNLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EHN+P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 299 ARIRELAAEHNVPLLEAPPLARALYHNVELEREIPGSLYSAVAEVLAWVYQLK 351


>gi|218699549|ref|YP_002407178.1| flagellar biosynthesis protein FlhB [Escherichia coli IAI39]
 gi|218369535|emb|CAR17304.1| flagellar export pore protein [Escherichia coli IAI39]
          Length = 382

 Score =  361 bits (928), Expect = 7e-98,   Method: Composition-based stats.
 Identities = 103/350 (29%), Positives = 188/350 (53%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGGVSLARRLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       + D + I+  +  L   A   ++P +   ++  + S ++    V +   +
Sbjct: 62  AGL-HFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKRI+S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRIFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRIRQMLRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|172059259|ref|YP_001806911.1| flagellar biosynthesis protein FlhB [Burkholderia ambifaria MC40-6]
 gi|171991776|gb|ACB62695.1| flagellar biosynthetic protein FlhB [Burkholderia ambifaria MC40-6]
          Length = 399

 Score =  361 bits (928), Expect = 8e-98,   Method: Composition-based stats.
 Identities = 98/353 (27%), Positives = 179/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++  +  ++TEA + ++ E A  EG    SRE + F+ + A         +P    + +
Sbjct: 1   MADE-SDLDRTEAATPRRREKAREEGQVARSRELASFALLAAGFYGAWLLAAPSGAHLQA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L    A   +    D   ++      S+     ++P L L  +  + + +     +++ 
Sbjct: 60  MLRGAFA-FDRATAFDTHRMLSAAGSASIEGLAALLPILALTGLAALLAPMALGGWLISQ 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
              +  F R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +  
Sbjct: 119 KTFELKFDRLNPISGLGRIFSIQGPIQLGMSLAKTLVVGGIGGIAIWRSKDELLGLATQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             S +  A   V       +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P
Sbjct: 179 FGSAVADAMHLVAVCCGTTVAGMLVVAALDVPYQIWQYNKKLRMTKEEVKREHRENEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM A  +A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A
Sbjct: 239 HVKGRIRQQQRAIARRRMMAAVPKADVVVTNPTHFAVALQYTDGEMRAPKVVAKGVNLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EHN+P+ E P LAR+L+  V I   IP   Y AVA+++  +Y  +
Sbjct: 299 ARIRELAAEHNVPLLEAPPLARALYHNVEIEREIPGSLYSAVAEVLAWVYQLR 351


>gi|89094442|ref|ZP_01167382.1| flagellar biosynthesis protein [Oceanospirillum sp. MED92]
 gi|89081334|gb|EAR60566.1| flagellar biosynthesis protein [Oceanospirillum sp. MED92]
          Length = 379

 Score =  361 bits (928), Expect = 8e-98,   Method: Composition-based stats.
 Identities = 97/353 (27%), Positives = 178/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   KTE P+ K+I +A  +G+ P S+E +    ++A +  ++ F S    S+  
Sbjct: 1   MAE-DSGQEKTEDPTPKRIREAREKGDVPRSKELATTLVLMAAVFSVIIFSSQLAESMLG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +        ++ + D + ++      +  A   +     +  +  +   +       + 
Sbjct: 60  MMESNFV-LDRQSVFDTNKMLAHFEVSAEEAIMGLAGIFAVLALAALVGPIALGGWNFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   R+    GIKR++S+ +L+   K+  K  LVG    + L      +L   S  
Sbjct: 119 QSIVPKGSRIDPLAGIKRMFSLKSLIELFKAIAKFSLVGGFAILILWTIREDILALASYE 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               +  A   +  V + +   +  + V+D+ +  + +  K++M+ QE+KDE+K + G P
Sbjct: 179 ARVAIDEALDIIIWVFMALSAVLILVAVVDVPYQLYDYTQKMRMTMQEVKDELKNTEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM+A   A ++ITNPTHY++AL+Y      APVL+AKG + +A
Sbjct: 239 EVKGRIRQLQREIAQRQMMQAVPEADVVITNPTHYSVALKYDGENRGAPVLLAKGADFVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA EH+IPI   P LAR+++    I+  IP   Y AVAQ++  ++  K
Sbjct: 299 LKIREIAKEHDIPILSAPPLARAIYNSTEIDDEIPSGLYMAVAQVLAYVFQLK 351


>gi|126665002|ref|ZP_01735985.1| flagellar biosynthesis protein B [Marinobacter sp. ELB17]
 gi|126630372|gb|EBA00987.1| flagellar biosynthesis protein B [Marinobacter sp. ELB17]
          Length = 377

 Score =  361 bits (927), Expect = 8e-98,   Method: Composition-based stats.
 Identities = 93/353 (26%), Positives = 181/353 (51%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++D+   KTE  + +++E A  +G    S+E +  + ++A    LL F +    ++ +
Sbjct: 1   MADDDSSQEKTEEATPRRLEKAKEDGETARSKELATTAVLMAGAGGLLIFGTHLGAALEA 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +     +  +  + D+ H+   L   + +A+  + P L++ ++  I   +     + + 
Sbjct: 61  IMRDAF-TLERSAIFDMRHMSVQLIASTKAAAWALSPILVMLLVAAIAGSIGIGGLLFSG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   R++  +GI R++S  +L+   K+  K+ LV TI  + L      +L   +  
Sbjct: 120 KSIAPKLNRMNPIKGIGRMFSARSLIELFKAIAKVGLVLTIAILILQVRTVDLLSISAEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H  +T+     ++      + V+D+ +  +  + KLKM+ QE+KDE K S G P
Sbjct: 180 AVPAMEHVLWTLGWSFFLLSCATIIIAVIDVPFQIYDHHKKLKMTMQEVKDEHKDSEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM+    A ++ITNPTHYA+AL+Y      AP++VAKG + +A
Sbjct: 240 EVKGRIRQLQREMSQRRMMQDVPTADVVITNPTHYAVALKYDPNSMAAPMVVAKGGDELA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+ +IA E+ + I   P LAR+++    I   IP   Y A+AQ++  ++  +
Sbjct: 300 FKIMEIARENKVEILRTPPLARAVYHNSDIGQEIPDGLYMAIAQVLAYVFQLR 352


>gi|330445379|ref|ZP_08309031.1| flagellar biosynthetic protein FlhB [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328489570|dbj|GAA03528.1| flagellar biosynthetic protein FlhB [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 376

 Score =  361 bits (927), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 88/353 (24%), Positives = 175/353 (49%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS++D    +TE  + +++E A  +G  P SRE +  + +++  + L++F      ++  
Sbjct: 1   MSDSD-GQERTEDATPRRLEQAREKGQVPRSRELASVAVLVSGAVGLMWFGEGLSKALGQ 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  +  S T+  + D+  +  ++    +     +   L+                  + 
Sbjct: 60  IMTAMF-SLTREDIFDLDRLFVIIFDAIVHILLPLALVLIFLFFAAFIGAAGVGGVRFSP 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P F +++   GIKR++ + + V  +KS +K+ LVG++    +  +           
Sbjct: 119 QAAMPKFSKMNPISGIKRMFGMQSWVELIKSILKVGLVGSVACYLIYSSLEDFFQLSIEV 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             +  +HA   +   +++I   +  +  +D+ +    +  +LKM+KQEIKDE K S G P
Sbjct: 179 FPANYFHALDILLNFVLLICCSLLIVVAIDVPFQIWNFNQQLKMTKQEIKDEYKDSEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM    +A ++ITNP H+++ALRY    + APV++AKG + +A
Sbjct: 239 EVKGRIRMLQREMAQRRMMADVPQADVVITNPEHFSVALRYDPKLDSAPVVIAKGGDHLA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++A +HNI I     LAR+++    +   IP   + AVAQ++  ++  K
Sbjct: 299 LKIREVANKHNIDIVPAAPLARAIYYTTELEQQIPDGLFVAVAQVLAYVFQLK 351


>gi|254780690|ref|YP_003065103.1| flagellar biosynthesis protein FlhB [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040367|gb|ACT57163.1| flagellar biosynthesis protein FlhB [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 354

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 354/354 (100%), Positives = 354/354 (100%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS
Sbjct: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL
Sbjct: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN
Sbjct: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP
Sbjct: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA
Sbjct: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKKI 354
           KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKKI
Sbjct: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKKI 354


>gi|254250896|ref|ZP_04944214.1| Flagellar biosynthesis pathway component FlhB [Burkholderia dolosa
           AUO158]
 gi|124893505|gb|EAY67385.1| Flagellar biosynthesis pathway component FlhB [Burkholderia dolosa
           AUO158]
          Length = 414

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 98/350 (28%), Positives = 178/350 (50%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +++  ++TEA + ++ E A  EG    SRE + F+ + A          P    + + L 
Sbjct: 18  DESDLDRTEAATPRRREKAREEGQVARSRELASFALLAAGFYGAWLLAGPSGTHLQTMLR 77

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
               S  +    D + ++      S+     ++P L L  +  + + +     +L+    
Sbjct: 78  GAF-SFDRATAFDTNRMLSAAGSASVEGLAALLPLLALTGLAALLAPMALGGWLLSQKTF 136

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +  F R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +    +
Sbjct: 137 ELKFDRLNPIAGLGRIFSIQGPIQLAMSVAKTLVVGGIGGIAIWRSKDELLGLATRPLGT 196

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            L  A   V       +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P +K
Sbjct: 197 ALADALHLVAVCCGTTVAGMLVVAALDVPYQLWQYNKKLRMTKEEVKREHRENEGDPHVK 256

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R +   R+  R +MM A  +A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A ++
Sbjct: 257 GRIRQQQRAIARRRMMAAVPKADVVVTNPTHFAVALQYTDGEMRAPKVVAKGVNLVAARI 316

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R++A EHN+P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 317 RELAAEHNVPLLEAPPLARALYHNVELEREIPGSLYSAVAEVLAWVYQLK 366


>gi|89075526|ref|ZP_01161937.1| flagellar biosynthesis protein [Photobacterium sp. SKA34]
 gi|89048798|gb|EAR54369.1| flagellar biosynthesis protein [Photobacterium sp. SKA34]
          Length = 376

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 89/353 (25%), Positives = 177/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS++D    +TE  + +++E A  +G  P SRE +  + +++  + L++F      +++ 
Sbjct: 1   MSDSD-GQERTEDATPRRLEQAREKGQVPRSRELASVAVLVSGAVGLMWFGEGLSKALSH 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  +  S T+  + D+  +  ++    +     +   L+   +              + 
Sbjct: 60  IMMAMF-SLTRDDIFDLDRLFVIILDAIVYILAPLFLVLIFLFVAAFIGAAGVGGVRFST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   +++   GIKR++ + + V  +KS +K+ LVG+I    +  N        +  
Sbjct: 119 QAAMPKLSKINPLSGIKRMFGLQSWVELIKSILKVGLVGSIACYLIFSNLEDFFQLSNEV 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             +  +HA   +   +++I   +  +  +D+ +    +  +LKM+KQEIKDE K S G P
Sbjct: 179 FPANYFHAIDILLNFVLLICCSLLIVVAIDVPFQIWNFNQQLKMTKQEIKDEYKDSEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM    +A ++ITNP H+++ALRY    + APV++AKG + +A
Sbjct: 239 EVKGRIRMLQREMAQRRMMADVPQADVVITNPEHFSVALRYDPKLDSAPVVIAKGGDHLA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA +H+I I     LAR+++    +   IP   + AVAQ++  ++  K
Sbjct: 299 LKIREIANKHDIDIVPAAPLARAIYYTTELEQQIPDGLFVAVAQILAYVFQLK 351


>gi|92114138|ref|YP_574066.1| flagellar biosynthetic protein FlhB [Chromohalobacter salexigens
           DSM 3043]
 gi|91797228|gb|ABE59367.1| flagellar biosynthetic protein FlhB [Chromohalobacter salexigens
           DSM 3043]
          Length = 387

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 91/353 (25%), Positives = 177/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+ + KTE P+ ++++ A  +G    SRE + F  +   +  L          +  
Sbjct: 1   MAE-DSDEEKTEDPTPRRLDKAKEDGEVARSRELTTFMLLAVGVGSLWSLGGHLYDRMGV 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +       ++ +  D + ++  +  L  +    ++P  L+  +  + + ++    +++ 
Sbjct: 60  VMEQSFL-FSRAEAFDTAVLMAHVWTLGQNTLLALLPLFLIVTVVALTAPVMLGGWLISG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P   +++  +G KR++S   L    K+  K +LVG +    L  N   +L  +S  
Sbjct: 119 KALQPQISKLNPLKGFKRMFSSQVLAELGKAVAKSVLVGGVAVAFLWLNRGDLLGLMSLP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               L          L + +  +  + ++D+ +    +  KL+M+K EIK E K++ G+P
Sbjct: 179 LSEALARGMDLAALCLSLCVAMLIVVVLIDVPFQLWSFTKKLRMTKDEIKKEHKETEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R ++  +S  R +MM     A +I+TNPTHYA+AL Y  +  +AP +VAKG +L+A
Sbjct: 239 QVKARMRAQQQSMARRRMMAKVPEADVIVTNPTHYAVALSYEGSYMEAPRVVAKGSDLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++   H +P+ E P LAR+L + V I+  +P   Y AVA+++   Y  K
Sbjct: 299 TRIRELGEAHGVPLLEAPPLARALHQHVDIDQEVPATLYTAVAEVLAWAYRLK 351


>gi|242238960|ref|YP_002987141.1| flagellar biosynthesis protein FlhB [Dickeya dadantii Ech703]
 gi|242131017|gb|ACS85319.1| flagellar biosynthetic protein FlhB [Dickeya dadantii Ech703]
          Length = 383

 Score =  360 bits (925), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 104/353 (29%), Positives = 179/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++ D+   KTEAP+  + E A  EG  P SRE +    ++  L  L          +  
Sbjct: 1   MAD-DSDLEKTEAPTPHRKEKAREEGQIPRSRELTSIMMLVVGLGILWMAGDIVARRLAL 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L   T   + D   ++  +  L       ++P +L  ++  I + ++    + + 
Sbjct: 60  LLSQGLF-FTHEMISDDKQMLKHMLGLLKLGGSALVPIILGTVVVAIAAPVMLGGLIFST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++ +  +++   GIKR+ S   L    K+ +K ++VG I ++ L  N+  +L  +S  
Sbjct: 119 KQMEFNLNKLNPISGIKRLVSSQMLAELFKAILKAVVVGGITSLFLWHNWQDILRLVSEP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             S +  +          +L+ +  +   D+ W       KL+MSKQ+I+DE KQ+ G+P
Sbjct: 179 LFSAVTDSLHFAIFCGFFVLIGLIPMVGFDVFWQIWSHLKKLRMSKQDIRDEFKQNEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R+  + +MM    +A +I+TNPTHYA+AL+Y + +  AP ++AKG   IA
Sbjct: 239 HVKGRIRQLQRAMAQRRMMADVPKADVIVTNPTHYAVALQYNEQKMSAPKVLAKGAGEIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++  EH IPI E P LAR+L+K   I   IP   Y AVA+++  +Y  K
Sbjct: 299 LKIRELGNEHKIPILEAPPLARALYKHSEIGKNIPSTLYAAVAEVLVWVYQIK 351


>gi|120554898|ref|YP_959249.1| flagellar biosynthesis protein FlhB [Marinobacter aquaeolei VT8]
 gi|120324747|gb|ABM19062.1| flagellar biosynthetic protein FlhB [Marinobacter aquaeolei VT8]
          Length = 378

 Score =  360 bits (925), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 94/354 (26%), Positives = 176/354 (49%), Gaps = 2/354 (0%)

Query: 1   MSEN-DAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVT 59
           M+E  D    KTE P+ +++E A  EG    S+E +  + +LA    LL F +    S+ 
Sbjct: 1   MAEENDNSQEKTEEPTPRRLEKAKEEGQTARSKELATMAVLLAGAGGLLIFGTSLGASIE 60

Query: 60  SDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLN 119
           S +        +  + D  H+   L   +  A+  + P L++ ++  I   +     + +
Sbjct: 61  SIMRDSFV-IERSAIFDTRHMSVQLILAAKEAAWALSPILVMLLIAAIAGSIGIGGLLFS 119

Query: 120 LNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISA 179
              + P F R+   +G+ R++S+ +L+  +K+  K+ LV  +  + L      +L     
Sbjct: 120 AKAIAPKFNRMDPIKGLGRMFSMRSLIELVKAIAKVGLVMAVAILILNLRTEDLLAIAEE 179

Query: 180 NPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
                + H  +T+      +      +  +D+ +  +    KL+M+KQE+KDE K + G 
Sbjct: 180 PTVPAMEHVLWTLGWSFFFLSCATIAIAAIDVPFQIYDHQKKLRMTKQEVKDEYKDTEGK 239

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLI 299
           P +K + + + R   + +MM+   +A ++ITNPTHYA+AL+Y Q    APV+VAKG + +
Sbjct: 240 PEVKGKIRQLQREMAQRRMMQDVPKADVVITNPTHYAVALKYDQKTMGAPVVVAKGADEV 299

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A K+ +IA E+ + +   P L R+++    I   IP   Y A+AQ++  ++  +
Sbjct: 300 AFKIMEIARENKVEVLRTPPLTRAVYHNTDIGEEIPDGLYMAIAQVLAYVFQLR 353


>gi|170702808|ref|ZP_02893660.1| flagellar biosynthetic protein FlhB [Burkholderia ambifaria
           IOP40-10]
 gi|170132277|gb|EDT00753.1| flagellar biosynthetic protein FlhB [Burkholderia ambifaria
           IOP40-10]
          Length = 399

 Score =  360 bits (925), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 99/353 (28%), Positives = 179/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++  +  ++TEA + ++ E A  EG    SRE + F+ + A         +P    + +
Sbjct: 1   MADE-SDLDRTEAATPRRREKAREEGQVARSRELASFALLAAGFYGAWLLAAPSGAHLQA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L    A   +    D   ++      S+     ++P L L  +  + + +     +++ 
Sbjct: 60  MLRGAFA-FDRATAFDTHRMLSAAGSASIEGLAALLPILALTGLAALLAPMALGGWLISQ 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
              +  F R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +  
Sbjct: 119 KTFELKFDRLNPISGLGRIFSIQGPIQLGMSLAKTLVVGGIGGIAIWRSKDELLGLATQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             S L  A   V       +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P
Sbjct: 179 LGSALADAMHLVAVCCGTTVAGMLVVAALDVPYQIWQYNKKLRMTKEEVKREHRENEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM A  +A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A
Sbjct: 239 HVKGRIRQQQRAIARRRMMAAVPKADVVVTNPTHFAVALQYTDGEMRAPKVVAKGVNLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EHN+P+ E P LAR+L+  V I   IP   Y AVA+++  +Y  +
Sbjct: 299 ARIRELAAEHNVPLLEAPPLARALYHNVEIEREIPGSLYSAVAEVLAWVYQLR 351


>gi|85711029|ref|ZP_01042089.1| flagellar biosynthesis protein [Idiomarina baltica OS145]
 gi|85694942|gb|EAQ32880.1| flagellar biosynthesis protein [Idiomarina baltica OS145]
          Length = 375

 Score =  360 bits (924), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 95/354 (26%), Positives = 174/354 (49%), Gaps = 3/354 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D    +TE P+ K+  +A  +G    S+E      +++  +   F+F   +Y+   
Sbjct: 1   MAETD--QERTEEPTEKRKREAREKGQIARSKEMGTAFVLVSAAVAF-FWFGESLYAGVR 57

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L +  +R+  D S I   L          VI       +F             + 
Sbjct: 58  GLFRDLFTLERRQAFDTSQIYKALAVGFEHIIWPVIIIFAFITLFTFLGNSWLGGINFSW 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++   G KR++    LV  +K   K  +V     + L+  +  +L      
Sbjct: 118 KAMAPKFSRMNPMNGFKRMFGTQALVELVKGIAKFGVVAISAFLLLSWQFDNILQISMGQ 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             S++ +A   +  + ++I   +  + V+D  +   +    L+M+KQEIKDE K S G+P
Sbjct: 178 MPSMIENALDILMWMFLLICCSMFLIVVIDAPFQLWKHNKDLRMTKQEIKDEHKDSEGSP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + +       +MM+   +A +++TNPTH+A+A++Y ++ N AP+L+AKG +  A
Sbjct: 238 EVKGRIRRLQMEMANRRMMQEVPKADVVVTNPTHFAVAIKYEESGNQAPILLAKGTDETA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKKI 354
            K+R+IA E+++P+   P+LARS++    + + IP   + AVAQ++  +Y  K+
Sbjct: 298 AKIREIALEYDVPLVASPALARSIYHTTELETEIPRGLFVAVAQVLAYVYQLKM 351


>gi|315286607|gb|EFU46040.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 110-3]
          Length = 400

 Score =  360 bits (924), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 103/350 (29%), Positives = 188/350 (53%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 20  SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGGVSLARRLSGMLS 79

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       + D + I+  +  L   A   ++P +   ++  I S ++    V +   +
Sbjct: 80  AGL-HFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVAIISPVMLGGLVFSGKSL 138

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 139 QPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPIT 198

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 199 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 258

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 259 GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 318

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 319 REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 368


>gi|119897394|ref|YP_932607.1| flagellar biosynthesis protein FlhB [Azoarcus sp. BH72]
 gi|119669807|emb|CAL93720.1| flagellar biosynthetic protein FlhB [Azoarcus sp. BH72]
          Length = 381

 Score =  360 bits (924), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 102/352 (28%), Positives = 183/352 (51%), Gaps = 2/352 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   KTE  S +++E A  EG  P SRE S F   +  ++ L          +  
Sbjct: 1   MAE-DSDLEKTEPASGRRLEQAREEGQVPQSRELSTFLVTMTGVVTLWLLGEWMAQRLLG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +    A   +    D + I+  L  L   A   ++P  L  ++  + S +     V   
Sbjct: 60  MIRRSFA-FEREMAFDHTLILAELQSLLGGALLTLMPLFLALLVAAVASPIALGGLVFAP 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P+F R++  +G+ R++S++ L   +K+ +K +LVG +    L      + D +   
Sbjct: 119 KALGPNFGRMNPIQGLGRMFSVHGLAEMVKAILKALLVGGVGAAVLWYYKDHLFDLMVEP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               +     TV    ++I   +  L +LD+ +   Q++ +L+M+K+E+K E K+  G+P
Sbjct: 179 LEVGMPDFAETVVFTALLITASLGLLALLDVPFQLWQYHKRLRMTKEEVKREAKEQDGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +++ R   R +MM A  +A +++TNPTH+++AL+Y      APV+VAKG+  +A
Sbjct: 239 QLKGRIRAMQREMARGRMMAAVPKADVVVTNPTHFSVALKYDAERMGAPVVVAKGRGELA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
            K+R+IA E+++P+ E P LAR+L+    +  AIP   Y AVA+++  +Y  
Sbjct: 299 MKIREIARENDVPLLEAPPLARALYAHCELEQAIPAALYTAVAEVMAYVYQL 350


>gi|308048765|ref|YP_003912331.1| flagellar biosynthetic protein FlhB [Ferrimonas balearica DSM 9799]
 gi|307630955|gb|ADN75257.1| flagellar biosynthetic protein FlhB [Ferrimonas balearica DSM 9799]
          Length = 389

 Score =  359 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 96/353 (27%), Positives = 182/353 (51%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+END+   +TE  + ++ E A  +G  P S+E    + ++A    +L        ++ +
Sbjct: 1   MAENDSSQERTEEATPRRREQAREKGQVPRSKELGTAAVLVAAAAGMLMMGGQIGEAMLT 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
                    T+ ++ D+  I  L + +       V+  +L+  + G    +       + 
Sbjct: 61  VAKSQFE-LTRAEVFDLGEISELFSRILSELMVPVLGFVLVLFIAGFLGNIGLGGMSFSW 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   ++S   G KR++ +  LV  +KS  K  ++  +    L+ N+  +L   S N
Sbjct: 120 QAAAPKASKMSPLAGFKRMFGLQALVELVKSIAKFAVIALVAWALLSVNFDQILQLSSGN 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   +  A   + K+ +++   +  + ++D  +       +LKM+KQE+KDE KQ+ G P
Sbjct: 180 PEGAVRDALALLLKLFVLLCSSLLIIVIIDAPYQLWNHNKQLKMTKQEVKDEYKQTEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + + R   + +MM    +A +++ NPTHY++ALRY ++ N+AP++VAKG + IA
Sbjct: 240 EVKGKIRQLQREMAQRRMMAEVPKADVVVVNPTHYSVALRYDKSINNAPLVVAKGTDEIA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA EH +P+   P+LAR+++    ++S IP   + AVAQ++  +Y  K
Sbjct: 300 LKIREIAREHEVPVVSSPALARAVYYSTKLDSPIPEGLFTAVAQILAYVYQLK 352


>gi|221202387|ref|ZP_03575420.1| flagellar biosynthetic protein FlhB [Burkholderia multivorans
           CGD2M]
 gi|221208974|ref|ZP_03581970.1| flagellar biosynthetic protein FlhB [Burkholderia multivorans CGD2]
 gi|221171096|gb|EEE03547.1| flagellar biosynthetic protein FlhB [Burkholderia multivorans CGD2]
 gi|221177801|gb|EEE10215.1| flagellar biosynthetic protein FlhB [Burkholderia multivorans
           CGD2M]
          Length = 399

 Score =  359 bits (922), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 98/353 (27%), Positives = 177/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++  +  ++TEA + ++ E A  EG    SRE + F+ + A          P    + +
Sbjct: 1   MADE-SDLDRTEAATPRRREKAREEGQVARSRELASFALLAAGFYGAWLLAGPAGAHLQA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L    A   +    D   ++      SL     ++P L L     + + +     +++ 
Sbjct: 60  MLRGAFA-FDRATAFDTHRMLSAAGSASLEGLAALLPILALTGAAALLAPMALGGWLISP 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
              +  F R++   G+ RI+SI   +    S  K ++VG I  +++  +   +L   +  
Sbjct: 119 KTFELKFDRLNPVAGLGRIFSIQGPIQLGMSIAKTLVVGGIGGVAIWRSKDELLGLATQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             + L  A   V       +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P
Sbjct: 179 LDTALVDALHLVAVCCGTTVAGMLVVAALDVPYQLWQYNKKLRMTKEEVKREHRENEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM A  +A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A
Sbjct: 239 HVKGRIRQQQRAIARRRMMAAVPKADVVVTNPTHFAVALQYADGEMRAPKVVAKGVNLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EHN+P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 299 ARIRELAAEHNVPLLEAPPLARALYHNVELEREIPGALYSAVAEVLAWVYQLK 351


>gi|115350237|ref|YP_772076.1| flagellar biosynthesis protein FlhB [Burkholderia ambifaria AMMD]
 gi|115280225|gb|ABI85742.1| flagellar biosynthetic protein FlhB [Burkholderia ambifaria AMMD]
          Length = 399

 Score =  359 bits (922), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 98/353 (27%), Positives = 179/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++  +  ++TEA + ++ E A  EG    SRE + F+ + A         +P    + +
Sbjct: 1   MADE-SDLDRTEAATPRRREKAREEGQVARSRELASFALLAAGFYGAWLLAAPSGAHLQA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L    A   +    D   ++      S+     ++P L L  +  + + +     +++ 
Sbjct: 60  MLRGAFA-FDRATAFDTHRMLSAAGSASIEGLAALLPILALTGLAALLAPMALGGWLISQ 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
              +  F R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +  
Sbjct: 119 KTFELKFDRLNPISGLGRIFSIQGPIQLAMSLAKTLVVGGIGGIAIWRSKDELLGLATQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             S +  A   V       +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P
Sbjct: 179 LGSAVADAMHLVAVCCGTTVAGMLVVAALDVPYQIWQYNKKLRMTKEEVKREHRENEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM A  +A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A
Sbjct: 239 HVKGRIRQQQRAIARRRMMAAVPKADVVVTNPTHFAVALQYTDGEMRAPKVVAKGVNLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EHN+P+ E P LAR+L+  V I   IP   Y AVA+++  +Y  +
Sbjct: 299 ARIRELAAEHNVPLLEAPPLARALYHNVEIEREIPGSLYSAVAEVLAWVYQLR 351


>gi|171321732|ref|ZP_02910646.1| flagellar biosynthetic protein FlhB [Burkholderia ambifaria MEX-5]
 gi|171092980|gb|EDT38217.1| flagellar biosynthetic protein FlhB [Burkholderia ambifaria MEX-5]
          Length = 399

 Score =  359 bits (922), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 99/353 (28%), Positives = 180/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++  +  ++TEA + ++ E A  EG    SRE + F+ + A         +P    + +
Sbjct: 1   MADE-SDLDRTEAATPRRREKAREEGQVARSRELASFALLAAGFYGAWLLAAPSGAHLQA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L    A   +    D   ++      S+     ++P L L  +  + + +     +++ 
Sbjct: 60  MLRGAFA-FDRATAFDTHRMLSAAGSASIEGLAALLPILALTGLAALLAPMALGGWLISQ 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
              +  F R++   G+ RI+SI   +  + S  K ++VG I  I++  +   +L   +  
Sbjct: 119 KTFELKFDRLNPISGLGRIFSIQGPIQLLMSLAKTLVVGGIGGIAIWRSKDELLGLATQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             S L  A   V       +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P
Sbjct: 179 LGSALADAMHLVAVCCGTTVAGMLVVAALDVPYQIWQYNKKLRMTKEEVKREHRENEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM A  +A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A
Sbjct: 239 HVKGRIRQQQRAIARRRMMAAVPKADVVVTNPTHFAVALQYTDGEMRAPKVVAKGVNLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EHN+P+ E P LAR+L+  V I   IP   Y AVA+++  +Y  +
Sbjct: 299 ARIRELAAEHNVPLLEAPPLARALYHNVEIEREIPGSLYSAVAEVLAWVYQLR 351


>gi|134294343|ref|YP_001118078.1| flagellar biosynthesis protein FlhB [Burkholderia vietnamiensis G4]
 gi|134137500|gb|ABO53243.1| flagellar biosynthetic protein FlhB [Burkholderia vietnamiensis G4]
          Length = 399

 Score =  359 bits (921), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 97/353 (27%), Positives = 176/353 (49%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++  +  ++TEA + ++ E A  EG    SRE + F+ + A          P    + +
Sbjct: 1   MADE-SDLDRTEAATPRRREKAREEGQVARSRELASFALLAAGFYGTWLVSGPSGAHLQT 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L     +  +    D   ++      S      V+P L L  +  + + +     +++ 
Sbjct: 60  MLRSAF-TFDRATAFDTHRMLSAAGTASAEGLAAVLPILALTGLAALLAPMALGGWLISQ 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
              +  F R+    G+ R++SI   +    S  K ++VG I  +++  +   +L   +  
Sbjct: 119 KTFELKFDRLDPIAGLGRMFSIQGPIQLAMSVAKTMVVGGIGGVAIWRSKDELLGLATQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             + L  A   V       +  +  L  LD+ +   Q+  KL+M+K+E+K E +++ G+P
Sbjct: 179 LGAALADALHLVAVCCGTTVAGMLVLAGLDVPYQLWQYNKKLRMTKEEVKREHRENEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM A  +A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A
Sbjct: 239 HVKGRIRQQQRAIARRRMMAAVPKADVVVTNPTHFAVALQYTDGEMRAPKVVAKGVNLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EHN+P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 299 ARIRELAAEHNVPLLEAPPLARALYHNVELEREIPGSLYSAVAEVLAWVYQLK 351


>gi|312884898|ref|ZP_07744588.1| flagellar biosynthesis protein FlhB [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309367375|gb|EFP94937.1| flagellar biosynthesis protein FlhB [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 376

 Score =  359 bits (921), Expect = 5e-97,   Method: Composition-based stats.
 Identities = 88/353 (24%), Positives = 179/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+D    +TE  + ++++ A  +G    S+E +  S ++   I L++F S     + S
Sbjct: 1   MAESD-GQERTEEATPRRLQQAREKGQVARSKELASVSVLIIGAIALMWFGSFLAKGLFS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L    ++ ++ D+  +  ++          ++  LL+  +  +           ++
Sbjct: 60  VMGRLFD-LSREEIFDLDKLFDIILGSVGELVFPLLLILLVLFLAALIGAAGVGGINFSV 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P + +++   G+KR+  + + V  +KS +K+ LV  +    + +    +       
Sbjct: 119 EAAMPKWSKMNPLSGLKRMVGVQSWVELIKSILKVTLVSGMAFYLINDAKQDLFQLSLDV 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               ++HA   +   +++I   +  +  +D+ +   Q  ++LKM+KQE+KDE K++ G P
Sbjct: 179 YPQNIFHALDILLNFILLISCTLLLVAAIDVPFQIWQHANQLKMTKQEVKDEYKETEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM    +A +I+TNP HY++ALRY Q  + AP++VAKG + +A
Sbjct: 239 EVKGRIRMLQREAAQRRMMAEVPQADVIVTNPEHYSVALRYRQDTDKAPIVVAKGTDHMA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++A EH+I I   P L R+L+    +   IP   + AVAQ++  ++  K
Sbjct: 299 LKIREVAREHDIYIVPAPPLTRALYFSTELEQEIPDGLFTAVAQILAYVFQLK 351


>gi|221214213|ref|ZP_03587185.1| flagellar biosynthetic protein FlhB [Burkholderia multivorans CGD1]
 gi|221165868|gb|EED98342.1| flagellar biosynthetic protein FlhB [Burkholderia multivorans CGD1]
          Length = 399

 Score =  359 bits (921), Expect = 5e-97,   Method: Composition-based stats.
 Identities = 97/353 (27%), Positives = 177/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++  +  ++TEA + ++ E A  EG    SRE + F+ + A          P    + +
Sbjct: 1   MADE-SDLDRTEAATPRRREKAREEGQVARSRELASFALLAAGFYGAWLLAGPAGAHLQA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L    A   +    D   ++      S+     ++P L L     + + +     +++ 
Sbjct: 60  MLRGAFA-FDRATAFDTHRMLSAAGSASVEGLAALLPILALTGAAALLAPMALGGWLISP 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
              +  F R++   G+ RI+SI   +    S  K ++VG I  +++  +   +L   +  
Sbjct: 119 KTFELKFDRLNPVAGLGRIFSIQGPIQLGMSIAKTLVVGGIGGVAIWRSKDELLGLATQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             + L  A   V       +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P
Sbjct: 179 LDTALVDALHLVAVCCGTTVAGMLVVAALDVPYQLWQYNKKLRMTKEEVKREHRENEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM A  +A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A
Sbjct: 239 HVKGRIRQQQRAIARRRMMAAVPKADVVVTNPTHFAVALQYADGEMRAPKVVAKGVNLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EHN+P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 299 ARIRELAAEHNVPLLEAPPLARALYHNVELEREIPGALYSAVAEVLAWVYQLK 351


>gi|293446267|ref|ZP_06662689.1| flagellar biosynthetic protein FlhB [Escherichia coli B088]
 gi|291323097|gb|EFE62525.1| flagellar biosynthetic protein FlhB [Escherichia coli B088]
          Length = 396

 Score =  359 bits (921), Expect = 5e-97,   Method: Composition-based stats.
 Identities = 102/350 (29%), Positives = 188/350 (53%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 16  SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGGVSLARRLSGMLS 75

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       + D + I+  +  L   A   ++P +   ++  + S ++    V +   +
Sbjct: 76  AGL-HFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSGKSL 134

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 135 QPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPIT 194

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 195 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 254

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 255 GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 314

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 315 REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 364


>gi|161523355|ref|YP_001578367.1| flagellar biosynthesis protein FlhB [Burkholderia multivorans ATCC
           17616]
 gi|189351872|ref|YP_001947500.1| flagellar biosynthesis protein FlhB [Burkholderia multivorans ATCC
           17616]
 gi|160340784|gb|ABX13870.1| flagellar biosynthetic protein FlhB [Burkholderia multivorans ATCC
           17616]
 gi|189335894|dbj|BAG44964.1| flagellar biosynthetic protein [Burkholderia multivorans ATCC
           17616]
          Length = 399

 Score =  359 bits (921), Expect = 5e-97,   Method: Composition-based stats.
 Identities = 98/353 (27%), Positives = 178/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++  +  ++TEA + ++ E A  EG    SRE + F+ + A         +P    + +
Sbjct: 1   MADE-SDLDRTEAATPRRREKAREEGQVARSRELASFALLAAGFYGAWLLAAPSGAHLQA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L    A   +    D   ++      SL     ++P L L     + + +     +++ 
Sbjct: 60  MLRGAFA-FDRATAFDTHRMLSAAGSASLEGLAALLPILALTGAAALLAPMALGGWLISP 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
              +  F R++   G+ RI+SI   +    S  K ++VG I  +++  +   +L   +  
Sbjct: 119 KTFELKFDRLNPVAGLGRIFSIQGPIQLGMSIAKTLVVGGIGGVAIWRSKDELLGLATQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             + L  A   V       +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P
Sbjct: 179 LDTALVDALHLVAVCCGTTVAGMLVVAALDVPYQLWQYNKKLRMTKEEVKREHRENEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM A  +A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A
Sbjct: 239 HVKGRIRQQQRAIARRRMMAAVPKADVVVTNPTHFAVALQYADGEMRAPKVVAKGVNLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EHN+P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 299 ARIRELAAEHNVPLLEAPPLARALYHNVELEREIPGALYSAVAEVLAWVYQLK 351


>gi|15802292|ref|NP_288317.1| flagellar biosynthesis protein FlhB [Escherichia coli O157:H7
           EDL933]
 gi|12515942|gb|AAG56870.1|AE005410_6 putative part of export apparatus for flagellar proteins
           [Escherichia coli O157:H7 str. EDL933]
          Length = 382

 Score =  358 bits (920), Expect = 5e-97,   Method: Composition-based stats.
 Identities = 103/350 (29%), Positives = 190/350 (54%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGGVSLARRLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       ++D + I+  +  L   A   ++P +   ++  + S ++    V +   +
Sbjct: 62  AGL-HFDHSIIKDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPHMMRLMAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++ V I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGXENNVPTLEAPPLARALYRHVEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|331647476|ref|ZP_08348568.1| flagellar biosynthetic protein FlhB [Escherichia coli M605]
 gi|330911689|gb|EGH40199.1| flagellar biosynthesis protein FlhB [Escherichia coli AA86]
 gi|331043200|gb|EGI15338.1| flagellar biosynthetic protein FlhB [Escherichia coli M605]
          Length = 382

 Score =  358 bits (920), Expect = 6e-97,   Method: Composition-based stats.
 Identities = 103/350 (29%), Positives = 188/350 (53%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVCVIWFGGVSLARRLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       + D + I+  +  L   A   ++P +   ++  I S ++    V +   +
Sbjct: 62  AGL-HFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVAIISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|15831844|ref|NP_310617.1| flagellar biosynthesis protein FlhB [Escherichia coli O157:H7 str.
           Sakai]
 gi|168747910|ref|ZP_02772932.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4113]
 gi|168757917|ref|ZP_02782924.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4401]
 gi|168762323|ref|ZP_02787330.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4501]
 gi|168770866|ref|ZP_02795873.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4486]
 gi|168776570|ref|ZP_02801577.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4196]
 gi|168783183|ref|ZP_02808190.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4076]
 gi|168789748|ref|ZP_02814755.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC869]
 gi|168801881|ref|ZP_02826888.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC508]
 gi|195939584|ref|ZP_03084966.1| flagellar biosynthesis protein FlhB [Escherichia coli O157:H7 str.
           EC4024]
 gi|208810589|ref|ZP_03252465.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4206]
 gi|208816756|ref|ZP_03257876.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4045]
 gi|208821749|ref|ZP_03262069.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4042]
 gi|209400586|ref|YP_002270964.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4115]
 gi|217328966|ref|ZP_03445047.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           TW14588]
 gi|254793504|ref|YP_003078341.1| flagellar biosynthesis protein FlhB [Escherichia coli O157:H7 str.
           TW14359]
 gi|261227619|ref|ZP_05941900.1| predicted flagellar export pore protein [Escherichia coli O157:H7
           str. FRIK2000]
 gi|261258215|ref|ZP_05950748.1| predicted flagellar export pore protein [Escherichia coli O157:H7
           str. FRIK966]
 gi|13362058|dbj|BAB36013.1| flagellar biosynthesis protein FlhB [Escherichia coli O157:H7 str.
           Sakai]
 gi|187768084|gb|EDU31928.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4196]
 gi|188017418|gb|EDU55540.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4113]
 gi|188999430|gb|EDU68416.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4076]
 gi|189355171|gb|EDU73590.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4401]
 gi|189360277|gb|EDU78696.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4486]
 gi|189367382|gb|EDU85798.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4501]
 gi|189370698|gb|EDU89114.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC869]
 gi|189376036|gb|EDU94452.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC508]
 gi|208725105|gb|EDZ74812.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4206]
 gi|208731099|gb|EDZ79788.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4045]
 gi|208741872|gb|EDZ89554.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4042]
 gi|209161986|gb|ACI39419.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           EC4115]
 gi|209767300|gb|ACI81962.1| flagellar biosynthesis protein FlhB [Escherichia coli]
 gi|209767302|gb|ACI81963.1| flagellar biosynthesis protein FlhB [Escherichia coli]
 gi|209767306|gb|ACI81965.1| flagellar biosynthesis protein FlhB [Escherichia coli]
 gi|217318313|gb|EEC26740.1| flagellar biosynthetic protein FlhB [Escherichia coli O157:H7 str.
           TW14588]
 gi|254592904|gb|ACT72265.1| predicted flagellar export pore protein [Escherichia coli O157:H7
           str. TW14359]
 gi|320188579|gb|EFW63241.1| Flagellar biosynthesis protein FlhB [Escherichia coli O157:H7 str.
           EC1212]
 gi|326342258|gb|EGD66039.1| Flagellar biosynthesis protein FlhB [Escherichia coli O157:H7 str.
           1044]
 gi|326343808|gb|EGD67570.1| Flagellar biosynthesis protein FlhB [Escherichia coli O157:H7 str.
           1125]
          Length = 382

 Score =  358 bits (920), Expect = 6e-97,   Method: Composition-based stats.
 Identities = 103/350 (29%), Positives = 190/350 (54%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGGVSLARRLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       ++D + I+  +  L   A   ++P +   ++  + S ++    V +   +
Sbjct: 62  AGL-HFDHSIIKDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPHMMRLMAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++ V I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGAENNVPTLEAPPLARALYRHVEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|90579940|ref|ZP_01235748.1| flagellar biosynthesis protein [Vibrio angustum S14]
 gi|90438825|gb|EAS64008.1| flagellar biosynthesis protein [Vibrio angustum S14]
          Length = 376

 Score =  358 bits (920), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 89/353 (25%), Positives = 177/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS++D    +TE  + +++E A  +G  P SRE +  + +++  + L++F      +++ 
Sbjct: 1   MSDSD-GQERTEDATPRRLEQAREKGQVPRSRELASVAVLVSGAVGLMWFGEGLSKALSH 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  +  S T+  + D+  +  ++    +     +   L+   +              + 
Sbjct: 60  IMTAMF-SLTRDDIFDLDRLFVIILDAIVYVLAPLFLVLIFLFVAAFIGAAGVGGVRFST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   +++   GIKR++ + + V  +KS +K+ LVG+I    +  +        +  
Sbjct: 119 QAAMPKLSKMNPLSGIKRMFGMQSWVELIKSILKVGLVGSIACYLIFSSLEDFFQLSNEV 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             +  +HA   +   +++I   +  +  +D+ +    +  +LKM+KQEIKDE K S G P
Sbjct: 179 FPANYFHAIDILLNFVLLICCSLLIVVAIDVPFQIWNFNQQLKMTKQEIKDEYKDSEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM    +A ++ITNP H+++ALRY    + APV++AKG + +A
Sbjct: 239 EVKGRIRMLQREMAQRRMMADVPQADVVITNPEHFSVALRYDPKLDSAPVVIAKGGDHLA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA +HNI I     LAR+++    +   IP   + AVAQ++  ++  K
Sbjct: 299 LKIREIANKHNIDIVPAAPLARAIYYTTELEQQIPDGLFVAVAQILAYVFQLK 351


>gi|170683078|ref|YP_001743365.1| flagellar biosynthesis protein FlhB [Escherichia coli SMS-3-5]
 gi|170520796|gb|ACB18974.1| flagellar biosynthetic protein FlhB [Escherichia coli SMS-3-5]
          Length = 382

 Score =  358 bits (920), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 103/350 (29%), Positives = 188/350 (53%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVCVIWFGGVSLARRLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       + D + I+  +  L   A   ++P +   ++  I S ++    V +   +
Sbjct: 62  AGL-HFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVAIISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|218689877|ref|YP_002398089.1| flagellar biosynthesis protein FlhB [Escherichia coli ED1a]
 gi|218427441|emb|CAR08339.2| flagellar export pore protein [Escherichia coli ED1a]
          Length = 382

 Score =  358 bits (919), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 103/350 (29%), Positives = 188/350 (53%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVCVIWFGGVSLARRLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       + D + I+  +  L   A   ++P +   ++  + S ++    V +   +
Sbjct: 62  AGL-HFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKRI+S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRIFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|194434131|ref|ZP_03066400.1| flagellar biosynthetic protein FlhB [Shigella dysenteriae 1012]
 gi|194417675|gb|EDX33775.1| flagellar biosynthetic protein FlhB [Shigella dysenteriae 1012]
 gi|332095083|gb|EGJ00117.1| flagellar biosynthetic protein FlhB [Shigella dysenteriae 155-74]
          Length = 382

 Score =  358 bits (919), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 102/350 (29%), Positives = 187/350 (53%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVCVIWFGGVSLARRLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       + D + I+  +  L   A   ++P +   +   + S ++    V +   +
Sbjct: 62  AGL-HFDHSIINDPNLILGQIILLIREAMLALLPLISGVVPVALISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTVFFLWHHWPQMMRLMAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|281178949|dbj|BAI55279.1| flagellar protein FlhB [Escherichia coli SE15]
          Length = 382

 Score =  358 bits (919), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 103/350 (29%), Positives = 187/350 (53%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGGVSLARRLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       + D + I+  +  L   A   ++P +   ++  I S ++    V +   +
Sbjct: 62  AGL-HFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVAIISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKR +S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRTFSAQTGAELLKAILKTILVGSVTGFFLWYHWPQMMRLMAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|324007265|gb|EGB76484.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 57-2]
          Length = 382

 Score =  358 bits (919), Expect = 8e-97,   Method: Composition-based stats.
 Identities = 103/350 (29%), Positives = 188/350 (53%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGGVSLARRLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       + D + I+  +  L   A   ++P +   ++  I S ++    V +   +
Sbjct: 62  AGL-HFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVAIISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPLT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|218705380|ref|YP_002412899.1| flagellar biosynthesis protein FlhB [Escherichia coli UMN026]
 gi|293405373|ref|ZP_06649365.1| flagellar biosynthetic protein flhB [Escherichia coli FVEC1412]
 gi|298381016|ref|ZP_06990615.1| flagellar biosynthetic protein flhB [Escherichia coli FVEC1302]
 gi|300899130|ref|ZP_07117412.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 198-1]
 gi|218432477|emb|CAR13370.1| flagellar export pore protein [Escherichia coli UMN026]
 gi|291427581|gb|EFF00608.1| flagellar biosynthetic protein flhB [Escherichia coli FVEC1412]
 gi|298278458|gb|EFI19972.1| flagellar biosynthetic protein flhB [Escherichia coli FVEC1302]
 gi|300357248|gb|EFJ73118.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 198-1]
          Length = 382

 Score =  358 bits (919), Expect = 8e-97,   Method: Composition-based stats.
 Identities = 102/350 (29%), Positives = 188/350 (53%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVCVIWFGGVSLARRLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       + D + I+  +  L   A   ++P +   ++  + S ++    V +   +
Sbjct: 62  AGL-HFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|26248146|ref|NP_754186.1| flagellar biosynthesis protein FlhB [Escherichia coli CFT073]
 gi|91211104|ref|YP_541090.1| flagellar biosynthesis protein FlhB [Escherichia coli UTI89]
 gi|110641997|ref|YP_669727.1| flagellar biosynthesis protein FlhB [Escherichia coli 536]
 gi|117624031|ref|YP_852944.1| flagellar biosynthesis protein FlhB [Escherichia coli APEC O1]
 gi|191172970|ref|ZP_03034504.1| flagellar biosynthetic protein FlhB [Escherichia coli F11]
 gi|218558744|ref|YP_002391657.1| flagellar biosynthesis protein FlhB [Escherichia coli S88]
 gi|227885693|ref|ZP_04003498.1| flagellar biosynthesis protein FlhB [Escherichia coli 83972]
 gi|237705835|ref|ZP_04536316.1| flagellar biosynthesis protein FlhB [Escherichia sp. 3_2_53FAA]
 gi|300994042|ref|ZP_07180661.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 45-1]
 gi|301050765|ref|ZP_07197623.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 185-1]
 gi|306814291|ref|ZP_07448457.1| flagellar biosynthesis protein FlhB [Escherichia coli NC101]
 gi|26108550|gb|AAN80753.1|AE016762_6 Flagellar biosynthetic protein flhB [Escherichia coli CFT073]
 gi|91072678|gb|ABE07559.1| flagellar biosynthetic protein FlhB [Escherichia coli UTI89]
 gi|110343589|gb|ABG69826.1| flagellar biosynthetic protein FlhB [Escherichia coli 536]
 gi|115513155|gb|ABJ01230.1| flagellar biosynthesis protein B [Escherichia coli APEC O1]
 gi|190906681|gb|EDV66286.1| flagellar biosynthetic protein FlhB [Escherichia coli F11]
 gi|218365513|emb|CAR03240.1| flagellar export pore protein [Escherichia coli S88]
 gi|226900592|gb|EEH86851.1| flagellar biosynthesis protein FlhB [Escherichia sp. 3_2_53FAA]
 gi|227837266|gb|EEJ47732.1| flagellar biosynthesis protein FlhB [Escherichia coli 83972]
 gi|294491560|gb|ADE90316.1| flagellar biosynthetic protein FlhB [Escherichia coli IHE3034]
 gi|300297582|gb|EFJ53967.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 185-1]
 gi|300406410|gb|EFJ89948.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 45-1]
 gi|305852450|gb|EFM52901.1| flagellar biosynthesis protein FlhB [Escherichia coli NC101]
 gi|307553898|gb|ADN46673.1| flagellar biosynthetic protein FlhB [Escherichia coli ABU 83972]
 gi|307626638|gb|ADN70942.1| flagellar biosynthesis protein FlhB [Escherichia coli UM146]
 gi|315290307|gb|EFU49683.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 153-1]
 gi|323186760|gb|EFZ72080.1| flagellar biosynthetic protein FlhB [Escherichia coli RN587/1]
 gi|323952382|gb|EGB48255.1| flagellar biosynthetic protein FlhB [Escherichia coli H252]
 gi|324013524|gb|EGB82743.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 60-1]
          Length = 382

 Score =  358 bits (918), Expect = 9e-97,   Method: Composition-based stats.
 Identities = 103/350 (29%), Positives = 188/350 (53%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGGVSLARRLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       + D + I+  +  L   A   ++P +   ++  I S ++    V +   +
Sbjct: 62  AGL-HFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVAIISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|300904767|ref|ZP_07122595.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 84-1]
 gi|301306905|ref|ZP_07212951.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 124-1]
 gi|300403281|gb|EFJ86819.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 84-1]
 gi|300837880|gb|EFK65640.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 124-1]
 gi|315257287|gb|EFU37255.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 85-1]
          Length = 382

 Score =  358 bits (918), Expect = 9e-97,   Method: Composition-based stats.
 Identities = 102/350 (29%), Positives = 188/350 (53%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVCVIWFGGVSLARRLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       + D + I+  +  L   A   ++P +   ++  + S ++    V +   +
Sbjct: 62  AGL-HFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLLALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|323968302|gb|EGB63709.1| flagellar biosynthetic protein FlhB [Escherichia coli M863]
 gi|327253009|gb|EGE64663.1| flagellar biosynthetic protein FlhB [Escherichia coli STEC_7v]
          Length = 382

 Score =  358 bits (918), Expect = 9e-97,   Method: Composition-based stats.
 Identities = 102/350 (29%), Positives = 188/350 (53%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVCVIWFGGVSLARRLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       + D + I+  +  L   A   ++P +   ++  + S ++    V +   +
Sbjct: 62  AGL-HFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFYLWHHWPQMMRLMAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|167420299|ref|ZP_02312052.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|166961994|gb|EDR58015.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar
           Orientalis str. MG05-1020]
          Length = 390

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 99/353 (28%), Positives = 182/353 (51%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   K+E P++ K+E A  +G  P SRE +    + A L  L          +++
Sbjct: 1   MAE-DSDQEKSEEPTASKLEKAREKGQIPRSRELTSMLMLGAGLTILWMSGESMARQLSA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L       + +   ++  +  L       ++P     ++  +   ++    + + 
Sbjct: 60  MVAQGL-HFDHSMVSNDKQMLRQIGMLLRQTLLAMLPIFAGLVIVALAVPMLLGGVLFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K   KR+S   G+KR++S   L   +K+ +K  LVG +  + L  N+  M+  I+A 
Sbjct: 119 ESIKFDLKRMSPVAGLKRMFSSQALAELLKAILKATLVGWVTGLFLWHNWPDMMRLIAAP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + L  A   +    ++++L ++ +   D+ +       KL+M+KQ+I+DE K   G+P
Sbjct: 179 PVAALGDALHLIIFCGLVVVLGLSPMVGFDVFYQITSHIKKLRMTKQDIRDEFKNQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A +I+TNPTHYA+AL+Y +++  AP ++AKG   +A
Sbjct: 239 HVKGRIRQQQRAMARRRMMVDVPKADVIVTNPTHYAVALQYNESKMSAPKVLAKGAGAVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++  EH IP+ E P LAR+LF+   +   IP   Y AVA+++  +Y  K
Sbjct: 299 LRIRELGAEHRIPLLEAPPLARALFRHSEVGQHIPATLYAAVAEVLAWVYQLK 351


>gi|289208350|ref|YP_003460416.1| flagellar biosynthetic protein FlhB [Thioalkalivibrio sp. K90mix]
 gi|288943981|gb|ADC71680.1| flagellar biosynthetic protein FlhB [Thioalkalivibrio sp. K90mix]
          Length = 383

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 94/353 (26%), Positives = 172/353 (48%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN++   KTE P+ K++ +A  +G  P SRE S F  ++A   ++ FF       +  
Sbjct: 1   MAENESGQEKTEQPTPKRLREAKEKGQVPRSRELSTFLVLMAAGGFMTFFGPTLGGQLAE 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
                     +    D S ++  L+       R ++P   + M+  + + ++      + 
Sbjct: 61  QTAGRFD-IERDLAYDSSLLLPYLSEQIFMTLRTLLPLFGVLMVAAVLAPILIGGANFSW 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
              KP   +++  +G+KRI+S   L+ F K+F K +LV  +    L      +L      
Sbjct: 120 QAAKPKASKLNPLKGLKRIFSWQGLMEFGKTFAKFVLVAGVAMSVLWTFSDRLLMLGYEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + HA        + +   +  +  +D  +       +L+M++QE+KDE K++ G P
Sbjct: 180 LEQAITHAAQLALGTFVAVSAALILVAAIDAPFQMWNHQKQLRMTRQELKDEYKETDGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + + +   + +MME   +A ++ITNPTHYA+A+ Y  +   AP LVAKG + +A
Sbjct: 240 EVKQKIRQLQQEMAQRRMMEEVPKADVVITNPTHYAVAITYEASRMAAPKLVAKGVDEVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
             +R +A EH I   E P +AR+++    +N  IP   + AVA+++  +Y  K
Sbjct: 300 ASIRAVADEHKIIRVEAPRVARAIYFTTDLNQEIPNGLFVAVARILAYVYQLK 352


>gi|74317263|ref|YP_315003.1| flagellar biosynthetic protein FlhB [Thiobacillus denitrificans
           ATCC 25259]
 gi|74056758|gb|AAZ97198.1| Flagellar biosynthetic protein FlhB [Thiobacillus denitrificans
           ATCC 25259]
          Length = 390

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 108/353 (30%), Positives = 189/353 (53%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  +   +TEAPS +++E A  EG    SRE + F  ++     L    S    +++ 
Sbjct: 1   MAEE-SDQERTEAPSPQRLEKAREEGQVLQSRELATFVVLMTGGAALWAMASQLGQTLSQ 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L         D +H++  L+     A+  + P LLL ++    S ++ R  + + 
Sbjct: 60  IVRGGL-QFHPAVARDSAHVMTQLSQQFFDATLALAPFLLLVVIATFASPILLRGWLFST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P FKR+S   G KR++S   LV  +K+  K+ L+G +    +  N   ++      
Sbjct: 119 KAFMPDFKRLSPLAGFKRMFSSQGLVELVKALAKVGLLGGVAAWLVWSNVEAIVSLSLEA 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + + H    + KV ++    +  + VLD+ +    +Y+KLKM+K++++ E K+S G+P
Sbjct: 179 PTAAIGHMGDIIGKVFLLASGAMIFIVVLDLPYQLWNFYNKLKMTKEQLRQEAKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R ++  R   R +MM     A +++TNPTHYA+AL+Y + +  AP +VAKG +L+A
Sbjct: 239 HVKARIRAQQREVARRRMMAEVPSADVVVTNPTHYAVALKYSEGKMGAPRVVAKGADLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA EH +P+ E P LAR+LF+   I + IP   Y AVA+++  ++  +
Sbjct: 299 AKIREIAAEHRVPLLEAPPLARALFRHTDIGNEIPATLYAAVAEVLAYVFQLR 351


>gi|16129832|ref|NP_416394.1| flagellin export apparatus, substrate specificity protein
           [Escherichia coli str. K-12 substr. MG1655]
 gi|89108720|ref|AP_002500.1| predicted flagellar export pore protein [Escherichia coli str. K-12
           substr. W3110]
 gi|157156351|ref|YP_001463185.1| flagellar biosynthesis protein FlhB [Escherichia coli E24377A]
 gi|170081536|ref|YP_001730856.1| flagellar export pore protein [Escherichia coli str. K-12 substr.
           DH10B]
 gi|193065459|ref|ZP_03046528.1| flagellar biosynthetic protein FlhB [Escherichia coli E22]
 gi|194429326|ref|ZP_03061852.1| flagellar biosynthetic protein FlhB [Escherichia coli B171]
 gi|209919306|ref|YP_002293390.1| flagellar biosynthesis protein FlhB [Escherichia coli SE11]
 gi|218554468|ref|YP_002387381.1| flagellar biosynthesis protein FlhB [Escherichia coli IAI1]
 gi|238901095|ref|YP_002926891.1| putative flagellar export pore protein [Escherichia coli BW2952]
 gi|256017916|ref|ZP_05431781.1| flagellar biosynthesis protein FlhB [Shigella sp. D9]
 gi|260844290|ref|YP_003222068.1| putative flagellar export pore protein FlhB [Escherichia coli
           O103:H2 str. 12009]
 gi|260855820|ref|YP_003229711.1| putative flagellar export pore protein FlhB [Escherichia coli
           O26:H11 str. 11368]
 gi|260868478|ref|YP_003234880.1| putative flagellar export pore protein FlhB [Escherichia coli
           O111:H- str. 11128]
 gi|293410191|ref|ZP_06653767.1| flagellar biosynthetic protein FlhB [Escherichia coli B354]
 gi|293415195|ref|ZP_06657838.1| flagellar biosynthetic protein FlhB [Escherichia coli B185]
 gi|300819864|ref|ZP_07100049.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 107-1]
 gi|300924972|ref|ZP_07140897.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 182-1]
 gi|300951503|ref|ZP_07165338.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 116-1]
 gi|300956607|ref|ZP_07168886.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 175-1]
 gi|301029330|ref|ZP_07192427.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 196-1]
 gi|301327670|ref|ZP_07220877.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 78-1]
 gi|307314208|ref|ZP_07593818.1| flagellar biosynthetic protein FlhB [Escherichia coli W]
 gi|331668576|ref|ZP_08369424.1| flagellar biosynthetic protein FlhB [Escherichia coli TA271]
 gi|331673405|ref|ZP_08374173.1| flagellar biosynthetic protein FlhB [Escherichia coli TA280]
 gi|331677765|ref|ZP_08378440.1| flagellar biosynthetic protein FlhB [Escherichia coli H591]
 gi|332278948|ref|ZP_08391361.1| flagellar biosynthesis protein FlhB [Shigella sp. D9]
 gi|2494574|sp|P76299|FLHB_ECOLI RecName: Full=Flagellar biosynthetic protein flhB
 gi|1736533|dbj|BAA15696.1| predicted flagellar export pore protein [Escherichia coli str. K12
           substr. W3110]
 gi|1788188|gb|AAC74950.1| flagellin export apparatus, substrate specificity protein
           [Escherichia coli str. K-12 substr. MG1655]
 gi|157078381|gb|ABV18089.1| flagellar biosynthetic protein FlhB [Escherichia coli E24377A]
 gi|169889371|gb|ACB03078.1| predicted flagellar export pore protein [Escherichia coli str. K-12
           substr. DH10B]
 gi|192926864|gb|EDV81489.1| flagellar biosynthetic protein FlhB [Escherichia coli E22]
 gi|194412633|gb|EDX28929.1| flagellar biosynthetic protein FlhB [Escherichia coli B171]
 gi|209912565|dbj|BAG77639.1| flagellar protein FlhB [Escherichia coli SE11]
 gi|218361236|emb|CAQ98820.1| flagellar export pore protein [Escherichia coli IAI1]
 gi|222033628|emb|CAP76369.1| flagellar biosynthetic protein flhB [Escherichia coli LF82]
 gi|238862415|gb|ACR64413.1| predicted flagellar export pore protein [Escherichia coli BW2952]
 gi|257754469|dbj|BAI25971.1| predicted flagellar export pore protein FlhB [Escherichia coli
           O26:H11 str. 11368]
 gi|257759437|dbj|BAI30934.1| predicted flagellar export pore protein FlhB [Escherichia coli
           O103:H2 str. 12009]
 gi|257764834|dbj|BAI36329.1| predicted flagellar export pore protein FlhB [Escherichia coli
           O111:H- str. 11128]
 gi|260448997|gb|ACX39419.1| flagellar biosynthetic protein FlhB [Escherichia coli DH1]
 gi|284921799|emb|CBG34872.1| flagellar biosynthesis protein FlhB [Escherichia coli 042]
 gi|291432843|gb|EFF05822.1| flagellar biosynthetic protein FlhB [Escherichia coli B185]
 gi|291470659|gb|EFF13143.1| flagellar biosynthetic protein FlhB [Escherichia coli B354]
 gi|299877756|gb|EFI85967.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 196-1]
 gi|300316589|gb|EFJ66373.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 175-1]
 gi|300418847|gb|EFK02158.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 182-1]
 gi|300449253|gb|EFK12873.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 116-1]
 gi|300527561|gb|EFK48623.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 107-1]
 gi|300845765|gb|EFK73525.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 78-1]
 gi|306906177|gb|EFN36695.1| flagellar biosynthetic protein FlhB [Escherichia coli W]
 gi|312946479|gb|ADR27306.1| flagellar biosynthesis protein FlhB [Escherichia coli O83:H1 str.
           NRG 857C]
 gi|315061186|gb|ADT75513.1| predicted flagellar export pore protein [Escherichia coli W]
 gi|315136523|dbj|BAJ43682.1| flagellar biosynthetic protein FlhB [Escherichia coli DH1]
 gi|323180678|gb|EFZ66223.1| flagellar biosynthetic protein FlhB [Escherichia coli 1180]
 gi|323186344|gb|EFZ71694.1| flagellar biosynthetic protein FlhB [Escherichia coli 1357]
 gi|323378237|gb|ADX50505.1| flagellar biosynthetic protein FlhB [Escherichia coli KO11]
 gi|323940452|gb|EGB36643.1| flagellar biosynthetic protein FlhB [Escherichia coli E482]
 gi|323948234|gb|EGB44222.1| flagellar biosynthetic protein FlhB [Escherichia coli H120]
 gi|324017961|gb|EGB87180.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 117-3]
 gi|324118940|gb|EGC12829.1| flagellar biosynthetic protein FlhB [Escherichia coli E1167]
 gi|331063770|gb|EGI35681.1| flagellar biosynthetic protein FlhB [Escherichia coli TA271]
 gi|331069603|gb|EGI40990.1| flagellar biosynthetic protein FlhB [Escherichia coli TA280]
 gi|331074225|gb|EGI45545.1| flagellar biosynthetic protein FlhB [Escherichia coli H591]
 gi|332101300|gb|EGJ04646.1| flagellar biosynthesis protein FlhB [Shigella sp. D9]
          Length = 382

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 102/350 (29%), Positives = 188/350 (53%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGGVSLARRLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       + D + I+  +  L   A   ++P +   ++  + S ++    V +   +
Sbjct: 62  AGL-HFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|191168095|ref|ZP_03029894.1| flagellar biosynthetic protein FlhB [Escherichia coli B7A]
 gi|309796010|ref|ZP_07690423.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 145-7]
 gi|190901893|gb|EDV61643.1| flagellar biosynthetic protein FlhB [Escherichia coli B7A]
 gi|308120460|gb|EFO57722.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 145-7]
          Length = 382

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 102/350 (29%), Positives = 188/350 (53%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGGVSLARRLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       + D + I+  +  L   A   ++P +   ++  + S ++    V +   +
Sbjct: 62  AGL-HFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFYLWHHWPQMMRLMAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|323174603|gb|EFZ60224.1| flagellar biosynthetic protein FlhB [Escherichia coli LT-68]
          Length = 382

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 102/350 (29%), Positives = 188/350 (53%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVCVIWFGGVSLARRLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       + D + I+  +  L   A   ++P +   ++  + S ++    V +   +
Sbjct: 62  AGL-HFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGVENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|330815159|ref|YP_004358864.1| FlhB [Burkholderia gladioli BSR3]
 gi|327367552|gb|AEA58908.1| FlhB [Burkholderia gladioli BSR3]
          Length = 404

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 99/353 (28%), Positives = 175/353 (49%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   KTE  + ++ E A  EG    SRE S F+ + A          P    + +
Sbjct: 1   MAE-DSDLEKTEEATPRRREKAREEGQVARSRELSSFALLAAGFYGAWMLSGPIGEHLRT 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L    +    D   ++       +     + P L L  +  + + +     +L+ 
Sbjct: 60  MLRGSLG-FDRAAAFDTHAMLTGAGRAGMEGLSALAPVLALTGLAALAAPIALGGWLLSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +   F R++   G+ RI+S+  L+    +  K ++VG I  I++ ++   +L  +   
Sbjct: 119 KAIGFKFDRLNPISGLGRIFSLQGLIQLGMALAKTVVVGGIGGIAIWKSREELLGLMMLP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            H  L      V     + +  +  +  +D+ +   Q+  KL+M+K+E+K E +++ G+P
Sbjct: 179 LHQALADTLHLVAVCCGVTVAGMLVVAGMDVPYQLWQYNKKLRMTKEEVKREHRENEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A +++TNPTH+A+ALRY   E  AP +VAKG NL+A
Sbjct: 239 HVKGRIRQQQRAMARRRMMANVPKADVVVTNPTHFAVALRYTDGEMRAPKVVAKGINLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EH +PI E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 299 ARIRELAEEHRVPILEAPPLARALYHNVELEREIPGPLYSAVAEVLAWVYQLK 351


>gi|254491439|ref|ZP_05104618.1| flagellar biosynthetic protein FlhB [Methylophaga thiooxidans
           DMS010]
 gi|224462917|gb|EEF79187.1| flagellar biosynthetic protein FlhB [Methylophaga thiooxydans
           DMS010]
          Length = 377

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 99/353 (28%), Positives = 185/353 (52%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  +   KTE P++K++++A N+G  P SRE +    ++A  + LLF     I S+  
Sbjct: 1   MAE-QSAQEKTEEPTAKRLDEARNKGQVPRSRELTTVMVLIASAVALLFMGKNIIASMAQ 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            ++    S T+++L D   ++    +   + +  +   L + ++  + +  +      + 
Sbjct: 60  VMNKSF-SFTRKELFDPMAMIHHFIYTIETIAFDLSMFLGVTVLAALAAPALIGGWNFSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P  +R+   +G+KRI+    L+   K+  K ILVG I T  L      +L      
Sbjct: 119 QAMAPKGERMDPLKGLKRIFGPQGLIELAKALGKFILVGVISTAILWSIRDQLLTLGRQE 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            +  +    +    V + I   +  + ++D+ +       +L+M+KQE+KDE+K++ GNP
Sbjct: 179 VNVAMADLGYLTMWVFLAICASLILIALIDVPFQIWNHNRQLRMTKQEVKDEMKETDGNP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + +     + +MM+    A ++ITNPTHYA+ALRY QT+  APV+VAKG + I+
Sbjct: 239 EVKGRIRRMQVELSQQRMMQDIPSADVVITNPTHYAVALRYDQTKTGAPVVVAKGADFIS 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +++R +A  +++PI   P L R+++    I   IP   Y AVAQ++  ++  +
Sbjct: 299 QQIRLVAEHNDVPILSAPPLTRAVYYSTEIGDEIPSGLYIAVAQVLAFVFQLR 351


>gi|22126401|ref|NP_669824.1| flagellar biosynthesis protein FlhB [Yersinia pestis KIM 10]
 gi|45441419|ref|NP_992958.1| flagellar biosynthesis protein FlhB [Yersinia pestis biovar
           Microtus str. 91001]
 gi|108807160|ref|YP_651076.1| flagellar biosynthesis protein FlhB [Yersinia pestis Antiqua]
 gi|108812495|ref|YP_648262.1| flagellar biosynthesis protein FlhB [Yersinia pestis Nepal516]
 gi|145598622|ref|YP_001162698.1| flagellar biosynthesis protein FlhB [Yersinia pestis Pestoides F]
 gi|149366261|ref|ZP_01888296.1| flagellar biosynthetic protein FlhB [Yersinia pestis CA88-4125]
 gi|165925946|ref|ZP_02221778.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165938738|ref|ZP_02227293.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166010865|ref|ZP_02231763.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166210428|ref|ZP_02236463.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|167401110|ref|ZP_02306613.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|167425790|ref|ZP_02317543.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|170024657|ref|YP_001721162.1| flagellar biosynthesis protein FlhB [Yersinia pseudotuberculosis
           YPIII]
 gi|186895104|ref|YP_001872216.1| flagellar biosynthesis protein FlhB [Yersinia pseudotuberculosis
           PB1/+]
 gi|218928912|ref|YP_002346787.1| flagellar biosynthesis protein FlhB [Yersinia pestis CO92]
 gi|229896231|ref|ZP_04511401.1| flagellar biosynthetic protein FlhB [Yersinia pestis Pestoides A]
 gi|229897166|ref|ZP_04512322.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229897892|ref|ZP_04513043.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229902876|ref|ZP_04517993.1| flagellar biosynthetic protein FlhB [Yersinia pestis Nepal516]
 gi|270486660|ref|ZP_06203734.1| flagellar biosynthetic protein FlhB [Yersinia pestis KIM D27]
 gi|294504041|ref|YP_003568103.1| flagellar biosynthesis protein [Yersinia pestis Z176003]
 gi|21959388|gb|AAM86075.1|AE013854_11 flagellar biosynthesis protein [Yersinia pestis KIM 10]
 gi|45436280|gb|AAS61835.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar
           Microtus str. 91001]
 gi|108776143|gb|ABG18662.1| flagellar biosynthetic protein FlhB [Yersinia pestis Nepal516]
 gi|108779073|gb|ABG13131.1| flagellar biosynthetic protein FlhB [Yersinia pestis Antiqua]
 gi|115347523|emb|CAL20431.1| flagellar biosynthetic protein FlhB [Yersinia pestis CO92]
 gi|145210318|gb|ABP39725.1| flagellar biosynthetic protein FlhB [Yersinia pestis Pestoides F]
 gi|149292674|gb|EDM42748.1| flagellar biosynthetic protein FlhB [Yersinia pestis CA88-4125]
 gi|165913352|gb|EDR31974.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165922150|gb|EDR39327.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165990209|gb|EDR42510.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166207608|gb|EDR52088.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|167049499|gb|EDR60907.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|167055189|gb|EDR64986.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|169751191|gb|ACA68709.1| flagellar biosynthetic protein FlhB [Yersinia pseudotuberculosis
           YPIII]
 gi|186698130|gb|ACC88759.1| flagellar biosynthetic protein FlhB [Yersinia pseudotuberculosis
           PB1/+]
 gi|229680323|gb|EEO76422.1| flagellar biosynthetic protein FlhB [Yersinia pestis Nepal516]
 gi|229688933|gb|EEO80998.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229693503|gb|EEO83552.1| flagellar biosynthetic protein FlhB [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229701154|gb|EEO89183.1| flagellar biosynthetic protein FlhB [Yersinia pestis Pestoides A]
 gi|262361772|gb|ACY58493.1| flagellar biosynthesis protein [Yersinia pestis D106004]
 gi|262366091|gb|ACY62648.1| flagellar biosynthesis protein [Yersinia pestis D182038]
 gi|270335164|gb|EFA45941.1| flagellar biosynthetic protein FlhB [Yersinia pestis KIM D27]
 gi|294354500|gb|ADE64841.1| flagellar biosynthesis protein [Yersinia pestis Z176003]
          Length = 386

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 99/353 (28%), Positives = 182/353 (51%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   K+E P++ K+E A  +G  P SRE +    + A L  L          +++
Sbjct: 1   MAE-DSDQEKSEEPTASKLEKAREKGQIPRSRELTSMLMLGAGLTILWMSGESMARQLSA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L       + +   ++  +  L       ++P     ++  +   ++    + + 
Sbjct: 60  MVAQGL-HFDHSMVSNDKQMLRQIGMLLRQTLLAMLPIFAGLVIVALAVPMLLGGVLFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K   KR+S   G+KR++S   L   +K+ +K  LVG +  + L  N+  M+  I+A 
Sbjct: 119 ESIKFDLKRMSPVAGLKRMFSSQALAELLKAILKATLVGWVTGLFLWHNWPDMMRLIAAP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + L  A   +    ++++L ++ +   D+ +       KL+M+KQ+I+DE K   G+P
Sbjct: 179 PVAALGDALHLIIFCGLVVVLGLSPMVGFDVFYQITSHIKKLRMTKQDIRDEFKNQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A +I+TNPTHYA+AL+Y +++  AP ++AKG   +A
Sbjct: 239 HVKGRIRQQQRAMARRRMMVDVPKADVIVTNPTHYAVALQYNESKMSAPKVLAKGAGAVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++  EH IP+ E P LAR+LF+   +   IP   Y AVA+++  +Y  K
Sbjct: 299 LRIRELGAEHRIPLLEAPPLARALFRHSEVGQHIPATLYAAVAEVLAWVYQLK 351


>gi|187478176|ref|YP_786200.1| flagellar biosynthesis protein FlhB [Bordetella avium 197N]
 gi|115422762|emb|CAJ49290.1| flagellar biosynthetic protein [Bordetella avium 197N]
          Length = 380

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 99/353 (28%), Positives = 176/353 (49%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++ D+   KTEA S +++E A  EG    SRE + F  + A +  L          ++ 
Sbjct: 1   MAD-DSDLEKTEAASPRRLEKAREEGQIARSRELTTFLMLAAGVGGLWLVGPSLYRGLSG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   +     R   D + +V         A   ++P   + ++  +   ++    V + 
Sbjct: 60  VMRDGMG-FDPRITHDTTAMVNQAVIGFGQAIWAILPVFGILVVAALLGSVMLGGLVFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++    +++   G+KRI+S   LV  +K+  K +LVG +    +   +  ML  +   
Sbjct: 119 KPLEFKASKLNPLSGLKRIFSSQTLVELIKASAKALLVGGVAGWVIWRYHDEMLGLMHVP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + L  A   V      I+  +  + ++D+ W       KL+MSK++++ E K+S G+P
Sbjct: 179 PPAALASALKLVVLCCAFIVSSLMLVVLIDVPWQIWSHLKKLRMSKEDVRQEHKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R +   R+  R +MM    RA +++TNPTHYA+AL Y ++   AP ++AKG  L+A
Sbjct: 239 HIKARIRQQQRAAARRRMMSQVPRADVVVTNPTHYAVALSYDESGGGAPTVIAKGTGLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EH IP  E P LAR+L + V +   IP   Y AVA+++  ++  +
Sbjct: 299 ARIRELAAEHRIPTLEAPPLARALHQHVELGHEIPAALYTAVAEVLAWVFQLR 351


>gi|51596001|ref|YP_070192.1| flagellar biosynthesis protein FlhB [Yersinia pseudotuberculosis IP
           32953]
 gi|51589283|emb|CAH20904.1| flagellar biosynthetic/export protein FlhB [Yersinia
           pseudotuberculosis IP 32953]
          Length = 386

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 100/353 (28%), Positives = 182/353 (51%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   K+E P++ K+E A  +G  P SRE +    + A L  L          +++
Sbjct: 1   MAE-DSDQEKSEEPTASKLEKAREKGQIPRSRELTSMLMLGAGLTILWMSGESMARQLSA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L       + +   ++  +  L       ++P     ++  +   ++    + + 
Sbjct: 60  MVAQGL-HFDHSMVSNDKQMLRQIGMLLRQTLLAMLPIFAGLVIVALAVPMLLGGVLFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K   KR+S   G+KR++S   L   +K+ +K  LVG +  + L  N+  M+  I+A 
Sbjct: 119 ESIKFDLKRMSPVAGLKRMFSSQALAELLKAILKATLVGWVTGLFLWHNWPDMMRLIAAP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + L  A   +    ++++L ++ +   D+ +       KL+M+KQ+I+DE K   G+P
Sbjct: 179 PVAALGDALHLIIFCGLVVVLGLSPMVGFDVFYQITSHIKKLRMTKQDIRDEFKNQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A II+TNPTHYA+AL+Y +++  AP ++AKG   +A
Sbjct: 239 HVKGRIRQQQRAMARRRMMVDVPKADIIVTNPTHYAVALQYNESKMSAPKVLAKGAGAVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++  EH IP+ E P LAR+LF+   +   IP   Y AVA+++  +Y  K
Sbjct: 299 LRIRELGAEHRIPLLEAPPLARALFRHSEVGQHIPATLYAAVAEVLAWVYQLK 351


>gi|331683387|ref|ZP_08383988.1| flagellar biosynthetic protein FlhB [Escherichia coli H299]
 gi|331079602|gb|EGI50799.1| flagellar biosynthetic protein FlhB [Escherichia coli H299]
          Length = 382

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 102/350 (29%), Positives = 188/350 (53%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGGVSLTRRLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       + D + I+  +  L   A   ++P +   ++  + S ++    V +   +
Sbjct: 62  AGL-HFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRMFSAQTGAELLKAILKSILVGSVTGFYLWHHWPQMMRLMAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|215487092|ref|YP_002329523.1| flagellar biosynthesis protein FlhB [Escherichia coli O127:H6 str.
           E2348/69]
 gi|312967082|ref|ZP_07781300.1| flagellar biosynthetic protein FlhB [Escherichia coli 2362-75]
 gi|215265164|emb|CAS09552.1| predicted flagellar export pore protein FlhB [Escherichia coli
           O127:H6 str. E2348/69]
 gi|312288546|gb|EFR16448.1| flagellar biosynthetic protein FlhB [Escherichia coli 2362-75]
          Length = 382

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 102/350 (29%), Positives = 187/350 (53%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGGVSLARRLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       + D + I+  +  L   A   ++P +   ++  I S ++    V +   +
Sbjct: 62  AGL-HFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVAIISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQ  G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQREGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|220932506|ref|YP_002509414.1| flagellar biosynthetic protein FlhB [Halothermothrix orenii H 168]
 gi|219993816|gb|ACL70419.1| flagellar biosynthetic protein FlhB [Halothermothrix orenii H 168]
          Length = 356

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 104/346 (30%), Positives = 186/346 (53%), Gaps = 1/346 (0%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
               KTE P+ +++  A  +G    S+E S   +++   + L F     IYS+T+ +   
Sbjct: 5   QSGEKTEKPTPRRLRKARQQGQVAKSQELSSAFTLMGGFLVLFFIIKNIIYSLTNRMSYF 64

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           L+     K+ D++ +  L+      A RL+ P LL   + G+    +Q  P+   + +KP
Sbjct: 65  LSLEAYNKINDVNSLYILIDSFYFIA-RLISPVLLASAIIGLVVNFLQVGPLFVPDLIKP 123

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
             K+++   G KR++S+ ++V  +KS  KI +V  +  + L  ++ T+++         +
Sbjct: 124 DLKKINPISGFKRLFSLKSVVELIKSLFKIAIVAILAYLQLKNSWQTLINLSRQGITEAV 183

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
            +    + KV I I++ +  L + D  +   ++   LKM+KQE+K+E K+  G+P IK++
Sbjct: 184 AYLGHLIFKVAITIIICLVVLGIADYIYQKWEYIRNLKMTKQEVKEEHKEIEGDPRIKSK 243

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
           ++   R    ++M++A   A ++ITNPTH A+AL+Y     +APV+VAKG+  IAKK+++
Sbjct: 244 RREKQREMTLNRMIKAMEEADVVITNPTHIAVALKYDINSMEAPVVVAKGEGFIAKKIKE 303

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            A E  I I E   LAR+L     I   IP   Y+AVA+++  +Y 
Sbjct: 304 KARELKIEIVENKPLARALNATTEIGEEIPVDLYQAVAEVLAFLYK 349


>gi|315296540|gb|EFU55837.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 16-3]
          Length = 382

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 103/350 (29%), Positives = 188/350 (53%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGGVALARRLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       + D + I+  +  L   A   ++P +   ++  I S ++    V +   +
Sbjct: 62  AGL-HFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVAIISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|167470753|ref|ZP_02335457.1| flagellar biosynthesis protein FlhB [Yersinia pestis FV-1]
          Length = 386

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 99/353 (28%), Positives = 182/353 (51%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   K+E P++ K+E A  +G  P SRE +    + A L  L          +++
Sbjct: 1   MAE-DSDQEKSEEPTASKLEKAREKGQIPRSRELTSMLMLGAGLTILWMSGESMARQLSA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L       + +   ++  +  L       ++P     ++  +   ++    + + 
Sbjct: 60  MVAQGL-HFGHSMVSNDKQMLRQIGMLLRQTLLAMLPIFAGLVIVALAVPMLLGGVLFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K   KR+S   G+KR++S   L   +K+ +K  LVG +  + L  N+  M+  I+A 
Sbjct: 119 ESIKFDLKRMSPVAGLKRMFSSQALAELLKAILKATLVGWVTGLFLWHNWPDMMRLIAAP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + L  A   +    ++++L ++ +   D+ +       KL+M+KQ+I+DE K   G+P
Sbjct: 179 PVAALGDALHLIIFCGLVVVLGLSPMVGFDVFYQITSHIKKLRMTKQDIRDEFKNQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A +I+TNPTHYA+AL+Y +++  AP ++AKG   +A
Sbjct: 239 HVKGRIRQQQRAMARRRMMVDVPKADVIVTNPTHYAVALQYNESKMSAPKVLAKGAGAVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++  EH IP+ E P LAR+LF+   +   IP   Y AVA+++  +Y  K
Sbjct: 299 LRIRELGAEHRIPLLEAPPLARALFRHSEVGQHIPATLYAAVAEVLAWVYQLK 351


>gi|153947600|ref|YP_001401303.1| flagellar biosynthesis protein FlhB [Yersinia pseudotuberculosis IP
           31758]
 gi|152959095|gb|ABS46556.1| flagellar biosynthetic protein FlhB [Yersinia pseudotuberculosis IP
           31758]
          Length = 386

 Score =  356 bits (915), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 99/353 (28%), Positives = 181/353 (51%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   K+E P++ K+E A  +G  P SRE +    + A L  L          +++
Sbjct: 1   MAE-DSDQEKSEEPTASKLEKAREKGQIPRSRELTSMLMLGAGLTILWMSGESMARQLSA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L       + +   ++  +  L       ++P     ++  +   ++    + + 
Sbjct: 60  MVAQGL-HFDHSMVSNDKQMLRQIGMLLRQTLLAMLPIFAGLVIVALAVPMLLGGVLFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K   KR+S   G+KR++S   L   +K+ +K  LVG +  + L  N+  M+  I+A 
Sbjct: 119 ESIKFDLKRMSPIAGLKRMFSSQALAELLKAILKATLVGWVTGLFLWHNWPDMMRLIAAP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + L  A   +    ++++L +  +   D+ +       KL+M+KQ+I+DE K   G+P
Sbjct: 179 PVAALGDALHLIIFCGLVVVLGLLPMVGFDVFYQITSHIKKLRMTKQDIRDEFKNQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A +I+TNPTHYA+AL+Y +++  AP ++AKG   +A
Sbjct: 239 HVKGRIRQQQRAMARRRMMVDVPKADVIVTNPTHYAVALQYNESKMSAPKVLAKGAGAVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++  EH IP+ E P LAR+LF+   +   IP   Y AVA+++  +Y  K
Sbjct: 299 LRIRELGAEHRIPLLEAPPLARALFRHSEVGQHIPATLYAAVAEVLAWVYQLK 351


>gi|291283062|ref|YP_003499880.1| Flagellar biosynthetic protein FlhB [Escherichia coli O55:H7 str.
           CB9615]
 gi|209767298|gb|ACI81961.1| flagellar biosynthesis protein FlhB [Escherichia coli]
 gi|209767304|gb|ACI81964.1| flagellar biosynthesis protein FlhB [Escherichia coli]
 gi|290762935|gb|ADD56896.1| Flagellar biosynthetic protein FlhB [Escherichia coli O55:H7 str.
           CB9615]
 gi|320641734|gb|EFX11122.1| flagellar biosynthesis protein FlhB [Escherichia coli O157:H7 str.
           G5101]
 gi|320647094|gb|EFX15927.1| flagellar biosynthesis protein FlhB [Escherichia coli O157:H- str.
           493-89]
 gi|320652377|gb|EFX20675.1| flagellar biosynthesis protein FlhB [Escherichia coli O157:H- str.
           H 2687]
 gi|320657978|gb|EFX25740.1| flagellar biosynthesis protein FlhB [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320658551|gb|EFX26245.1| flagellar biosynthesis protein FlhB [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320668449|gb|EFX35276.1| flagellar biosynthesis protein FlhB [Escherichia coli O157:H7 str.
           LSU-61]
          Length = 382

 Score =  356 bits (915), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 102/350 (29%), Positives = 189/350 (54%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGGVSLARRLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       ++D + I+  +  L   A   ++P +   ++  + S ++    V +   +
Sbjct: 62  AGL-HFDHSIIKDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPHMMRLMAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|295097231|emb|CBK86321.1| flagellar biosynthetic protein FlhB [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 381

 Score =  356 bits (915), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 97/353 (27%), Positives = 174/353 (49%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE    D KTE P+  + + A  EG  P SRE +  + +L     ++   S     + S
Sbjct: 1   MSEESESD-KTEDPTPHRKQKAREEGQVPRSRELTTLAMLLVGWGLIVGAGSHLATQLES 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            LH  L +  +  + D  +++     L   A   ++P      +  I +  I      + 
Sbjct: 60  ILHNGL-TFDRLLIRDPQNMLHRAASLLSMAFLAILPFAGGLYVTAITAPSIIGGLNASS 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K + K+++   GIKR++S   +   +KS +K++L  T   + L  N    ++ +   
Sbjct: 119 KALKVNLKKLNPVTGIKRLFSAQMVSEMIKSILKVLLAATGGGLFLLLNKSRFINLMYEP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               L      +   ++ ++L +  +   D+ +     + KL+MS+QEIKDE K   G+P
Sbjct: 179 LGGALNDISNLLIGCMLYVILSLIPMVAFDVIYQLWSNFKKLRMSRQEIKDEFKNQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R + I R   + +MM     A +++ NPTHY++AL+Y +    AP++VA G  LIA
Sbjct: 239 HIKGRVRQIQRQMAQSRMMAEVPTADVVVNNPTHYSVALKYQEGTMGAPIVVASGSGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A E+ +P+ E P LAR+L++       +P   Y AVA+++  +Y  +
Sbjct: 299 LRIREMAEENRVPMLEAPPLARALYRHCEPGQPVPGELYNAVAEVLAWVYSLR 351


>gi|300917538|ref|ZP_07134195.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 115-1]
 gi|300415243|gb|EFJ98553.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 115-1]
          Length = 382

 Score =  356 bits (915), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 102/350 (29%), Positives = 189/350 (54%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVCVIWFGGVSLARRLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       ++D + I+  +  L   A   ++P +   ++  + S ++    V +   +
Sbjct: 62  AGL-HFDHSIIKDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLLAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|297569688|ref|YP_003691032.1| flagellar biosynthetic protein FlhB [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296925603|gb|ADH86413.1| flagellar biosynthetic protein FlhB [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 353

 Score =  356 bits (915), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 97/353 (27%), Positives = 182/353 (51%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  +   KTE P+ +++ +A  +G+   S E    + +LA +I L F        VT 
Sbjct: 1   MAEEQSGQEKTEKPTERRLLEARKKGDVAKSMEVPSAAVLLAGVIVLYFTGERMFNQVTG 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L +     L    ++  +     +S   ++ P +L   +  + +  +Q   +   
Sbjct: 61  MMQFYLGNLDTLNL-SPGNMPAISRQALISIFDVLWPLMLTVFIVALLANYMQIGVLFTT 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +KP  +++   +G  R++S   L NF KS  K+ +VG +    +      +L  +   
Sbjct: 120 EKMKPKLEKIDPLKGFGRLFSKQALANFFKSMAKMGVVGYVAYSEVKRALNEILPLMDKA 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P+ I+     T   + +   L IA +  +D  +   Q+  K+KM+KQ++KDE KQ+ G+P
Sbjct: 180 PYPIVMFMTETAFWIFLKCALAIAIIAAIDYAFQRWQFMEKMKMTKQDMKDEGKQTEGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R ++I     R +MM    +A +++TNPT  A+A++Y      AP ++AKG  ++A
Sbjct: 240 HVKGRIRAIQTEMARKRMMAEVPKADVVVTNPTRLAIAIKYDALTMPAPKVLAKGAGVVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA EH +PI E+  LA++L++ V I+  IP   ++AVA+++  +Y+ +
Sbjct: 300 GKIREIAQEHEVPIVEDKPLAQALYQTVEIDQTIPENLFQAVAEVLAYVYNLR 352


>gi|301018276|ref|ZP_07182787.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 69-1]
 gi|331663378|ref|ZP_08364288.1| flagellar biosynthetic protein FlhB [Escherichia coli TA143]
 gi|300399746|gb|EFJ83284.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 69-1]
 gi|331059177|gb|EGI31154.1| flagellar biosynthetic protein FlhB [Escherichia coli TA143]
          Length = 382

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 101/350 (28%), Positives = 188/350 (53%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    ++  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILVVGVSVIWFGGVSLARRLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       + D + I+  +  L   A   ++P +   ++  + S ++    V +   +
Sbjct: 62  AGL-HFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|260776470|ref|ZP_05885365.1| flagellar biosynthesis protein FlhB [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260607693|gb|EEX33958.1| flagellar biosynthesis protein FlhB [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 376

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 87/353 (24%), Positives = 179/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+D    +TE  + ++++ A  +G    S+E +  S ++   I L++F      ++ +
Sbjct: 1   MAESD-GQERTEDATPRRLQQAREKGQVARSKELASVSVLVIGAIALMWFGESLARALYT 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L    ++ ++ D+  +  +      S    ++  L++  +  +           ++
Sbjct: 60  VMGRLFD-LSRDEIFDLPKLFDIALGSMGSLLGPLLLILVVLFIAALIGAAGIGGISFSV 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P + +++   G+KR+  + + V  +KS +K+ LV  +    +      +       
Sbjct: 119 EAAMPKWSKMNPLSGLKRMVGLQSWVELLKSILKVTLVSGVAFYLIDAAQEDLFQLSMDV 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               ++HA   +   +++I   +  +  +DI +   Q  ++LKM+KQE+KDE K++ G P
Sbjct: 179 YPQNIFHALDILLNFVLLISCSLLIVVAIDIPFQIWQHANQLKMTKQEVKDEYKETEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM    +A +I+TNP H+++ALRY Q  + AP++VAKG + +A
Sbjct: 239 EVKGRIRMLQREAAQRRMMSEVPQADVIVTNPEHFSVALRYKQDTDKAPIVVAKGTDHMA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA EH+I +   P LAR+L+    +   IP   + AVAQ++  ++  K
Sbjct: 299 LKIREIAREHDIYVIPAPPLARALYHSTELEQEIPDGLFTAVAQVLAYVFQLK 351


>gi|27365293|ref|NP_760821.1| flagellar biosynthesis protein FlhB [Vibrio vulnificus CMCP6]
 gi|320155677|ref|YP_004188056.1| flagellar biosynthesis protein FlhB [Vibrio vulnificus MO6-24/O]
 gi|27361440|gb|AAO10348.1| flagellar biosynthetic protein FlhB [Vibrio vulnificus CMCP6]
 gi|319930989|gb|ADV85853.1| flagellar biosynthesis protein FlhB [Vibrio vulnificus MO6-24/O]
          Length = 376

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 89/353 (25%), Positives = 176/353 (49%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+D    +TE  + ++++ A  +G    S+E +  S ++   + L++F      ++  
Sbjct: 1   MAESD-GQERTEEATPRRLQQAREKGQVARSKELASVSVLVIGAVSLMWFGESLARALFK 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L  S ++ ++ D S +  + +    +    ++  L    +              ++
Sbjct: 60  AMGRLF-SLSREEIFDPSKLFDIASGALSALLLPLLLILFALFVAAAIGSAGVGGISFSV 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   +++   GIKR++ + + V  +KS +K+ LV  +    +  +   ++      
Sbjct: 119 EAATPKLSKMNPLSGIKRMFGLQSWVELIKSILKVALVTGVAIYLIQASQEDLIQLSLDV 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               ++HA   +   +++I   +  +  +DI +   Q   +LKM+KQE+KDE K + G P
Sbjct: 179 YPQNIFHALDILLNFVLLISCSLLIVVAIDIPFQIWQHADQLKMTKQEVKDEYKDTEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM     A +I+TNP H+++ALRY Q  + APV+VAKG + +A
Sbjct: 239 EVKGRIRMLQREAAQRRMMADVPTADVIVTNPEHFSVALRYKQNSDRAPVVVAKGTDHMA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++A EH+I I   P LAR+L+    +   IP   + AVAQ++  ++  K
Sbjct: 299 MKIREVAREHDISIVPAPPLARALYYSTELEQQIPDGLFTAVAQILAYVFQLK 351


>gi|330720472|gb|EGG98776.1| Flagellar biosynthesis protein FlhB [gamma proteobacterium
           IMCC2047]
          Length = 378

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 100/352 (28%), Positives = 181/352 (51%), Gaps = 1/352 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+D+   KTE  + K++EDA  +G+ P S+E +  + +L     LL F       +++
Sbjct: 1   MAESDSGQEKTEEATPKRLEDAKKKGDIPRSKELNTTAILLGGTGALLAFGGGISAGLSN 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +       ++  + D   ++  L      +   +IP  ++ M+  I   +     V++ 
Sbjct: 61  MMSANFR-FSRDDIFDPQVMLIHLGQSMAESMMALIPFFIVVMLAAIIGPIALGGWVMSG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P  +R+S   GIKR+++   L+  +K+  K +LV T+  + L      +L     +
Sbjct: 120 KSLAPKGERISPLAGIKRMFAKQALMELLKTIAKFLLVATLSLVILDFMTNDILAIAKED 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H    V   ++ +   +  ++++D+ +       KLKM+ QE+KDE+K + G P
Sbjct: 180 TIPAMAHTLRIVGWSVLAMSCTMILISIIDVPFQISSHAKKLKMTMQEVKDEMKNTEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K+R + +     + +MM A   A ++ITNP HYA+AL+Y      AP+LVAKG + IA
Sbjct: 240 EVKSRIRQLQYDMAQGRMMSAVPEADVVITNPEHYAVALKYNSDNMGAPLLVAKGADHIA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
            K+R+IA  H+IP+ E P LAR++F    +   IP   Y AVAQ++  ++  
Sbjct: 300 FKIREIAKAHDIPVLEAPPLARAVFYSTELEQEIPAGLYVAVAQVLAYVFQL 351


>gi|320198575|gb|EFW73175.1| Flagellar biosynthesis protein FlhB [Escherichia coli EC4100B]
          Length = 382

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 102/350 (29%), Positives = 188/350 (53%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGGVSLARRLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       + D + I+  +  L   A   ++P +   ++  + S ++    V +   +
Sbjct: 62  AGLR-FDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|291278828|ref|YP_003495663.1| flagellar biosynthetic protein FlhB [Deferribacter desulfuricans
           SSM1]
 gi|290753530|dbj|BAI79907.1| flagellar biosynthetic protein FlhB [Deferribacter desulfuricans
           SSM1]
          Length = 359

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 113/353 (32%), Positives = 195/353 (55%), Gaps = 3/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M E +    +TE  + ++ + A  EGN P SRE S     L  +I+L F+    I + + 
Sbjct: 1   MPEKNDA-ERTEEATPRRRQKAREEGNVPKSRELSTAIIFLISVIFLYFYTPILIDNFSK 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L+          S  V L   +     +++ P   L ++ G+   + Q   +++ 
Sbjct: 60  LISHTLSKVGY--TLSKSATVELFNFVFQFYLKVLFPLFALLVVAGLLVNVAQFGFLISP 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P + R++   G++ ++S  +LV  +KS  KI +VG +  I +      +L+   A+
Sbjct: 118 KALEPKWDRLNPINGLQNLFSKRSLVELIKSIFKIFVVGFVAYIIVRGKIGVILNLADAD 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P S +      V ++   I L I  +++LD  +   Q+   LKM+KQE+K+E KQ  G+P
Sbjct: 178 PFSSMVFFGKLVFELCFKIGLLILLMSILDFFYQKWQYEQDLKMTKQEVKEEFKQMEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           +I+ R +S+ R   R +MME   +A ++ITNPTHYA+A++Y   ++ APV+VAKGQ L+A
Sbjct: 238 LIRQRIRSMQREMARKRMMEEVPKADVVITNPTHYAVAIKYDINKDRAPVVVAKGQRLMA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +K+++IA E+ + I E+P LAR+L+ QV I   IP   YKA+A+++  +Y  K
Sbjct: 298 QKIKEIAKENGVFIHEDPPLARTLYSQVEIGDEIPENLYKAIAEILAIVYKMK 350


>gi|331653290|ref|ZP_08354295.1| flagellar biosynthetic protein FlhB [Escherichia coli M718]
 gi|331049388|gb|EGI21460.1| flagellar biosynthetic protein FlhB [Escherichia coli M718]
          Length = 382

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 102/350 (29%), Positives = 190/350 (54%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGGVSLARRLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       ++D + I+  +  L   A   ++P +   ++  + S ++    V +   +
Sbjct: 62  AGL-HFDHSIIKDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKR++S+      +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRMFSVQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGSENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|119469999|ref|ZP_01612804.1| flagellar biosynthesis protein B [Alteromonadales bacterium TW-7]
 gi|119446709|gb|EAW27982.1| flagellar biosynthesis protein B [Alteromonadales bacterium TW-7]
          Length = 376

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 87/353 (24%), Positives = 174/353 (49%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   KTE P+ KKIE++  +G    S+E      ++   I LL +       + +
Sbjct: 1   MAE-DSGQEKTEEPTGKKIEESKKKGQVARSKELGTMFVLIFSAISLLMYGPEIGKGLYN 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  +L S  + +  D + +  + + ++ +    +   + + +  GI    +      + 
Sbjct: 60  IMGRML-SLNRNETYDTTKMFAVWSSVADALIFPMAMFVFIILFAGIIGNTLLGGFNFSW 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   ++S  +G KR++     V   K+ +K ++V +     +   +  +L     +
Sbjct: 119 QAAAPKASKMSPFKGFKRMFGPQAAVELTKAILKFLVVASFAFFLINTFFDEILHLSIES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             + + HA   +  + + +   +  +  +D  +  H  + +LKM+ QE+KDE K S G+P
Sbjct: 179 APNNIIHALEILSWMFLALSCTLVIIAAIDAPYQSHTHHKQLKMTLQEVKDEYKNSEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R +   R   + +MM+    A +++TNPTHY++AL+Y      AP+++AKG + +A
Sbjct: 239 QIKARIRQTQRQMSQKRMMQDVPDADVVVTNPTHYSVALKYDTERAGAPIVLAKGVDELA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++RK+A  +++PI E P L R+L+    +   IP   + AVAQ++  ++  K
Sbjct: 299 MQIRKVAGGNDVPIVESPMLTRALYHTAEVGEQIPDQLFTAVAQVLAYVFQLK 351


>gi|320194407|gb|EFW69038.1| Flagellar biosynthesis protein FlhB [Escherichia coli WV_060327]
          Length = 382

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 103/350 (29%), Positives = 188/350 (53%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGGVALARPLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       + D + I+  +  L   A   ++P +   ++  I S ++    V +   +
Sbjct: 62  AGL-HFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVAIISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|28899010|ref|NP_798615.1| flagellar biosynthesis protein FlhB [Vibrio parahaemolyticus RIMD
           2210633]
 gi|153836930|ref|ZP_01989597.1| flagellar biosynthetic protein FlhB [Vibrio parahaemolyticus
           AQ3810]
 gi|260365244|ref|ZP_05777801.1| flagellar biosynthetic protein FlhB [Vibrio parahaemolyticus K5030]
 gi|260878794|ref|ZP_05891149.1| flagellar biosynthetic protein FlhB [Vibrio parahaemolyticus
           AN-5034]
 gi|260897389|ref|ZP_05905885.1| flagellar biosynthetic protein FlhB [Vibrio parahaemolyticus
           Peru-466]
 gi|260899948|ref|ZP_05908343.1| flagellar biosynthetic protein FlhB [Vibrio parahaemolyticus
           AQ4037]
 gi|4322010|gb|AAD15913.1| polar flagellar assembly protein FlhB [Vibrio parahaemolyticus]
 gi|28807229|dbj|BAC60499.1| polar flagellar assembly protein FlhB [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149749703|gb|EDM60448.1| flagellar biosynthetic protein FlhB [Vibrio parahaemolyticus
           AQ3810]
 gi|308088249|gb|EFO37944.1| flagellar biosynthetic protein FlhB [Vibrio parahaemolyticus
           Peru-466]
 gi|308094200|gb|EFO43895.1| flagellar biosynthetic protein FlhB [Vibrio parahaemolyticus
           AN-5034]
 gi|308107420|gb|EFO44960.1| flagellar biosynthetic protein FlhB [Vibrio parahaemolyticus
           AQ4037]
 gi|308115443|gb|EFO52983.1| flagellar biosynthetic protein FlhB [Vibrio parahaemolyticus K5030]
 gi|328474453|gb|EGF45258.1| flagellar biosynthesis protein FlhB [Vibrio parahaemolyticus 10329]
          Length = 376

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 89/353 (25%), Positives = 174/353 (49%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+D    +TE  + ++++ A  +G    S+E +  S ++   I L++F      S+ S
Sbjct: 1   MAESD-GQERTEEATPRRLQQAREKGQVARSKELASASVLIVGAIALMWFGESLARSLFS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L     + ++ D + +  +           +   L+   +              + 
Sbjct: 60  IMSRLFD-LKRDEIFDTTKLFDIALGAMTDLLFPLFLILITLFVAATIGAAGVGGISFSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   +++   G+KR+  + + V  +KS +K++LV  +    +  +   ++      
Sbjct: 119 EAAMPKLSKMNPLSGLKRMVGMQSWVELIKSILKVVLVTGVAMYLIQASQADLIQLSMDV 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               ++HA   +   +++I   +  +  +DI +   Q   +LKM+KQE+KDE K++ G P
Sbjct: 179 YPQNIFHALDILLNFILLISCSLLIVVAIDIPFQIWQHADQLKMTKQEVKDEYKETEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM    +A +I+TNP HY++ALRY Q  + APV++AKG + +A
Sbjct: 239 EVKGRIRMLQREAAQRRMMADVPQADVIVTNPEHYSVALRYKQKTDRAPVVIAKGTDHMA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++A EH+I I   P LAR+L+    +   IP   + AVAQ++  ++  K
Sbjct: 299 MKIREVAREHDITIVPAPPLARALYHTTELEQEIPDGLFTAVAQVLAFVFQLK 351


>gi|114332395|ref|YP_748617.1| flagellar biosynthesis protein FlhB [Nitrosomonas eutropha C91]
 gi|114309409|gb|ABI60652.1| flagellar biosynthetic protein FlhB [Nitrosomonas eutropha C91]
          Length = 376

 Score =  356 bits (913), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 99/353 (28%), Positives = 185/353 (52%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++ D    +TE  S +++E +  EG    S+E + F+ ++A    L    S  I  +++
Sbjct: 1   MAD-DNDLERTEPASPRRLEKSREEGQVARSQELTTFTMLMAASGSLWVIGSLIIQKLSA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L    +    + + ++  L  L+L     + P L   ++  + S ++    + + 
Sbjct: 60  LLESGL-QIEREVAFNPALLLPRLFQLALDGLLAIAPLLGWLVIVALVSPMLLSGWLFSS 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P FKR++   G KRI+S + L+  +K+  K  ++G +    +  +   +LD I   
Sbjct: 119 KALFPDFKRLNPVNGFKRIFSSHGLIELVKAIAKAAVIGGVAAGIIWSHKQDVLDLIGMP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             + L      +    ++I+  +  L V+D+ +       +L+MSK++++ E K+  G+P
Sbjct: 179 LDTGLTSMGRLIGLTFMLIVGAMLLLVVIDVPFQLWNHARQLRMSKEDLRKEAKEDEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +S+ R   R +MM    RA +++TNPTHYA+AL+Y      AP +VAKG  LIA
Sbjct: 239 QVKARIRSMQREMARRRMMAEVPRADVVVTNPTHYAVALKYQDHSMRAPKVVAKGSQLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EH+IP+ E P LAR+L+  V +++ IP   Y AVA ++  ++  +
Sbjct: 299 ARIRELADEHHIPVLEVPPLARALYHHVELDTEIPETLYTAVAHVLAYVFQLR 351


>gi|157161351|ref|YP_001458669.1| flagellar biosynthesis protein FlhB [Escherichia coli HS]
 gi|170019775|ref|YP_001724729.1| flagellar biosynthesis protein FlhB [Escherichia coli ATCC 8739]
 gi|188494102|ref|ZP_03001372.1| flagellar biosynthetic protein FlhB [Escherichia coli 53638]
 gi|193069902|ref|ZP_03050851.1| flagellar biosynthetic protein FlhB [Escherichia coli E110019]
 gi|194439073|ref|ZP_03071156.1| flagellar biosynthetic protein FlhB [Escherichia coli 101-1]
 gi|218695446|ref|YP_002403113.1| flagellar biosynthesis protein FlhB [Escherichia coli 55989]
 gi|253773163|ref|YP_003035994.1| flagellar biosynthesis protein FlhB [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254161940|ref|YP_003045048.1| flagellar biosynthesis protein FlhB [Escherichia coli B str.
           REL606]
 gi|300822346|ref|ZP_07102487.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 119-7]
 gi|300928913|ref|ZP_07144417.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 187-1]
 gi|301645603|ref|ZP_07245532.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 146-1]
 gi|307138545|ref|ZP_07497901.1| flagellar biosynthesis protein FlhB [Escherichia coli H736]
 gi|331642498|ref|ZP_08343633.1| flagellar biosynthetic protein FlhB [Escherichia coli H736]
 gi|157067031|gb|ABV06286.1| flagellar biosynthetic protein FlhB [Escherichia coli HS]
 gi|169754703|gb|ACA77402.1| flagellar biosynthetic protein FlhB [Escherichia coli ATCC 8739]
 gi|188489301|gb|EDU64404.1| flagellar biosynthetic protein FlhB [Escherichia coli 53638]
 gi|192956802|gb|EDV87256.1| flagellar biosynthetic protein FlhB [Escherichia coli E110019]
 gi|194422032|gb|EDX38036.1| flagellar biosynthetic protein FlhB [Escherichia coli 101-1]
 gi|218352178|emb|CAU97917.1| flagellar export pore protein [Escherichia coli 55989]
 gi|242377601|emb|CAQ32357.1| flagellar biosynthesis protein FlhB, subunit of Flagellar Export
           Apparatus and Flagellum [Escherichia coli BL21(DE3)]
 gi|253324207|gb|ACT28809.1| flagellar biosynthetic protein FlhB [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253973841|gb|ACT39512.1| flagellar biosynthesis protein B [Escherichia coli B str. REL606]
 gi|253978035|gb|ACT43705.1| flagellar biosynthesis protein B [Escherichia coli BL21(DE3)]
 gi|300463067|gb|EFK26560.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 187-1]
 gi|300525229|gb|EFK46298.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 119-7]
 gi|301076135|gb|EFK90941.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 146-1]
 gi|315617894|gb|EFU98492.1| flagellar biosynthetic protein FlhB [Escherichia coli 3431]
 gi|323937138|gb|EGB33418.1| flagellar biosynthetic protein FlhB [Escherichia coli E1520]
 gi|323961935|gb|EGB57534.1| flagellar biosynthetic protein FlhB [Escherichia coli H489]
 gi|323972611|gb|EGB67814.1| flagellar biosynthetic protein FlhB [Escherichia coli TA007]
 gi|331039296|gb|EGI11516.1| flagellar biosynthetic protein FlhB [Escherichia coli H736]
 gi|332089613|gb|EGI94715.1| flagellar biosynthetic protein FlhB [Shigella boydii 5216-82]
 gi|332343606|gb|AEE56940.1| flagellar biosynthetic protein FlhB [Escherichia coli UMNK88]
          Length = 382

 Score =  356 bits (913), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 102/350 (29%), Positives = 189/350 (54%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGGVSLARRLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       ++D + I+  +  L   A   ++P +   ++  + S ++    V +   +
Sbjct: 62  AGL-HFDHSIIKDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|37680652|ref|NP_935261.1| flagellar biosynthesis protein FlhB [Vibrio vulnificus YJ016]
 gi|37199401|dbj|BAC95232.1| flagellar biosynthesis pathway, component FlhB [Vibrio vulnificus
           YJ016]
          Length = 376

 Score =  356 bits (913), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 88/353 (24%), Positives = 176/353 (49%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+D    +TE  + ++++ A  +G    S+E +  S ++   + L++F      ++  
Sbjct: 1   MAESD-GQERTEEATPRRLQQAREKGQVARSKELASVSVLVIGAVSLMWFGESLARALFK 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L  S ++ ++ D S +  + +    +    ++  L    +              ++
Sbjct: 60  AMGRLF-SLSREEIFDPSKLFDIASGALSALLLPLLLILFALFVAAAIGSAGVGGISFSV 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   +++   GIKR++ + + V  +KS +K+ LV  +    +  +   ++      
Sbjct: 119 EAATPKLSKMNPLSGIKRMFGLQSWVELIKSILKVALVTGVAIYLIQASQEDLIQLSLDV 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               ++HA   +   +++I   +  +  +DI +   Q   +LKM+KQE+KDE K + G P
Sbjct: 179 YPQNIFHALDILLNFVLLISCSLLIVVAIDIPFQIWQHADQLKMTKQEVKDEYKDTEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM     A +I+TNP H+++ALRY Q  + AP++VAKG + +A
Sbjct: 239 EVKGRIRMLQREAAQRRMMADVPTADVIVTNPEHFSVALRYKQNSDRAPIVVAKGTDHMA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++A EH+I I   P LAR+L+    +   IP   + AVAQ++  ++  K
Sbjct: 299 MKIREVAREHDISIVPAPPLARALYYSTELEQQIPDGLFTAVAQILAYVFQLK 351


>gi|22034295|gb|AAL01537.1| FlhB [Escherichia fergusonii]
          Length = 381

 Score =  356 bits (913), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 99/353 (28%), Positives = 177/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE +    KTE P+  + + A  EG  P SRE +  S +LA    LL   +     +  
Sbjct: 1   MSEENDS-EKTEDPTPHRKQKAREEGQVPRSRELTSLSMLLAGWGLLLVGGNYLAKQLQH 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            LH  L +  +  + D  H++     L   A   ++P +    +  + +  I     ++ 
Sbjct: 60  LLHNGL-TFDRLLVSDPQHMLHHAAALLGMAFLAILPFVGGLFITALVTPSIIGGLNMSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K + K+++   GIKR++S   +   +KS +K++L G    + L  N    ++ I   
Sbjct: 119 KAIKFNLKKLNPLSGIKRLFSGQMVSEMVKSILKVLLAGIGGGLFLWLNKAKFINLIFEP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               L      +   +++I+L +  +   D+ +     + KL+MS +EIKDE K   G+P
Sbjct: 179 LGMALADISALLIGCMLVIILSLIPMVAFDVIYQLWSNFKKLRMSLKEIKDEFKNQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R + + R   + +MM     A +++ NPTHY++AL+Y +    AP++VA G  LIA
Sbjct: 239 QIKARVRQLQRQMAQQRMMTDVPTADVVVNNPTHYSVALKYQEGAMGAPMVVASGSGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A E+ +P+ E P LAR+L++     + +P   Y AVA+++  +Y  K
Sbjct: 299 LRIRELAEENRVPMLEAPPLARALYRHCDPGTPVPAELYSAVAEVLAWVYGLK 351


>gi|94264043|ref|ZP_01287843.1| Flagellar biosynthetic protein FlhB [delta proteobacterium MLMS-1]
 gi|94266371|ref|ZP_01290070.1| Flagellar biosynthetic protein FlhB [delta proteobacterium MLMS-1]
 gi|93453023|gb|EAT03511.1| Flagellar biosynthetic protein FlhB [delta proteobacterium MLMS-1]
 gi|93455554|gb|EAT05741.1| Flagellar biosynthetic protein FlhB [delta proteobacterium MLMS-1]
          Length = 356

 Score =  356 bits (913), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 95/353 (26%), Positives = 182/353 (51%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  +   KTE P+ +++ +A N+G+   S E    + +LA +I L F        VT 
Sbjct: 1   MAEEQSGQEKTEKPTERRLLEARNKGDVAKSMEVPSAAVLLAGVIVLYFTGEYMFNRVTG 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L++    ++   + +  +   + L    ++ P +L   +  + +  +Q   +   
Sbjct: 61  MMQFYLSNLHDIEI-SAASMPNITRQVMLLIYTVLWPLMLTVFLAALAANYLQVGFLFTA 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P  +++   +G+ R++S   L N  KS  K  LVG I    +      +L      
Sbjct: 120 EKITPKLEKIDPLKGLGRLFSKQTLNNAFKSIAKFSLVGYIAYSEIIRAMPEILPLADKA 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P+ IL     T   + +   +    + ++D  +   Q+  K+KM+KQ++KDE KQS G+P
Sbjct: 180 PYPILVFMVETAFWIFLKCAVLFILIALIDYAFQRWQFMEKMKMTKQDMKDESKQSEGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +SI     + +MM    +A +++TNPTH A+A++Y      AP ++AKG  ++A
Sbjct: 240 HVKGRIRSIQMEMAKKRMMAEVPKADVVVTNPTHLAVAIKYDALTMKAPEVLAKGAGVVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K++++A EH +P+ E+  LA++L++ V I  +IP   ++AVA+++  +Y+ K
Sbjct: 300 NKIKEVAREHQVPVVEDKPLAQALYQNVEIGGSIPENLFQAVAEVLAYVYNLK 352


>gi|312969924|ref|ZP_07784107.1| flagellar biosynthetic protein FlhB [Escherichia coli 1827-70]
 gi|310338209|gb|EFQ03298.1| flagellar biosynthetic protein FlhB [Escherichia coli 1827-70]
          Length = 382

 Score =  355 bits (912), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 102/350 (29%), Positives = 189/350 (54%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGGVSLARRLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       ++D + I+  +  L   A   ++P +   ++  + S ++    V +   +
Sbjct: 62  AGL-HFDHSIIKDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLLALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|317048539|ref|YP_004116187.1| flagellar biosynthetic protein FlhB [Pantoea sp. At-9b]
 gi|316950156|gb|ADU69631.1| flagellar biosynthetic protein FlhB [Pantoea sp. At-9b]
          Length = 384

 Score =  355 bits (912), Expect = 5e-96,   Method: Composition-based stats.
 Identities = 99/353 (28%), Positives = 189/353 (53%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++  + ++KTE+P++ ++E A  +G  P SRE +    +L+ ++ L    +     + S
Sbjct: 1   MADESSDEDKTESPTAHRLEKARQDGQIPRSRELTSLLMMLSGIMILWLGGTSIARRLAS 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +           + D   IV  ++ L   A   V+P +   ++  I + ++    V++ 
Sbjct: 61  MVATGFR-FDHGMVTDDKVIVAHISSLIGQAVLAVLPLMAGLVLVAIAAPMLLGGIVISG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F +++   G+KR+ S       +K+ +K +LVG +    +  ++  ML  IS +
Sbjct: 120 KSLSPDFTKLNPLSGLKRMVSGQTWAELLKAILKAVLVGLVAGWYIWSHWPEMLRLISES 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + L H    +    ++++L +  +   D+ W  + ++ KL+MS+Q+I+DE KQ  G+P
Sbjct: 180 PMNALEHGMDMIAICCVLVMLGLIPMVGFDVFWQLYSYFKKLRMSRQDIRDEFKQQEGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A +I+TNPTHY++AL+Y   +  AP ++AKG   +A
Sbjct: 240 HVKGRIRQAMRAAARRRMMADVPKADVIVTNPTHYSVALQYNDKKMSAPKVIAKGAGEVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++  EH +PI E P LAR+L++   I   IP   Y AVA+++  ++  +
Sbjct: 300 LKIRELGKEHRVPILEAPPLARALYRHTEIGQFIPGALYAAVAEVLAWVWQLR 352


>gi|309702103|emb|CBJ01418.1| flagellar biosynthesis protein FlhB [Escherichia coli ETEC H10407]
          Length = 382

 Score =  355 bits (912), Expect = 5e-96,   Method: Composition-based stats.
 Identities = 102/350 (29%), Positives = 189/350 (54%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGGVSLARRLSDMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       ++D + I+  +  L   A   ++P +   ++  + S ++    V +   +
Sbjct: 62  AGL-HFDHSIIKDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|90021814|ref|YP_527641.1| flagellar biosynthesis protein FlhB [Saccharophagus degradans 2-40]
 gi|89951414|gb|ABD81429.1| flagellar biosynthetic protein FlhB [Saccharophagus degradans 2-40]
          Length = 376

 Score =  355 bits (912), Expect = 5e-96,   Method: Composition-based stats.
 Identities = 91/352 (25%), Positives = 173/352 (49%), Gaps = 1/352 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   KTE P++K+ E A  +G  P S+E +  + ++   + L  F       +  
Sbjct: 1   MAEEDSAQEKTEEPTAKRQEKAREDGQIPRSKELTTSAVLIVGCVGLYMFGGQIAQGLAD 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L     +  +  + D + ++  L        +++IP   + ++  I   +     + + 
Sbjct: 61  ILKFNF-TIEREAIFDPNAMLGHLGSSFYLGLKVLIPLFAVLLVAAIAGPIALGGWLFST 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   R+    G+KR++S+ +LV  +K+  K+ +V     + L      +L      
Sbjct: 120 KSLAPKLNRMDPVAGLKRMFSVKSLVELVKAIGKVGVVVAFAFVLLNYMKEDLLGLGFEG 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+ +      I+I +    +  +DI +       KL+M++QEIKDE+K S G P
Sbjct: 180 VERGMAHSVYLSIIAAIIISVSTLVIAAVDIPFQIWDNVKKLRMTRQEIKDEMKDSEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + +     +++MM A   A ++ITNPTHY++AL+Y     + P+L+AKG + +A
Sbjct: 240 EVKGRIRQLQYEMAQNRMMAAVPEADVVITNPTHYSVALKYDPNSMETPILLAKGVDHMA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
            K+R+IA  + I   + P LAR+++    ++  IP   Y AVAQ++  ++  
Sbjct: 300 MKIREIAKANKIEFIQSPLLARAIYHTTEVDEEIPSGLYVAVAQVLAYVFQI 351


>gi|146307831|ref|YP_001188296.1| flagellar biosynthesis protein FlhB [Pseudomonas mendocina ymp]
 gi|145576032|gb|ABP85564.1| flagellar biosynthetic protein FlhB [Pseudomonas mendocina ymp]
          Length = 378

 Score =  355 bits (912), Expect = 6e-96,   Method: Composition-based stats.
 Identities = 90/353 (25%), Positives = 178/353 (50%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+++   K+E P+SK++E++  +G    S+E +  +  L   + L+ F +     +  
Sbjct: 1   MAESESGAEKSEEPTSKRLEESRKKGQIARSKELNTLAVTLTGTVALIIFGAYMGNVLMD 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +     S  +  L     +   L      A   + P  L  ++  +   +     + + 
Sbjct: 61  LMRGNF-SLPREVLMHEGSMALYLLASGKHALVAIQPLFLALLIASVIGPIALGGWLFSA 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P   R++   G+KR++S+  LV  +K+  K +++  +  + L  +   +L   +  
Sbjct: 120 EALQPKASRMNPLAGLKRMFSVQALVELLKALAKFLVILAVALVVLALDQDDLLAIANEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V      +   +  +  +D+ +       KLKM+KQE++DE K + G P
Sbjct: 180 VEPAILHSLRVVGWSAFWLSCGLILIAAVDVPFQLWSHKQKLKMTKQEVRDEYKDTEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R     +MM+A  +A ++ITNPTH+A+AL+Y   +  AP+L+AKG + +A
Sbjct: 240 EVKGRIRQLQREMAERRMMQAVPQADVVITNPTHFAVALKYDPEKGGAPMLLAKGGDFLA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA EH + + E P+LAR+++    ++  IP   Y AVAQ++  +Y  +
Sbjct: 300 LKIREIAQEHKVMVLESPALARAVYYSTELDQEIPAGLYLAVAQVLAYVYQLR 352


>gi|169827139|ref|YP_001697297.1| flagellar biosynthesis protein FlhB [Lysinibacillus sphaericus
           C3-41]
 gi|168991627|gb|ACA39167.1| Flagellar biosynthetic protein [Lysinibacillus sphaericus C3-41]
          Length = 362

 Score =  355 bits (911), Expect = 6e-96,   Method: Composition-based stats.
 Identities = 103/347 (29%), Positives = 181/347 (52%)

Query: 7   PDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLL 66
              KTE  + KK +DA  +G    S++ +    +L   I+L FF       + +      
Sbjct: 13  SGEKTEKATPKKRQDARKKGQVVKSQDVTSAIVMLMVFIFLFFFAGSLRDELLAFFRQTF 72

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
               + +   I  ++ L     +  + +++P + + ++  +    +Q   +  L  +K  
Sbjct: 73  IHNIRIETLTIDSVMHLFIDTLIQMAFIIVPIMAIAVVGALAGNFLQFGFLFTLEPMKFD 132

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
            K++   +G+KRI+S+  +V  +KS +KI  +G++ TI +  N   +L     +P   L 
Sbjct: 133 LKKMDPIKGLKRIFSVKAIVELLKSVLKIGFIGSVTTIIIWTNLPEVLALSFKSPWITLI 192

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
                V  + I   L +  +++LD  +    +   LKMSKQ+IKDE K S G+P+IK++ 
Sbjct: 193 TVGKLVGIMGIAASLVLLCVSILDWLYQKFDYEKNLKMSKQDIKDEYKNSEGDPLIKSKI 252

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           K   R     +MM     A ++ITNPTHYA+AL+Y +   DAP ++AKG + IA+K++ I
Sbjct: 253 KQRQREMAMRRMMSEIPSADVVITNPTHYAIALKYDEESMDAPRVIAKGTDFIAQKIKLI 312

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A EH++ + E   LAR+++ QV I   +P  F+KAVA+++  +Y  K
Sbjct: 313 AKEHDVIMVENRPLARAMYDQVEIGDPVPEEFFKAVAEILAYVYRIK 359


>gi|162139338|ref|YP_689375.2| flagellar biosynthesis protein FlhB [Shigella flexneri 5 str. 8401]
          Length = 397

 Score =  355 bits (911), Expect = 7e-96,   Method: Composition-based stats.
 Identities = 103/350 (29%), Positives = 188/350 (53%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGGVSLARRLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       ++D + I+  +  L   A   ++P +   ++  + S ++    V +   +
Sbjct: 62  AGL-HFDHSIIKDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKRI+S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRIFSAQTSAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R   + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRICQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|256022455|ref|ZP_05436320.1| flagellar biosynthesis protein FlhB [Escherichia sp. 4_1_40B]
          Length = 382

 Score =  355 bits (911), Expect = 7e-96,   Method: Composition-based stats.
 Identities = 101/350 (28%), Positives = 187/350 (53%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGGVSLARRLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       + D + I+  +  L   A   ++P +   ++  + S ++    V +   +
Sbjct: 62  AGL-HFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P   +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKCSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|254228444|ref|ZP_04921870.1| flagellar biosynthetic protein FlhB [Vibrio sp. Ex25]
 gi|262393601|ref|YP_003285455.1| flagellar biosynthesis protein FlhB [Vibrio sp. Ex25]
 gi|151939032|gb|EDN57864.1| flagellar biosynthetic protein FlhB [Vibrio sp. Ex25]
 gi|262337195|gb|ACY50990.1| flagellar biosynthesis protein FlhB [Vibrio sp. Ex25]
          Length = 376

 Score =  355 bits (911), Expect = 7e-96,   Method: Composition-based stats.
 Identities = 88/353 (24%), Positives = 173/353 (49%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+D    +TE  + ++++ A  +G    S+E +  S ++   I L++F      S+ S
Sbjct: 1   MAESD-GQERTEEATPRRLQQAREKGQVARSKELASASVLIVGAISLMWFGEALARSLFS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L     + ++ D + +  +           +   L       +           + 
Sbjct: 60  IMSRLFD-LQREEIFDTAKLFDIALGAMTDLLFPLFLVLATLFTAAMIGAAGVGGISFSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   +++   G+KR+  + + V  +KS +K++LV  +    +  +   ++      
Sbjct: 119 QAAMPKLSKMNPLSGLKRMVGMQSWVELIKSILKVVLVTGVAIYLIQASQADLIQLSMDV 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               ++HA   +   +++I   +  +  +DI +   Q   +LKM+KQE+KDE K++ G P
Sbjct: 179 YPQNIFHALDILLNFILLISCSLLIVVAIDIPFQIWQHADQLKMTKQEVKDEYKETEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM    +A +I+TNP H+++ALRY Q  + APV++AKG + +A
Sbjct: 239 EVKGRIRMLQREAAQRRMMADVPQADVIVTNPEHFSVALRYKQKTDRAPVVIAKGTDHMA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++A EH+I I   P LAR+L+    +   IP   + AVAQ++  ++  K
Sbjct: 299 MKIREVAREHDITIVPAPPLARALYHTTELEQEIPDGLFTAVAQVLAFVFQLK 351


>gi|330502779|ref|YP_004379648.1| flagellar biosynthesis protein FlhB [Pseudomonas mendocina NK-01]
 gi|328917065|gb|AEB57896.1| flagellar biosynthesis protein FlhB [Pseudomonas mendocina NK-01]
          Length = 378

 Score =  355 bits (911), Expect = 7e-96,   Method: Composition-based stats.
 Identities = 90/353 (25%), Positives = 178/353 (50%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+++  +K+E P+ K++E++  +G    S+E +  +  L   + L+ F +     +  
Sbjct: 1   MAESESGADKSEEPTGKRLEESRKKGQIARSKELNTLAVTLTGTVALIIFGAYMGNVLMD 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +     S  +  L     +   L      A   V P LL  ++  +   +     + + 
Sbjct: 61  IMRGNF-SLPREVLMSERSMALYLLASGKEALLAVQPFLLALLIASVAGPIALGGWLFSA 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P   R++   G+KR++S+  LV  +K+  K +++  +  + L  +   +L   +  
Sbjct: 120 EALQPKASRMNPLAGLKRMFSVQALVELVKALAKFLVILAVALVVLAIDQDDLLAIANEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V      +   +  +  +D+ +       KL M+KQE++DE K + G P
Sbjct: 180 VEPAILHSLRVVGWSAFWLSCGLILIAAVDVPFQLWSHKQKLMMTKQEVRDEYKDTEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R     +MM+A  +A ++ITNPTH+A+AL+Y   +  AP+L+AKG + +A
Sbjct: 240 EVKGRIRQLQREMAERRMMQAVPQADVVITNPTHFAVALKYDPEKGGAPMLLAKGGDFLA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA EH + + E P+LAR+++    ++  IP   Y AVAQ++  +Y  +
Sbjct: 300 LKIREIAQEHQVMVLESPALARAVYYSTELDQEIPAGLYLAVAQVLAYVYQLR 352


>gi|91223558|ref|ZP_01258823.1| flagellar biosynthesis protein B [Vibrio alginolyticus 12G01]
 gi|269965690|ref|ZP_06179803.1| Flagellar biosynthetic protein flhB [Vibrio alginolyticus 40B]
 gi|91191644|gb|EAS77908.1| flagellar biosynthesis protein B [Vibrio alginolyticus 12G01]
 gi|269829758|gb|EEZ83994.1| Flagellar biosynthetic protein flhB [Vibrio alginolyticus 40B]
          Length = 376

 Score =  354 bits (910), Expect = 8e-96,   Method: Composition-based stats.
 Identities = 88/353 (24%), Positives = 173/353 (49%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+D    +TE  + ++++ A  +G    S+E +  S ++   I L++F      S+ S
Sbjct: 1   MAESD-GQERTEEATPRRLQQAREKGQVARSKELASASVLIVGAISLMWFGEALARSLFS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L     + ++ D + +  +           +   L       +           + 
Sbjct: 60  IMSRLFD-LQREEIFDTAKLFDIALGAMSDLLFPLFLVLATLFTAAMIGAAGVGGISFSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   +++   G+KR+  + + V  +KS +K++LV  +    +  +   ++      
Sbjct: 119 QAAMPKLSKMNPLSGLKRMVGMQSWVELIKSILKVVLVTGVAIYLIQASQADLIQLSMDV 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               ++HA   +   +++I   +  +  +DI +   Q   +LKM+KQE+KDE K++ G P
Sbjct: 179 YPQNIFHALDILLNFILLISCSLLIVVAIDIPFQIWQHADQLKMTKQEVKDEYKETEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM    +A +I+TNP H+++ALRY Q  + APV++AKG + +A
Sbjct: 239 EVKGRIRMLQREAAQRRMMADVPQADVIVTNPEHFSVALRYKQKTDRAPVVIAKGTDHMA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++A EH+I I   P LAR+L+    +   IP   + AVAQ++  ++  K
Sbjct: 299 MKIREVAREHDITIVPAPPLARALYHTTELEQEIPDGLFTAVAQVLAFVFQLK 351


>gi|24113260|ref|NP_707770.1| flagellar biosynthesis protein FlhB [Shigella flexneri 2a str. 301]
 gi|30063328|ref|NP_837499.1| flagellar biosynthesis protein FlhB [Shigella flexneri 2a str.
           2457T]
 gi|24052262|gb|AAN43477.1| putative part of export apparatus for flagellar proteins [Shigella
           flexneri 2a str. 301]
 gi|30041580|gb|AAP17308.1| putative part of export apparatus for flagellar proteins [Shigella
           flexneri 2a str. 2457T]
 gi|281601322|gb|ADA74306.1| putative part of export apparatus for flagellar proteins [Shigella
           flexneri 2002017]
 gi|313650088|gb|EFS14501.1| flagellar biosynthetic protein FlhB [Shigella flexneri 2a str.
           2457T]
 gi|332757344|gb|EGJ87681.1| flagellar biosynthetic protein FlhB [Shigella flexneri 2747-71]
 gi|332757435|gb|EGJ87770.1| flagellar biosynthetic protein FlhB [Shigella flexneri K-671]
 gi|332766606|gb|EGJ96810.1| flagellar biosynthetic protein FlhB [Shigella flexneri 2930-71]
 gi|333017652|gb|EGK36964.1| flagellar biosynthetic protein FlhB [Shigella flexneri K-304]
          Length = 397

 Score =  354 bits (910), Expect = 8e-96,   Method: Composition-based stats.
 Identities = 103/350 (29%), Positives = 188/350 (53%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGGVSLARRLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       ++D + I+  +  L   A   ++P +   ++  + S ++    V +   +
Sbjct: 62  AGL-HFDHSIIKDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKRI+S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRIFSAQTSAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R   + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRICQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|296103646|ref|YP_003613792.1| flagellar biosynthetic protein FlhB [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295058105|gb|ADF62843.1| flagellar biosynthetic protein FlhB [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 381

 Score =  354 bits (909), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 94/353 (26%), Positives = 174/353 (49%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE +    KTE P+  + + A  EG  P SRE +    +LA    LL         +  
Sbjct: 1   MSEQNDS-EKTEDPTPHRKQKAREEGQVPRSRELTSLLMLLAGWGLLLVAGGWLAKQLLH 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            LH  L +  +  + D   ++     L   A   ++P +    +  + +  +     ++ 
Sbjct: 60  LLHNGL-TFDRLLVSDPQQMLHHAGSLLGMAFLALLPFVGGLFLTAVATPSLIGGLNMSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K + K+++   GIKR++S   +   +KS +K+ L G    + L  N    +  +   
Sbjct: 119 KALKFNVKKLNPISGIKRLFSAQMVSEMVKSILKVTLAGIGGGLFLWFNKGKFISLMYEP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               L      +   +++I+L +  +   D+ +     + KL+MS +EIKDE K   G+P
Sbjct: 179 LRMALGDISALLMGCMLVIILSLIPMVAFDVVYQLWSNFKKLRMSLKEIKDEFKNQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           +IK++ + + R   + +MM     A +++ NPTHY++AL+Y +    AP++VA G  LIA
Sbjct: 239 LIKSKVRQLQRQMAQQRMMSDVPTADVVVNNPTHYSVALKYQEGAMGAPMVVASGSGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A E+ +P+ E P LAR+L++     + +P   Y AVA+++  +Y  K
Sbjct: 299 LRIRELAEENRVPMLEAPPLARALYRHCDPGTPVPAELYSAVAEVLAWVYGLK 351


>gi|90411036|ref|ZP_01219050.1| flagellar biosynthesis protein [Photobacterium profundum 3TCK]
 gi|90328249|gb|EAS44560.1| flagellar biosynthesis protein [Photobacterium profundum 3TCK]
          Length = 376

 Score =  354 bits (909), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 86/353 (24%), Positives = 177/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+D    +TE  +++K+E A  +G    S+E +  + ++   + L+++      ++  
Sbjct: 1   MAESD-GQERTEDATARKLEQAREKGQVARSKELASVAVLVMGAVSLMWYGEGLGKALAE 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  +  S ++ ++ D++ +  ++     S    +   L++     +           + 
Sbjct: 60  IMTQMF-SLSREEIYDLNRLFSIMLTAIWSVVFPLGLVLIVLFTAALIGAAGLGGVSFSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   +++   G KR++ + + V  +KS +K++LV  +    +  +           
Sbjct: 119 EAAMPKLSKMNPMSGFKRMFGMQSWVELIKSILKVLLVTGVAAYLMYSSLNDFFLLSLEI 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             S ++HA   + + +++I   +  +  +D+ +   Q   +LKM+KQE+KDE K + G P
Sbjct: 179 YPSNIFHALDILMQFILLICCSLLVIVAIDVPYQIWQHNEQLKMTKQEVKDEYKDTEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM    +A +IITNP H+++ALRY    + AP+++AKG +  A
Sbjct: 239 EVKGRIRMLQREMAQRRMMADVPQADVIITNPEHFSVALRYDPKLDSAPIVIAKGVDHAA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA +HNI I   P LAR+++    +   IP   + AVAQ++  I+  K
Sbjct: 299 LKIREIANKHNIDIVPAPPLARAIYHTTELEQHIPDGLFVAVAQVLAYIFQLK 351


>gi|3169254|gb|AAC17834.1| flagellar protein FlhB [Escherichia coli]
          Length = 382

 Score =  354 bits (909), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 103/350 (29%), Positives = 189/350 (54%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGGVSLARRLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       + D + I+  +  L   A   ++P +   ++  + S ++    V +   +
Sbjct: 62  AGL-HFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+R R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRIRQMQRARARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGAENNVPTLEAPRLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|212709483|ref|ZP_03317611.1| hypothetical protein PROVALCAL_00525 [Providencia alcalifaciens DSM
           30120]
 gi|212687821|gb|EEB47349.1| hypothetical protein PROVALCAL_00525 [Providencia alcalifaciens DSM
           30120]
          Length = 383

 Score =  354 bits (908), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 101/353 (28%), Positives = 181/353 (51%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS+  +   KTE P+  K + A ++G    S+E S    +LA +  L          +  
Sbjct: 1   MSDE-SDVEKTEEPTPHKKQKAKDDGQIVRSKELSSLMMMLAGVSLLWLSGGHLATQLRQ 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +           L++   ++  L  +   A   ++P +    + GI +  +    + N 
Sbjct: 60  IMRQGFI-FDGHYLQNTGLMLSYLGRVVSEALFALLPIIGGLALVGISASSLVGGLLFNS 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K   K+++  +G+KRI+S+N L    K+ +K + VG   +I L +++ ++L  +   
Sbjct: 119 KLIKFDLKKLNPIKGLKRIFSMNALSELFKAILKCVFVGLGASIFLWQSWPSLLHLVMEP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + L +A   V     +I+  +  +   D+ + +     KL+MS+QEIKDE KQ  G+P
Sbjct: 179 PTTALANALEKVIFAGYLIVFLLIPMVAFDVFYQFRSHLKKLRMSRQEIKDEFKQQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK + +   R+  R++MM     A +I+TNPTHYA+AL+Y   +  AP ++AKG  +IA
Sbjct: 239 HIKAKIRQQQRAIARNRMMADVPSADVIVTNPTHYAVALKYDDKKMGAPKVLAKGAGVIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +++++I  EH I   E P LAR+L++   I  +IP   Y AVA+++  +Y  +
Sbjct: 299 QRIKEIGAEHRILQLEAPPLARALYRHAEIGQSIPVALYAAVAEVLAWVYQLR 351


>gi|156975417|ref|YP_001446324.1| flagellar biosynthesis protein FlhB [Vibrio harveyi ATCC BAA-1116]
 gi|156527011|gb|ABU72097.1| hypothetical protein VIBHAR_03148 [Vibrio harveyi ATCC BAA-1116]
          Length = 376

 Score =  354 bits (908), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 90/353 (25%), Positives = 175/353 (49%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+D    +TE  + ++++ A  +G    S+E +  S ++   I L++F      S+ S
Sbjct: 1   MAESD-GQERTEEATPRRLQQAREKGQVARSKELASASVLIVGAIALMWFGESLARSLFS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L    T+ ++ D + +  +           +   L+   +  +           + 
Sbjct: 60  IMSRLFD-LTRDEIFDTAKLFDIAFGAMTDLLFPLFLILITLFVAAMIGAAGVGGISFSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   +++   G+KR+  + + V  +KS +K+ LV  +    +  +   ++      
Sbjct: 119 EAAMPKLSKMNPLSGLKRMVGMQSWVELIKSILKVALVTGMAIYLIQASQADLIQLSMDV 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               ++HA   +   +++I   +  +  +DI +   Q   +LKM+KQE+KDE K++ G P
Sbjct: 179 YPQNIFHALDILLNFILLISCSLLIVVAIDIPFQIWQHADQLKMTKQEVKDEYKETEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM    +A +IITNP H+++ALRY Q  + APV++AKG + +A
Sbjct: 239 EVKGRIRMLQREAAQRRMMADVPQADVIITNPEHFSVALRYKQKTDRAPVVIAKGTDHMA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++A EH+I I   P LAR+L+    +   IP   + AVAQ++  ++  K
Sbjct: 299 MKIREVAREHDITIVPAPPLARALYHTTELEQEIPDGLFTAVAQVLAFVFQLK 351


>gi|83654182|gb|ABC38245.1| flagellar biosynthetic protein FlhB [Burkholderia thailandensis
           E264]
          Length = 459

 Score =  354 bits (908), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 101/350 (28%), Positives = 179/350 (51%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+   +TEA + K+ E A  EG    SRE + F+ + A          P    + + LH
Sbjct: 61  EDSDLERTEAATPKRREKAREEGQVARSRELASFALLSAGFYGAWMLSGPIGEHLRTMLH 120

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
               S  +    D + ++     LSL     ++P L L  +  + + +     +++    
Sbjct: 121 TAF-SFDRATAFDTNRMLSHAGILSLEGLYALVPVLALTGVAALAAPMALGGWLVSTKTF 179

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +  F+R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +   H+
Sbjct: 180 ELKFERLNPVAGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELLGLATQPLHA 239

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            L  A   +     M +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P +K
Sbjct: 240 ALADALHLIAVCCGMTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEVKREHRENEGDPHVK 299

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R +   R+  R +MM     A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A ++
Sbjct: 300 GRIRQQQRAMARRRMMANVPTADVVVTNPTHFAVALKYTDGEMRAPKVVAKGVNLVAARI 359

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R++A EH++P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 360 RELAAEHHVPLLEAPPLARALYHNVDLEREIPGTLYSAVAEVLAWVYQLK 409


>gi|86146123|ref|ZP_01064449.1| flagellar biosynthesis protein [Vibrio sp. MED222]
 gi|218708836|ref|YP_002416457.1| flagellar biosynthesis protein FlhB [Vibrio splendidus LGP32]
 gi|85836070|gb|EAQ54202.1| flagellar biosynthesis protein [Vibrio sp. MED222]
 gi|218321855|emb|CAV17833.1| Flagellar biosynthetic protein flhB [Vibrio splendidus LGP32]
          Length = 376

 Score =  354 bits (908), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 91/353 (25%), Positives = 180/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+D    +TE  + K+++ A  +G    S+E +  S ++   I L++F      ++  
Sbjct: 1   MAESD-GQERTEDATPKRLQQAKEKGQVARSKELASASVLIVGAIALMWFGESMAKALFE 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L  S ++ ++ D + ++ +     ++    +   L+   +  +           ++
Sbjct: 60  TMQRLF-SLSREEVFDTTKLLEIAGGALVNLLFPLFLILITLFVAAVIGAAGVGGINFSM 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   +++   GIKR++ + + V  +KS +K+ LV  +    +  +   ++      
Sbjct: 119 QAAMPKASKLNPLSGIKRMFGLQSWVELLKSILKVALVSGMAIYLIQASQHDLMQLSMEV 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               ++HA   +   +++I   +  +  +DI +   Q   +LKM+KQEIKDE K + G P
Sbjct: 179 YPQNIFHALDILLNFILLISCSLLIVVAIDIPFQIWQHADQLKMTKQEIKDEHKDTEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM    +A +I+TNP H+++ALRY Q ++ APV+VAKG + +A
Sbjct: 239 EVKGRIRMLQREAAQRRMMADVPQADVIVTNPEHFSVALRYKQNQDKAPVVVAKGVDHMA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA E++I I   P LAR+L+    +   IP   + AVAQ++  ++  K
Sbjct: 299 MKIREIARENDIYIVPAPPLARALYHTTELEQQIPDGLFTAVAQVLAYVFQLK 351


>gi|117617532|ref|YP_855917.1| flagellar biosynthetic protein FlhB [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117558939|gb|ABK35887.1| flagellar biosynthetic protein FlhB [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 376

 Score =  354 bits (908), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 92/354 (25%), Positives = 172/354 (48%), Gaps = 4/354 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++ D    +TE P+ K+++ A  +G    S+E    S +LA +  LL        ++  
Sbjct: 1   MADTD--QERTEQPTGKRLQQAREKGQIARSKELGTASVLLAAVFGLLMVKESLAGAMVK 58

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L +   +  + +  D + ++ +L  L       +    +L  +      ++      + 
Sbjct: 59  VLTMGF-TLDREQAFDPNAMMTMLPALLRELLHPLGLLFMLVAIAAFVGNILMGGMNFSS 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P + ++S   GIKR++ + +LV  +KS  K++ +       L+  +  +L+     
Sbjct: 118 EAMLPKWSKLSPLNGIKRMFGVQSLVELVKSIAKVVFISLFAWWMLSSQFNHLLNLSLEG 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               +  A   +  +LI++   +  +  +D+ +       +LKM+KQE+KDE K S G P
Sbjct: 178 YPGGIIDALDLLLWMLIILCCALIPIVAIDVPFQQWNHMRQLKMTKQEVKDEFKDSEGKP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYI-QTENDAPVLVAKGQNLI 299
            +K R + +       +MM    +A ++ITNPTHY++AL+Y       AP +VAKG + I
Sbjct: 238 EVKGRIRRLQMEMAMRRMMGDVPKADVVITNPTHYSVALKYDTAKPGSAPKVVAKGTDEI 297

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A K+R+IA E+ IP+   P+L R+++    I   IP   + AVAQ++  +Y  K
Sbjct: 298 AMKIREIAREYEIPVMPSPALTRAIYHATEIGHEIPEGLFAAVAQVLAYVYQLK 351


>gi|153834147|ref|ZP_01986814.1| flagellar biosynthetic protein FlhB [Vibrio harveyi HY01]
 gi|148869517|gb|EDL68515.1| flagellar biosynthetic protein FlhB [Vibrio harveyi HY01]
          Length = 376

 Score =  353 bits (907), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 91/353 (25%), Positives = 175/353 (49%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+D    +TE  + ++++ A  +G    S+E +  S ++   I L++F      S+ S
Sbjct: 1   MAESD-GQERTEEATPRRLQQAREKGQVARSKELASASVLIVGAIALMWFGESLARSLFS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L    T+ ++ D + +  +           +   L+   +  +           + 
Sbjct: 60  IMSRLFD-LTRDEIFDTAKLFDIAFGAMTDLLFPLFLILITLFVAAMIGAAGVGGISFSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   +++   G+KR+  + + V  +KS +K+ LV  +    +  +   ++      
Sbjct: 119 EAAMPKLSKMNPLSGLKRMVGMQSWVELIKSILKVALVTGMAIYLIQASQADLIQLSMDV 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               ++HA   +   +++I   +  +  +DI +   Q   +LKM+KQEIKDE K++ G P
Sbjct: 179 YPQNIFHALDILLNFILLISCSLLIVVAIDIPFQIWQHADQLKMTKQEIKDEYKETEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM    +A +IITNP H+++ALRY Q  + APV++AKG + +A
Sbjct: 239 EVKGRIRMLQREAAQRRMMADVPQADVIITNPEHFSVALRYKQKTDRAPVVIAKGTDHMA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++A EH+I I   P LAR+L+    +   IP   + AVAQ++  ++  K
Sbjct: 299 MKIREVAREHDITIVPAPPLARALYHTTELEQEIPDGLFTAVAQVLAFVFQLK 351


>gi|300935856|ref|ZP_07150814.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 21-1]
 gi|300458968|gb|EFK22461.1| flagellar biosynthetic protein FlhB [Escherichia coli MS 21-1]
          Length = 382

 Score =  353 bits (907), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 103/350 (29%), Positives = 188/350 (53%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDEIDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGGVALARRLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       + D + I+  +  L   A   ++P +   ++  I S ++    V +   +
Sbjct: 62  AGL-HFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVAIISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|332756021|gb|EGJ86374.1| flagellar biosynthetic protein FlhB [Shigella flexneri 4343-70]
 gi|333003254|gb|EGK22800.1| flagellar biosynthetic protein FlhB [Shigella flexneri K-218]
          Length = 397

 Score =  353 bits (906), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 102/350 (29%), Positives = 187/350 (53%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGGVSLARRLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       ++D + I+  +  L   A   ++P +   ++  + S ++    V +   +
Sbjct: 62  AGL-HFDHSIIKDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKRI+S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRIFSAQTSAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQ  G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQGEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R   + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRICQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|167620815|ref|ZP_02389446.1| flagellar biosynthesis protein FlhB [Burkholderia thailandensis
           Bt4]
          Length = 401

 Score =  353 bits (906), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 103/353 (29%), Positives = 182/353 (51%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   +TEA + K+ E A  EG    SRE + F+ + A          P    + +
Sbjct: 1   MAE-DSDLERTEAATPKRREKAREEGQVARSRELASFALLSAGFYGAWMLSGPIGEHLRT 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            LH    S  +    D + ++     LSL     ++P L L  +  + + +     +++ 
Sbjct: 60  MLHTAF-SFDRATAFDTNRMLSHAGILSLEGLYALVPVLALTGVAALAAPMALGGWLVST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
              +  F+R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +  
Sbjct: 119 KTFELKFERLNPVAGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELLGLATQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            H+ L  A   +     M +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P
Sbjct: 179 LHAALADALHLIAVCCGMTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEVKREHRENEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM     A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A
Sbjct: 239 HVKGRIRQQQRAMARRRMMANVPTADVVVTNPTHFAVALKYTDGEMRAPKVVAKGVNLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EH++P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 299 ARIRELAAEHHVPLLEAPPLARALYHNVDLEREIPGTLYSAVAEVLAWVYQLK 351


>gi|126653730|ref|ZP_01725648.1| flagellar biosynthesis protein B [Bacillus sp. B14905]
 gi|126589694|gb|EAZ83830.1| flagellar biosynthesis protein B [Bacillus sp. B14905]
          Length = 365

 Score =  353 bits (906), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 103/347 (29%), Positives = 182/347 (52%)

Query: 7   PDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLL 66
              KTE  + KK +DA  +G    S++ +    +L   I+L+FF       + +      
Sbjct: 16  SGEKTEKATPKKRQDARKKGQVIKSQDVTSAIVMLMVFIFLIFFAGSLRDELLAFFRQTF 75

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
               + +   I  ++ L     +  + +++P + + ++  +    +Q   +  L  +K  
Sbjct: 76  IHNIRIETLTIDSVMHLFIETLIQMAFIIVPIMAIAVVGALAGNFLQFGFLFTLEPMKFD 135

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
            K++   +G+KRI+S+  +V  +KS +KI  +G++ TI +  N   +L     +P   L 
Sbjct: 136 LKKMDPIKGLKRIFSVKAIVELLKSVLKIGFIGSVTTIIIWTNLPEVLALSFKSPWMTLI 195

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
                V  + I   L +  +++LD  +    +   LKMSKQ+IKDE K S G+P+IK++ 
Sbjct: 196 TVGKLVGIMGIAASLVLLCVSILDWMYQKFDYEKNLKMSKQDIKDEYKNSEGDPLIKSKI 255

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           K   R     +MM     A ++ITNPTHYA+AL+Y +   DAP ++AKG + IA+K++ I
Sbjct: 256 KQRQREMAMRRMMSEIPSADVVITNPTHYAIALKYDEENMDAPRVIAKGTDFIAQKIKLI 315

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A EH++ + E   LAR+++ QV I   +P  F+KAVA+++  +Y  K
Sbjct: 316 AKEHDVIMVENRPLARAMYDQVEIGDPVPEEFFKAVAEILAYVYRIK 362


>gi|197285519|ref|YP_002151391.1| flagellar biosynthesis protein FlhB [Proteus mirabilis HI4320]
 gi|227356013|ref|ZP_03840404.1| flagellar biosynthetic protein [Proteus mirabilis ATCC 29906]
 gi|194683006|emb|CAR43467.1| flagellar biosynthetic protein [Proteus mirabilis HI4320]
 gi|227163790|gb|EEI48698.1| flagellar biosynthetic protein [Proteus mirabilis ATCC 29906]
          Length = 382

 Score =  353 bits (906), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 106/353 (30%), Positives = 173/353 (49%), Gaps = 3/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   KTE P+  K E A  +G    S+E S    IL  +  L          + +
Sbjct: 1   MAE-DSDLEKTEEPTPHKREKAKKDGQIVRSKELSSVLMILGGVSLLWMSGRFITRELYA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L     +     + + + ++     L   A   + P  L  ++  IG   +      + 
Sbjct: 60  MLTEGF-TFNHHIIGNENLLIPRFASLMKQAVFALSPVFLGLVLVAIGGSAVLGGINFSS 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K   K+ +   G+KRI+S+N L    K+ +K + VG   T+ L  N+  +L  I+  
Sbjct: 119 KSIKFDPKKWNPISGLKRIFSMNALAELFKAILKSLFVGLAATVFLWHNWNDILHLITLP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P S L +A   +   + + +  +  +   DI +       KL+M++QEIKDE KQ  G+P
Sbjct: 179 PLSALANAMQLLIFAVYIAVFMLIPMVAFDIIFQIRSHLKKLRMTRQEIKDEFKQQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +       R +MM    +A +I+TNPTHYA+AL+Y   +  AP ++AKG   IA
Sbjct: 239 QLKARIRQQQHEMSRRRMMADVPKADVIVTNPTHYAVALQYN-DKMVAPKVLAKGAGAIA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+++I  EH IP+ E P LAR+L++   I  AIP   Y AVA+++  +Y  +
Sbjct: 298 LKIKEIGAEHRIPLLEAPPLARALYRHSEIGQAIPATLYAAVAEVLAWVYQLR 350


>gi|149377872|ref|ZP_01895601.1| Flagellar biosynthesis pathway, component FlhB [Marinobacter
           algicola DG893]
 gi|149357814|gb|EDM46307.1| Flagellar biosynthesis pathway, component FlhB [Marinobacter
           algicola DG893]
          Length = 378

 Score =  353 bits (906), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 94/354 (26%), Positives = 177/354 (50%), Gaps = 2/354 (0%)

Query: 1   MSEN-DAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVT 59
           M+E  D    KTE  + +++E A  +G    S+E +  + +LA    LL F +    S+ 
Sbjct: 1   MAEENDNSQEKTEEATPRRLEKAREDGQTARSKELATMAVLLAGAGGLLMFGASMGASLE 60

Query: 60  SDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLN 119
           S +        +  + D  H+   L   +  A+  + P L+L ++  +   +     +++
Sbjct: 61  SIMRDSFV-LERSAIFDTRHMSVQLMASAKEAALSLAPLLILLLVAAVAGSIGIGGLLVS 119

Query: 120 LNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISA 179
              + P   R+   +G+KR++S+ +L+  +K+ +K+ LV  +  + L      +L     
Sbjct: 120 GKAIAPKLNRMDPLKGLKRMFSMRSLIELVKAILKVGLVMAVAILILNLRTDDLLSIAEE 179

Query: 180 NPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
              S + H  +T+     ++      +  +D+ +       KL+M+KQE+KDE K + G 
Sbjct: 180 PARSAMEHVVWTMAWSFFILACATIVIAAIDVPFQIFDHQKKLRMTKQEVKDEYKDTEGK 239

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLI 299
           P +K + + + R   + +MM+    A ++ITNPTHYA+AL+Y Q    AP++VAKG +  
Sbjct: 240 PEVKGKIRQLQREMAQRRMMQDVPGADVVITNPTHYAVALKYDQKNMAAPIVVAKGSDET 299

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A K+ +IA E+ + I   P LAR+++    I   IP   Y A+AQ++  ++  +
Sbjct: 300 AFKIMEIARENKVEILRTPPLARAVYHNTDIGGEIPDGLYMAIAQVLAYVFQLR 353


>gi|311105926|ref|YP_003978779.1| flagellar biosynthetic protein FlhB [Achromobacter xylosoxidans A8]
 gi|310760615|gb|ADP16064.1| flagellar biosynthetic protein FlhB [Achromobacter xylosoxidans A8]
          Length = 384

 Score =  353 bits (906), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 106/353 (30%), Positives = 182/353 (51%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  +   KTEA S +++E A  EG    SRE   F  + A +  +    S    ++T 
Sbjct: 1   MAEE-SDLEKTEAASPRRLEKAREEGQIARSRELGTFMMLAAGVGAIWAGGSSLYRTLTG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L    QR + D   +V         A  +++P   L  +  + S ++    V++ 
Sbjct: 60  VLRNGLG-FDQRIVADPGVMVERAVEGFGQALLVLLPIFGLLAVIAVLSSVLLGGLVISG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++ +F ++S   G+KR++S   +V  +K+  K +LVG +    +   +  ML  +   
Sbjct: 119 KPLQFNFSKLSPISGVKRMFSSQTVVELIKALAKALLVGGVAVWVIWRYHDDMLSLMHVA 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + L  A   V      I+  +  + +LD+ W       KL+MSK++++ E K+S G+P
Sbjct: 179 PSAALVKALTLVAMCCAFIVASLIVIVMLDVPWQIWSHLKKLRMSKEDVRQEHKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R   R +MM    +A +++TNPTHYA+AL+Y + ++ AP ++AKG  LIA
Sbjct: 239 HVKARIRQQQRQAARRRMMSEVPKADVVVTNPTHYAVALKYDEEKSGAPRVLAKGTGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++A E+ IP  E P LAR+L + V I   IP   Y AVA+++  ++  +
Sbjct: 299 AKIRELAAENRIPTLEAPPLARALHQHVEIGQEIPAELYTAVAEVLAWVFQLR 351


>gi|121601443|ref|YP_994701.1| flagellar biosynthesis protein FlhB [Burkholderia mallei SAVP1]
 gi|124383615|ref|YP_001027675.1| flagellar biosynthesis protein FlhB [Burkholderia mallei NCTC
           10229]
 gi|126450428|ref|YP_001082647.1| flagellar biosynthesis protein FlhB [Burkholderia mallei NCTC
           10247]
 gi|238563575|ref|ZP_00438645.2| flagellar biosynthetic protein FlhB [Burkholderia mallei GB8 horse
           4]
 gi|251767891|ref|ZP_02268743.2| flagellar biosynthetic protein FlhB [Burkholderia mallei PRL-20]
 gi|254175097|ref|ZP_04881758.1| flagellar biosynthetic protein FlhB [Burkholderia mallei ATCC
           10399]
 gi|254186354|ref|ZP_04892871.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254194732|ref|ZP_04901163.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei S13]
 gi|254201433|ref|ZP_04907797.1| flagellar biosynthetic protein FlhB [Burkholderia mallei FMH]
 gi|254206775|ref|ZP_04913126.1| flagellar biosynthetic protein FlhB [Burkholderia mallei JHU]
 gi|254357202|ref|ZP_04973476.1| flagellar biosynthetic protein FlhB [Burkholderia mallei
           2002721280]
 gi|121230253|gb|ABM52771.1| flagellar biosynthetic protein FlhB [Burkholderia mallei SAVP1]
 gi|124291635|gb|ABN00904.1| flagellar biosynthetic protein FlhB [Burkholderia mallei NCTC
           10229]
 gi|126243298|gb|ABO06391.1| flagellar biosynthetic protein FlhB [Burkholderia mallei NCTC
           10247]
 gi|147747327|gb|EDK54403.1| flagellar biosynthetic protein FlhB [Burkholderia mallei FMH]
 gi|147752317|gb|EDK59383.1| flagellar biosynthetic protein FlhB [Burkholderia mallei JHU]
 gi|148026266|gb|EDK84351.1| flagellar biosynthetic protein FlhB [Burkholderia mallei
           2002721280]
 gi|157934039|gb|EDO89709.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei
           Pasteur 52237]
 gi|160696142|gb|EDP86112.1| flagellar biosynthetic protein FlhB [Burkholderia mallei ATCC
           10399]
 gi|169651482|gb|EDS84175.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei S13]
 gi|238520421|gb|EEP83881.1| flagellar biosynthetic protein FlhB [Burkholderia mallei GB8 horse
           4]
 gi|243061442|gb|EES43628.1| flagellar biosynthetic protein FlhB [Burkholderia mallei PRL-20]
          Length = 401

 Score =  353 bits (906), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 104/353 (29%), Positives = 182/353 (51%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+  ++TEA + K+ E A  EG    SRE + F+ + A          P    + +
Sbjct: 1   MAE-DSDLDRTEAATPKRREKAREEGQVARSRELASFALLSAGFYGAWMLSGPIGEHLRT 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            LH    S  +    D + ++     LSL     + P L L  +  + + +     +++ 
Sbjct: 60  MLHTAF-SFDRAAAFDTNRMLSHAGTLSLEGLYALAPVLALTGVAALAAPMAMGGWLVST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
              +  F+R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +  
Sbjct: 119 KTFELKFERLNPITGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELLGLATQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            H+ L  A   V     M +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P
Sbjct: 179 LHAALADALHLVAVCCGMTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEVKREHRENEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM     A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A
Sbjct: 239 HVKGRIRQQQRAMARRRMMANVPTADVVVTNPTHFAVALKYTDGEMRAPKVVAKGVNLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EH++P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 299 ARIRELAAEHHVPLLEAPPLARALYHNVELEREIPGTLYSAVAEVLAWVYQLK 351


>gi|317403765|gb|EFV84247.1| flagellar biosynthetic protein FlhB [Achromobacter xylosoxidans
           C54]
          Length = 384

 Score =  353 bits (905), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 108/353 (30%), Positives = 181/353 (51%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  +   KTEA S +++E A  EG    SRE   F  +   +  +          ++ 
Sbjct: 1   MAEE-SDLEKTEAASPRRLEKAREEGQIARSRELGTFMMLAVGVGAIWAGGGTIYKGLSG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   LA   QR + D   +V    +    A  +++P   L  +  + S ++    V++ 
Sbjct: 60  VLRNGLA-FDQRVVADPGVMVEQAVNGFGHALMVILPIFGLLAVIAVLSSVLLGGIVISG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P+F ++SL  G+KR++S   +V  +K+  K +LVG +    L   +  ML  +   
Sbjct: 119 KPLSPNFSKLSLFAGLKRMFSAQTVVELIKALAKAMLVGGVAVWILWRYHDDMLGLMHVA 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + L  A   V      I+  +  + +LD+ W       KL+MSK++++ E K+S G+P
Sbjct: 179 PSAALTKALSLVAMCCAFIVASLLVIVLLDVPWQIWSHLKKLRMSKEDVRQEHKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
             K R +   R   R +MM    +A +++TNPTHYA+AL+Y + +N AP ++AKG  LIA
Sbjct: 239 HTKARIRQQQRQAARRRMMSEVPKADVVVTNPTHYAVALKYEEDKNGAPRVLAKGTGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++A EH IP  E P LAR+L + V +   IP   Y AVA+++  ++  +
Sbjct: 299 AKIRELAAEHRIPTLEAPPLARALHQHVELGQEIPAELYTAVAEVLAWVFQLR 351


>gi|126441654|ref|YP_001060838.1| flagellar biosynthesis protein FlhB [Burkholderia pseudomallei 668]
 gi|126221147|gb|ABN84653.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei 668]
          Length = 401

 Score =  353 bits (905), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 104/353 (29%), Positives = 182/353 (51%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+  ++TEA + K+ E A  EG    SRE + F+ + A          P    + +
Sbjct: 1   MAE-DSDLDRTEAATPKRREKAREEGQVARSRELASFALLSAGFYGAWMLSGPIGEHLRT 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            LH    S  +    D + ++     LSL     + P L L  +  + + +     +++ 
Sbjct: 60  MLHTAF-SFDRAAAFDTNRMLSHAGTLSLEGLYALAPVLALTGVAALATPMAMGGWLVST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
              +  F+R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +  
Sbjct: 119 KTFELKFERLNPITGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELLGLATQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            H+ L  A   V     M +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P
Sbjct: 179 LHAALADALHLVAVCCGMTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEVKREHRENEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM     A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A
Sbjct: 239 HVKGRIRQQQRAMARRRMMANVPTADVVVTNPTHFAVALKYTDGEMRAPKVVAKGVNLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EH++P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 299 ARIRELAAEHHVPLLEAPPLARALYHNVELEREIPGTLYSAVAEVLAWVYQLK 351


>gi|316932838|ref|YP_004107820.1| flagellar biosynthetic protein FlhB [Rhodopseudomonas palustris
           DX-1]
 gi|315600552|gb|ADU43087.1| flagellar biosynthetic protein FlhB [Rhodopseudomonas palustris
           DX-1]
          Length = 357

 Score =  353 bits (905), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 108/350 (30%), Positives = 188/350 (53%), Gaps = 2/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D KTE P+ KK++DAL  G+   S+E + +  I    + L  F       +   L 
Sbjct: 2   SDDSDEKTEEPTQKKLDDALKRGDVAKSQEVNTWFLIAGGTLVLSSFHGSIGAGILGPLR 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
            L+  +   +++    I    + +  + + + +P  L+ +   I   LIQ   V +   +
Sbjct: 62  SLIEKSWMLRVDGDGLIALTKSLMYATVAAIGVPLFLVMITAVI-GNLIQHRLVFSAEGL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
            P   ++S  +G KR++    L NF+K   K++ +G ++   L   +  +   ++ +  +
Sbjct: 121 TPKLSKLSPLQGAKRVFGKQALANFLKGLFKVVALGIVMVAVLYPEHDRLDALLTMDVAA 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
           +L        K+L  ++  +A + V D  + Y QW+ K KMS QEIKDE KQS G+P IK
Sbjct: 181 LLGVTVTLTLKLLGAVVAMLAFVAVADYFFQYRQWHEKQKMSLQEIKDEYKQSEGDPHIK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + +   R++ +MM     A+++ITNPTH+++AL+Y +    AP+ VAKG + +A K+
Sbjct: 241 GRLRQLRYQRMKKRMMAEVPGASVVITNPTHFSVALKYERG-MPAPICVAKGVDAVAFKI 299

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R++A E+N+PI E   LAR+L+  V I+  IP   Y+AVA++I  + + K
Sbjct: 300 REVAKENNVPIVENVPLARALYATVEIDEEIPVEHYQAVAEVIGYVMNLK 349


>gi|229591837|ref|YP_002873956.1| flagellar biosynthesis protein FlhB [Pseudomonas fluorescens SBW25]
 gi|229363703|emb|CAY51084.1| flagellar biosynthetic protein flhb [Pseudomonas fluorescens SBW25]
          Length = 378

 Score =  353 bits (905), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 99/353 (28%), Positives = 176/353 (49%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+++  +KTE P+ K+ +D+  +G    S+E +  ++++A    LL +       +  
Sbjct: 1   MAESESGQDKTEDPTEKRKKDSREKGEIARSKELNTVATMMAGSGALLIYGGGLALDLME 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +    A   +  L +   +   L H    A   V P L+  ++  +   +     +   
Sbjct: 61  LMKHNFALP-REVLLNPDAMGQYLLHSGKIAILAVQPILITLLLAALIGPVALGGWLFAA 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++   G+KR++S   LV  +K+  K IL+  +  + L+ +   +L      
Sbjct: 120 GSMAPKFSRMNPGAGLKRMFSAKALVELLKALAKFILILFVALMVLSSDIDDLLRIAHEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             S + H+   V    + +   +  +  +D      + + KL M+KQE++DE K   G P
Sbjct: 180 LESAIIHSVQVVGWSALWMAAGLIIIAAVDAPIQLWESHKKLLMTKQEVRDEHKDQEGRP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + KMM +   A +IITNPTHYA+AL+Y   +  AP+L+AKG +  A
Sbjct: 240 EVKQRIRQLQREMSQRKMMASVPDADVIITNPTHYAVALKYDPEKGGAPMLLAKGSDFTA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA  H+I + E P LARS+F    ++  IP   Y AVAQ++  +Y  +
Sbjct: 300 LKIREIAVAHDILLLESPELARSIFYSTDLDQEIPAGLYLAVAQVLAYVYQIR 352


>gi|148976426|ref|ZP_01813132.1| flagellar biosynthesis protein B [Vibrionales bacterium SWAT-3]
 gi|145964249|gb|EDK29505.1| flagellar biosynthesis protein B [Vibrionales bacterium SWAT-3]
          Length = 376

 Score =  353 bits (905), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 88/353 (24%), Positives = 180/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+D    +TE  + ++++ A  +G    S+E +  S ++   + L++F      ++  
Sbjct: 1   MAESD-GQERTEDATPRRLQQAKEKGQVARSKELASASVLIVGAVALMWFGESMAKALFE 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L  S ++ ++ D + ++ +     ++    +   L+   +  +           ++
Sbjct: 60  AMQRLF-SLSRDEIFDTNKLLEIAGGALVNLLFPLFLILITLFIAAVIGAAGVGGINFSM 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   +++   GIKR++ + + V  +KS +K+ LV  +    +  +   ++      
Sbjct: 119 QAAMPKASKLNPLSGIKRMFGLQSWVELIKSILKVALVSGMAVYLIQASQHDLMQLSMDV 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               ++HA   +   +++I   +  +  +DI +   Q   +LKM+KQE+KDE K + G P
Sbjct: 179 YPQNIFHALDILLNFILLISCSLLIVVAIDIPFQIWQHADQLKMTKQEVKDEFKDTEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM    +A +I+TNP H+++ALRY Q ++ AP++VAKG + +A
Sbjct: 239 EVKGRIRMLQREAAQRRMMADVPQADVIVTNPEHFSVALRYKQNQDKAPIVVAKGVDHMA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA EH+I I   P LAR+L+    +   IP   + AVAQ++  ++  K
Sbjct: 299 MKIREIAREHDIYIVPAPPLARALYHTTELEQQIPDGLFTAVAQVLAYVFQLK 351


>gi|88800470|ref|ZP_01116034.1| Flagellar biosynthesis pathway, component FlhB [Reinekea sp.
           MED297]
 gi|88776800|gb|EAR08011.1| Flagellar biosynthesis pathway, component FlhB [Reinekea sp.
           MED297]
          Length = 378

 Score =  353 bits (905), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 100/352 (28%), Positives = 176/352 (50%), Gaps = 1/352 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D    KTE P+ +K+E A  +G+   S+E +  + ++   I  L F      ++  
Sbjct: 1   MAEQDTSQEKTEEPTPRKLEKAKEDGDIARSKELNTSAILIVSAICFLVFGRMMGTTMMR 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +     S   R   D+      ++ ++  A   ++P     ++  + + +       + 
Sbjct: 61  IM-EFCFSFDPRASWDVIVAGEYVSVVAGEALLSIVPLFGFLLLAALFAPIGLGGWNFST 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   R++   GIKR++S+N+LV  +K + K+I+V T   + L       L  +   
Sbjct: 120 KALAPKGSRMNPLSGIKRMFSMNSLVELLKGWGKVIVVATAAILVLISLKNEFLSMVFQP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             S + HA   +    +++      + ++DI +  +    KL+M+ QEIK+E K + G P
Sbjct: 180 TESAITHAVEVIAWSFLLLAASTVLIAIVDIPFQIYSHTKKLRMTMQEIKEEYKNTEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + K + R     +MM     A +IITNPTHYA+AL+Y      AP++VAKG + +A
Sbjct: 240 EVKAKIKQLQREMANRRMMSDVPEADVIITNPTHYAVALKYDPNAMPAPLMVAKGVDEVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
            K+R+I  E+++P+ E P+LARS++    I   IP   Y AVAQ++  IY  
Sbjct: 300 FKIREIGQEYDVPVLEMPALARSIYHHTRIGDEIPEGLYVAVAQVLAYIYQI 351


>gi|311992333|gb|ADQ26740.1| protein export component [Aeromonas hydrophila]
          Length = 375

 Score =  353 bits (905), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 91/350 (26%), Positives = 168/350 (48%), Gaps = 2/350 (0%)

Query: 5   DAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHV 64
           D    +TE P+ K+++ A  +G    S+E    S +LA +  LL        ++   L +
Sbjct: 2   DTDQERTEQPTGKRLQQAREKGQIARSKELGTASVLLAAVFGLLMVKESLAGAMVKVLTM 61

Query: 65  LLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVK 124
              +  + +  D + ++ +L  L       +    +L  +       +      +   + 
Sbjct: 62  GF-TLDREQAFDPNAMMTMLPALLRELLHPLGLLFMLVAIAAFVGNTLMGGMNFSSEAML 120

Query: 125 PSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSI 184
           P + ++S   GIKR++ + +LV  +KS  K++ +       L+  +  +L+         
Sbjct: 121 PKWSKLSPLNGIKRMFGVQSLVELVKSIAKVVFISLFAWWMLSSQFNHLLNLSLEGYPGG 180

Query: 185 LYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKN 244
           +  A   +  +LI++   +  +  +D+ +       +LKM+KQE+KDE K S G P +K 
Sbjct: 181 IIDALDLLLWMLIILCCALIPIVAIDVPFQQWNHMRQLKMTKQEVKDEFKDSEGKPEVKG 240

Query: 245 RQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYI-QTENDAPVLVAKGQNLIAKKM 303
           R + +       +MM    +A ++ITNPTHY++AL+Y       AP +VAKG + IA K+
Sbjct: 241 RIRRLQMEMAMRRMMGDVPKADVVITNPTHYSVALKYDTAKPGSAPKVVAKGTDEIAMKI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+IA E+ IP+   P+L R+++    I   IP   + AVAQ++  +Y  K
Sbjct: 301 REIAREYEIPVMPSPALTRAIYHATEIGHEIPEGLFAAVAQVLAYVYQLK 350


>gi|77359754|ref|YP_339329.1| flagellar biosynthesis protein FlhB [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76874665|emb|CAI85886.1| Flagellar biosynthetic protein flhB, putative part of export
           apparatus for flagellar proteins [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 376

 Score =  353 bits (905), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 94/353 (26%), Positives = 172/353 (48%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE D+   KTE P+SKK+EDA  +G    S+E      ++   I LL +       + +
Sbjct: 1   MSE-DSGQEKTEEPTSKKVEDAKKKGQIARSKELGTMFVLIFSAISLLMYGPEIGKGLYN 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  +L S  + +  D + +  +   ++ +    +   +L+ ++       +      + 
Sbjct: 60  VMGRML-SLNRNETYDTTKMFAVWGEVADALMFPMAMFVLIIVLAAFIGNTMLGGFNFSW 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   ++S  +G KR++     V  +KS +K  LV +     +   +  +L     +
Sbjct: 119 QAAAPKASKMSPAKGFKRMFGPQAGVELLKSLLKFGLVASFAVFLINTFFDEILHLSVES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + HA   +  + + +   +  +  +D  +  +    +LKM+ QE+KDE K S G+P
Sbjct: 179 APGNIIHALEILAWMFLGLSCTLIIIAAIDAPFQSYNHNKQLKMTLQEVKDEYKNSEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R +   R   + +MM+    A +I+TNPTHY++AL+Y      AP++VAKG + +A
Sbjct: 239 QIKARIRQTQRQMSQKRMMQDVPDADVIVTNPTHYSVALKYDTERAGAPIVVAKGIDEMA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++RKIA  + +PI E PSL R+L+    +   IP   + AVAQ++  ++  K
Sbjct: 299 MQIRKIAIGNEVPILESPSLTRALYHTAEVGEQIPDQLFTAVAQVLAYVFQLK 351


>gi|126454601|ref|YP_001068145.1| flagellar biosynthesis protein FlhB [Burkholderia pseudomallei
           1106a]
 gi|134281603|ref|ZP_01768311.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei 305]
 gi|167920930|ref|ZP_02508021.1| flagellar biosynthesis protein FlhB [Burkholderia pseudomallei
           BCC215]
 gi|217423909|ref|ZP_03455409.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei 576]
 gi|226193093|ref|ZP_03788703.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei
           Pakistan 9]
 gi|237814235|ref|YP_002898686.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei
           MSHR346]
 gi|242317683|ref|ZP_04816699.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei
           1106b]
 gi|254183876|ref|ZP_04890467.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei
           1655]
 gi|254298802|ref|ZP_04966253.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei
           406e]
 gi|126228243|gb|ABN91783.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei
           1106a]
 gi|134247270|gb|EBA47356.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei 305]
 gi|157808470|gb|EDO85640.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei
           406e]
 gi|184214408|gb|EDU11451.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei
           1655]
 gi|217392972|gb|EEC32994.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei 576]
 gi|225934693|gb|EEH30670.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei
           Pakistan 9]
 gi|237506461|gb|ACQ98779.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei
           MSHR346]
 gi|242140922|gb|EES27324.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei
           1106b]
          Length = 401

 Score =  352 bits (904), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 104/353 (29%), Positives = 182/353 (51%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+  ++TEA + K+ E A  EG    SRE + F+ + A          P    + +
Sbjct: 1   MAE-DSDLDRTEAATPKRREKAREEGQVARSRELASFALLSAGFYGAWMLSGPIGEHLRT 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            LH    S  +    D + ++     LSL     + P L L  +  + + +     +++ 
Sbjct: 60  MLHAAF-SFDRAAAFDTNRMLSHAGTLSLEGLYALAPVLALTGVAALAAPMAMGGWLVST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
              +  F+R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +  
Sbjct: 119 KTFELKFERLNPITGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELLGLATQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            H+ L  A   V     M +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P
Sbjct: 179 LHAALADALHLVAVCCGMTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEVKREHRENEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM     A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A
Sbjct: 239 HVKGRIRQQQRAMARRRMMANVPTADVVVTNPTHFAVALKYTDGEMRAPKVVAKGVNLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EH++P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 299 ARIRELAAEHHVPLLEAPPLARALYHNVELEREIPGTLYSAVAEVLAWVYQLK 351


>gi|268589991|ref|ZP_06124212.1| flagellar biosynthetic protein FlhB [Providencia rettgeri DSM 1131]
 gi|291314710|gb|EFE55163.1| flagellar biosynthetic protein FlhB [Providencia rettgeri DSM 1131]
          Length = 383

 Score =  352 bits (904), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 101/353 (28%), Positives = 180/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS+  +   KTE P+  K + A ++G    S+E S    +LA +  L          +  
Sbjct: 1   MSDE-SDVEKTEEPTPHKKQKAKDDGQIVRSKELSSLMMMLAGVSLLWLSGGHLAAQLRQ 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
                        L++   ++  L  +   A   ++P +    + GI +  +    V N 
Sbjct: 60  ITRQGFI-FDGHYLQNTGLMISYLGRVVSEALFALLPVIGGLALVGISASSLVGGLVFNS 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K   K+++  +G+KRI+S+N L    K+ +K + VG    I L +++ ++L  +  +
Sbjct: 119 KLIKFDLKKLNPIKGLKRIFSMNALSELFKAVLKSLFVGLGAFIFLWQSWPSLLHLVMES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + L +A   V     +I+  +  +   D+ + +     KL+MS+QEIKDE KQ  G+P
Sbjct: 179 PVTALSNALQKVIFAGYLIVFLLIPMVAFDVFYQFRSHLKKLRMSRQEIKDEFKQQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK + +   R+  R++MM     A +I+TNPTHYA+AL+Y   +  AP ++AKG  ++A
Sbjct: 239 QIKAKIRQQQRAIARNRMMADVPNADVIVTNPTHYAVALKYDDKKMGAPKVLAKGAGVLA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +++++I  EH I   E P LAR+L++   I  +IP   Y AVA+++  +Y  +
Sbjct: 299 QRIKEIGEEHRILQLEAPPLARALYRHAEIGQSIPVALYAAVAEVLAWVYQLR 351


>gi|163801858|ref|ZP_02195755.1| flagellar biosynthesis protein B [Vibrio sp. AND4]
 gi|159174366|gb|EDP59170.1| flagellar biosynthesis protein B [Vibrio sp. AND4]
          Length = 376

 Score =  352 bits (904), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 91/353 (25%), Positives = 177/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE+D    +TE  + K+++ A  +G    S+E +  S ++   I L++F      S+ +
Sbjct: 1   MSESD-GQERTEDATPKRLQQAREKGQVARSKELASASVLIVGAIALMWFGESLARSLFA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L    T+ ++ D + +  +           +   L+   +  +           + 
Sbjct: 60  IMSRLFD-LTRDEIFDTAKLFDIAFGAMADLLFPLFLILITLFIAALIGAAGVGGVSFSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   +++   G+KR+  + + V  +KS +K+ LV  +    +  +   ++      
Sbjct: 119 EAAMPKLSKMNPLSGLKRMVGMQSWVELIKSILKVGLVAGMAIYLIQASQSDLIQLSMDV 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               ++HA  T+   +++I   +  +  +DI +   Q  ++LKM+KQEIKDE K++ G P
Sbjct: 179 YPQNIFHALDTLLNFILLISCSLLIVVAIDIPFQIWQHANQLKMTKQEIKDEYKETEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM    +A +IITNP H+++ALRY Q  + AP+++AKG + +A
Sbjct: 239 EVKGRIRMLQREAAQRRMMADVPQADVIITNPEHFSVALRYKQKTDRAPIVIAKGTDHMA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++A E++I I   P LAR+L+    +   IP   + AVAQ++  ++  K
Sbjct: 299 MKIREVARENDITIVPAPPLARALYHTTELEQEIPDGLFTAVAQVLAFVFQLK 351


>gi|187778764|ref|ZP_02995237.1| hypothetical protein CLOSPO_02359 [Clostridium sporogenes ATCC
           15579]
 gi|187772389|gb|EDU36191.1| hypothetical protein CLOSPO_02359 [Clostridium sporogenes ATCC
           15579]
          Length = 587

 Score =  352 bits (904), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 104/347 (29%), Positives = 187/347 (53%), Gaps = 2/347 (0%)

Query: 7   PDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLL 66
            + KTE  + +K  DA  +G    S+E +L  ++LAC + L+     G   +   +   L
Sbjct: 240 SEEKTEEATPRKKMDARKKGQVAKSKELALAFTLLACTLVLVALGEYGANELKETMAGFL 299

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
            +    +L + +++  L     L   ++V+P  L  M FGI +  +Q   +     +KP 
Sbjct: 300 NNYLNMEL-NYNNLNSLAILTVLRVGKIVLPVALPIMCFGIAANYLQTGFLFTKEPLKPD 358

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
           FK+++   G KR++S+  ++  +K    I +VG +    L +NY  +L+  +  P  ++ 
Sbjct: 359 FKKLNPINGFKRMFSLRTVMELLKDLTIITVVGIVGYKFLKDNYLKILNLGTLRPWYMIT 418

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
                   +   I L +  ++V D  +  +Q+   LKM+KQE+K+E KQ  G+P IK++ 
Sbjct: 419 GLLSLAISIFFKITLIMLFISVADYVYQKYQYNKDLKMTKQEVKEEYKQDEGDPQIKSKI 478

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           K   R     +MM+   +AT+++TNPTH A+ALRY +  + AP +VAKG + +A K++ I
Sbjct: 479 KQKQREMAMQRMMQEVPKATVVVTNPTHIAVALRYEKG-DSAPKVVAKGADYVAIKIKDI 537

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A  + +P+ E   LAR ++++V I+S +P   Y+AVA+++  +Y  K
Sbjct: 538 AKNNEVPVIENKPLARLIYEKVEIDSEVPQDMYEAVAEILAIVYTLK 584


>gi|237653600|ref|YP_002889914.1| flagellar biosynthesis protein FlhB [Thauera sp. MZ1T]
 gi|237624847|gb|ACR01537.1| flagellar biosynthetic protein FlhB [Thauera sp. MZ1T]
          Length = 380

 Score =  352 bits (904), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 104/352 (29%), Positives = 186/352 (52%), Gaps = 2/352 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   KTE PSS+++E A  EG  P SRE S F   +     LL         V  
Sbjct: 1   MAE-DSDLEKTEDPSSRRLEQAREEGQVPQSRELSTFLVTMTGAATLLLLGGWMAGRVMG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
                 A   +R   D + ++ +L  +   A   ++P  +  M+  + + ++    V   
Sbjct: 60  LFRDGFA-FDRRAAFDENVMLDMLERMLGGALLTLMPLFVALMVAAVAAPMVLGGLVFAP 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +   F R+   +G+ R++S++ LV   K+ +K +LVG +  + L   +  +   +   
Sbjct: 119 KVLGLKFDRLDPLQGLGRMFSLHGLVEMFKAILKSVLVGGVAALVLWYEFEHLFSLMVEP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             + +     T+    ++I+L +  L  +D+ +   Q++ KL+M+K+E+K E K+  G+P
Sbjct: 179 LETGMADFSATIVFATLLIVLSLGLLAAIDVPFQLWQYHKKLRMTKEEVKRESKEQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           +IK R +++ R   R +MM    +A +++TNPTH+++AL+Y   +  APV+VAKG+  +A
Sbjct: 239 MIKGRIRAMQREMARRRMMAEVPKADVVVTNPTHFSVALKYDAAKMGAPVVVAKGRGELA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
            K+R+IA E  +P+ E P LAR+L+K   +  AIP   Y AVA+++  +Y  
Sbjct: 299 LKIREIAKESEVPLLEAPPLARALYKHCELEQAIPAALYTAVAEVMAYVYQL 350


>gi|308273532|emb|CBX30134.1| Flagellar biosynthetic protein flhB [uncultured Desulfobacterium
           sp.]
          Length = 356

 Score =  352 bits (904), Expect = 5e-95,   Method: Composition-based stats.
 Identities = 111/353 (31%), Positives = 191/353 (54%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  +   KTE P+ KK ED   +G    S+E S    + + L  +  + S  +  V  
Sbjct: 1   MAEEASG-EKTEKPTPKKREDIRKKGEVAKSKELSSVVVLFSGLFAMGIYGSFMLSKVQE 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
               LL++ T   L  I  ++    HL +S   ++ P L       + S + Q   +++ 
Sbjct: 60  ITKSLLSNPTITDL-TIHGVMEFSRHLIISFVVILAPLLAAVFAGAVLSNIAQVGFMVSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +KP F +++  +G+KR+ S+ +++   KS VK+I+VG    +++T     +       
Sbjct: 119 ELIKPKFSKLNPFKGLKRLVSMQSVMELFKSMVKLIIVGATAYLTITHEMDNVSMLGELE 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             SI ++ F T   + +   + +  L V+D  +   ++  ++KMSKQEIKDE K++ G+P
Sbjct: 179 LVSIFHYIFATFYNIFLKCSIAMLVLVVIDYAYQRWEFEKRIKMSKQEIKDEYKKTEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K+R ++I     R +MM+   +A +IITNPTH+A+A++Y   E +AP ++AKG   IA
Sbjct: 239 QVKSRIRAIQMEMARKRMMQDVPKADVIITNPTHFAVAIKYNGLEMNAPKVIAKGAGEIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            +++ +A +HNIP+ E   LAR+L+K V I   IP   Y+AVA ++  IY  K
Sbjct: 299 ARIKSLAADHNIPVVENKELARNLYKLVEIGREIPADLYQAVAGVLAYIYKLK 351


>gi|197334476|ref|YP_002156665.1| flagellar biosynthetic protein FlhB [Vibrio fischeri MJ11]
 gi|197315966|gb|ACH65413.1| flagellar biosynthetic protein FlhB [Vibrio fischeri MJ11]
          Length = 376

 Score =  352 bits (904), Expect = 5e-95,   Method: Composition-based stats.
 Identities = 94/353 (26%), Positives = 186/353 (52%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+D    +TE  +SK+++ A ++G    S+E +  S ++   + L++F      ++ S
Sbjct: 1   MAESD-GQERTEDATSKRLQQAKDKGQVARSKELASVSVLVCGAVALMWFGEDVARALFS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +     S ++ ++ D + ++ ++    ++    V   L+   +  +           + 
Sbjct: 60  VMERFF-SISREEIYDTNKLLEIVGGALIALVFPVFLILITLFVAALAGAAGLGGISFSS 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P F +++   GIKR++ + + V  +KS +K+ LVG +    +  +   +       
Sbjct: 119 EAAMPKFSKMNPMSGIKRMFGMQSWVELLKSILKVSLVGGMAFYLIEGSKEDLFQLSLDT 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             + ++H+   +   +++I   +  +  +DI +   Q  ++LKM+KQE+KDE K++ G P
Sbjct: 179 YPANIFHSLDILLNFILLISCTLLIVVAIDIPFQIWQHANQLKMTKQEVKDEYKETEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM     A +++TNP HY++ALRY Q+++ AP++VAKG + +A
Sbjct: 239 EVKGRIRMLQREMTQRRMMADVPSADVVVTNPEHYSVALRYDQSKDAAPIVVAKGVDHVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA EHNI I   P LAR+L+    +   IP   + AVAQ++  I+  K
Sbjct: 299 MKIREIAREHNIYILPAPPLARALYHSTELEQQIPDGLFAAVAQILAYIFQMK 351


>gi|326796452|ref|YP_004314272.1| flagellar biosynthetic protein FlhB [Marinomonas mediterranea
           MMB-1]
 gi|326547216|gb|ADZ92436.1| flagellar biosynthetic protein FlhB [Marinomonas mediterranea
           MMB-1]
          Length = 378

 Score =  352 bits (903), Expect = 5e-95,   Method: Composition-based stats.
 Identities = 101/353 (28%), Positives = 189/353 (53%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+    KTE  SSKK++DA  +GN   S++ S  + ++   + + F        + +
Sbjct: 1   MAENEDGTEKTEDASSKKLDDARKKGNVARSKDLSSAALLIVAAMSIYFTGRILAIDLGN 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
             H       ++ L D + ++F L   ++     +I  + +  + GI   +       + 
Sbjct: 61  LFHFNFV-IERQDLFDKARMIFHLYESAVGVIDSMILLMGVLAVAGIVGSIGIGGLNFSW 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   +++   G+KRI S+ +LV  +KS  K++LVG+I T+ +      +L     +
Sbjct: 120 EPLTPKLSKLNPISGLKRIASVQSLVELLKSIAKVLLVGSIATVVIMLYLPELLGLPFES 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             + + H+   +    I + L +  +  +DI +   +  + LKM+KQE+KDE KQ+ G+P
Sbjct: 180 VGNAVQHSTEVLIWAFIFVSLALVFIAAIDIPFQIWKHSNDLKMTKQEVKDEHKQAEGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + +    ++MM    +A +IITNPTH+++AL+Y  T +DAPV++AKG + IA
Sbjct: 240 QVKGRIRQMQQQMAMNRMMSDVPKADVIITNPTHFSVALKYDTTSSDAPVVLAKGPDFIA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++A  + IP+ + P L R+++K   +   +P   +K VAQL+  ++  K
Sbjct: 300 MKIREVANFYEIPVIQSPDLTRAIYKHTEVGEQVPEGLFKVVAQLLAYVFQLK 352


>gi|74055047|gb|AAZ95852.1| FlhB [Aeromonas hydrophila]
          Length = 376

 Score =  352 bits (903), Expect = 6e-95,   Method: Composition-based stats.
 Identities = 92/351 (26%), Positives = 167/351 (47%), Gaps = 2/351 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D    +TE P+ K+++ A  +G    S+E    S +LA +  LL        ++   L 
Sbjct: 2   DDTDQERTEQPTGKRLQQAREKGQIARSKELGTASVLLAAVFGLLMVKESLAGAMVKILT 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
           +   +  + +  D + +  ++  L       +    +L  +       +      +   +
Sbjct: 62  IGF-TLDRDQAFDPNAMGAMVPALLRELLHPLGLLFMLVAIAAFIGNTLMGGMNFSSEAM 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
            P + ++S   GIKR++ + +LV  +KS  K++ +       L+  +  +L+        
Sbjct: 121 LPKWSKLSPLNGIKRMFGVQSLVELIKSIAKVVFITLFAWWMLSSQFNHLLNLSLEGYPG 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            +  A   +  +LI++   +  +  +D+ +       +LKM+KQE+KDE K S G P +K
Sbjct: 181 GIIDALDLLLWMLIILCCALIPIVAIDVPFQQWNHMRQLKMTKQEVKDEFKDSEGKPEVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYI-QTENDAPVLVAKGQNLIAKK 302
            R + +       +MM    +A ++ITNPTHY++AL+Y       AP +VAKG + IA K
Sbjct: 241 GRIRRLQMEMAMRRMMGDVPKADVVITNPTHYSVALKYDTAKPGAAPKVVAKGTDEIAMK 300

Query: 303 MRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +R+IA E+ IPI   P L R++F    I   IP   + AVAQ++  +Y  K
Sbjct: 301 IREIAREYEIPIMPSPGLTRAIFHSTEIGHEIPEGLFAAVAQVLAYVYQLK 351


>gi|152997434|ref|YP_001342269.1| flagellar biosynthetic protein FlhB [Marinomonas sp. MWYL1]
 gi|150838358|gb|ABR72334.1| flagellar biosynthetic protein FlhB [Marinomonas sp. MWYL1]
          Length = 378

 Score =  352 bits (903), Expect = 6e-95,   Method: Composition-based stats.
 Identities = 102/353 (28%), Positives = 183/353 (51%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+    KTE+ SSKK++DA N+GN P S++ S    ++     +    +  +  + +
Sbjct: 1   MAENEDGSEKTESASSKKLQDARNKGNLPRSKDLSSALLLIVAAATIYGTGTLLVRDL-A 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L        +  + D+S +VF L    ++    ++  + +  + GI   +       + 
Sbjct: 60  VLFDFNFLVERADVFDLSRMVFHLYESVVAMMDSMVLLMAVLAVAGIVGSIALGGLNFSW 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   ++S   G+KR++S+ +LV   KS  K+ LVG +  + +       L     +
Sbjct: 120 EPLTPKLSKMSPIAGLKRMFSVQSLVELFKSIAKVTLVGIVSVLVVNYFLPETLGLTFQS 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H    V    + + L +A +  +D+ +       KLKM+KQE+KDE KQ  G+P
Sbjct: 180 IELAIAHGIDIVIWSFVFVTLALALIAAIDVPFQVWSHKEKLKMTKQEVKDEYKQQEGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           +++ R + + R    ++MM     A +IITNPTH+++AL+Y Q    APVL+AKG + IA
Sbjct: 240 LVRGRIRQMQRQAAMNRMMSDVPSADVIITNPTHFSVALKYDQAGGAAPVLLAKGGDFIA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++   ++IP+ + P+LAR+++    I   IP   +K VAQL+  +Y  +
Sbjct: 300 LKIREVGNHYDIPVIQSPALARAIYHHTEIGDEIPQGLFKVVAQLLAYVYQLR 352


>gi|54308128|ref|YP_129148.1| flagellar biosynthesis protein FlhB [Photobacterium profundum SS9]
 gi|46912554|emb|CAG19346.1| putative flagellar biosynthetic protein FlhB [Photobacterium
           profundum SS9]
          Length = 376

 Score =  352 bits (903), Expect = 6e-95,   Method: Composition-based stats.
 Identities = 87/353 (24%), Positives = 178/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS++D    +TE  + +K+E A  +G    S+E +  + ++   + L+++      ++  
Sbjct: 1   MSDSD-GQERTEDATPRKLEQAREKGQVARSKELASVAVLVMGAVSLIWYGEGLGKALAE 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  +  S ++ ++ D+S +  ++     S    +   L++  +  +           ++
Sbjct: 60  IMTQMF-SLSREEIYDLSRLFSIMLTAIWSVVFPLGLVLVVLFLAALIGAAGLGGVSFSV 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   +++   G KR++ + + V  +KS +K++LV  +    +  +    L      
Sbjct: 119 EAAMPKLSKMNPMSGFKRMFGMQSWVELIKSILKVLLVAGVAAYLMYSSLNDFLLLSLEI 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             S ++HA   + + +++I   +  +  +D+ +   Q   +LKM+KQE+KDE K + G P
Sbjct: 179 YPSNIFHALDILMQFILLICCSLLVIVAIDVPYQIWQHNEQLKMTKQEVKDEYKDTEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM    +A +II NP H+++ALRY    + AP+++AKG +  A
Sbjct: 239 EVKGRIRMLQREMAQRRMMADVPQADVIIINPEHFSVALRYDPKLDSAPIVIAKGVDHTA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA +HNI I   P LAR+++    +   IP   + AVAQ++  I+  K
Sbjct: 299 LKIREIANKHNIDIVSAPPLARAIYHTTELEQHIPDGLFVAVAQVLAYIFQLK 351


>gi|254258153|ref|ZP_04949207.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei
           1710a]
 gi|254216842|gb|EET06226.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei
           1710a]
          Length = 401

 Score =  351 bits (902), Expect = 7e-95,   Method: Composition-based stats.
 Identities = 105/353 (29%), Positives = 182/353 (51%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+  ++TEA + K+ E A  EG    SRE + F+ + A          P    + +
Sbjct: 1   MAE-DSDLDRTEAATPKRREKAREEGQVARSRELASFALLSAGFYGAWMLSGPIGEHLRT 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            LH    S  +    D + ++     LSL     + P L L  +  + + +     +++ 
Sbjct: 60  MLHTAF-SFDRAAAFDTNRMLSHAGTLSLEGLYALAPVLALTGVAALAAPMAMGGWLVST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
              +  F+R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +  
Sbjct: 119 KTFELKFERLNPITGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELLGLATQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            H+ L  A   V     M +  +  +  LD+ +   Q+  KL+M+K+EIK E +++ G+P
Sbjct: 179 LHAALADALHLVAVCCGMTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEIKREHRENEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM     A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A
Sbjct: 239 HVKGRIRQQQRAMARRRMMANVPTADVVVTNPTHFAVALKYTDGEMRAPKVVAKGVNLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EH++P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 299 ARIRELAAEHHVPLLEAPPLARALYHNVELEREIPGTLYSAVAEVLAWVYQLK 351


>gi|238919250|ref|YP_002932765.1| flagellar biosynthetic protein FlhB, [Edwardsiella ictaluri 93-146]
 gi|238868819|gb|ACR68530.1| flagellar biosynthetic protein FlhB, putative [Edwardsiella
           ictaluri 93-146]
          Length = 388

 Score =  351 bits (902), Expect = 7e-95,   Method: Composition-based stats.
 Identities = 107/353 (30%), Positives = 179/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE  +   KTE P+  +IE A  +G  P SRE +    + A L  +L       +S+  
Sbjct: 1   MSEE-SDLEKTEDPTPHRIEKAREKGQIPRSRELTSILMLAAGLAIMLLGGEYLAHSLAE 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L +  QR L +   ++  L  L   A   ++P L   M+ G  + ++    + + 
Sbjct: 60  MIAQGL-NFDQRLLSNDKQMLIQLGMLLQQAVAALMPVLFGLMLVGWCAPMLIGGFLFSP 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + +K    R++   G KR++S   L   +K  +K  LVG +    L   +  ML  ++  
Sbjct: 119 SSIKCDLNRLNPLSGFKRMFSSQVLAELLKGILKAALVGWVCGWFLLHYWSRMLRLVTEP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               +  A   V    ++++L +  +   D+ +      SKL+M+KQEIKDE K+  G+P
Sbjct: 179 TLDAMGDALHLVGMCGLLVVLGLLPMVGFDVFYQVWSNLSKLRMTKQEIKDEFKEQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM     A +I+TNPTHYA+AL+Y + +  AP ++AKG   +A
Sbjct: 239 HVKGRIRQQQRAAARRRMMSDVPGADVIVTNPTHYAVALQYQENKMSAPKVLAKGAGEVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           ++++ +  EH IP  E P LAR+L++   I  AIP   Y AVA+++  +Y  K
Sbjct: 299 QRIKALGAEHRIPQLEAPPLARALYRHSEIGQAIPATLYAAVAEVLAWVYQLK 351


>gi|323491458|ref|ZP_08096642.1| flagellar biosynthesis protein FlhB [Vibrio brasiliensis LMG 20546]
 gi|323314327|gb|EGA67407.1| flagellar biosynthesis protein FlhB [Vibrio brasiliensis LMG 20546]
          Length = 376

 Score =  351 bits (902), Expect = 7e-95,   Method: Composition-based stats.
 Identities = 87/353 (24%), Positives = 178/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+D    +TE  + ++++ A  +G    S+E +  S ++   + L++F      ++ +
Sbjct: 1   MAESD-GQERTEDATPRRLQQAREKGQVARSKELASVSVLVIGSVALMWFGEGLARALFT 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L  S ++ ++ D   +  +      S    ++  L+   +  +           ++
Sbjct: 60  AMGRLF-SLSREEIFDQVKLFDIALGSLSSLLLPLLLILVTLFIAALIGAAGVGGISFSV 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P + +++   G+KR+  + + V  +KS +K+ LV  +    +      +       
Sbjct: 119 EAAMPKWSKMNPLSGLKRMVGLQSWVELIKSILKVALVSGMAFYLINAAKEDLFQLSMDV 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               ++HA   +   +++I   +  +  +DI +   Q  ++LKM+KQE+KDE K++ G P
Sbjct: 179 YPQNIFHALDILLNFILLISCTLLLVVAIDIPFQIWQHANQLKMTKQEVKDEYKETEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM    +A +I+TNP H+++ALRY Q  + AP++VAKG + +A
Sbjct: 239 EVKGRIRMLQREAAQRRMMAEVPQADVIVTNPEHFSVALRYKQDSDRAPIVVAKGTDHMA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA EH+I +   P LAR+L+    +   IP   + AVAQ++  ++  K
Sbjct: 299 LKIREIAREHDIYVVPAPPLARALYHSTELEQEIPDGLFTAVAQILAYVFQLK 351


>gi|77457779|ref|YP_347284.1| flagellar biosynthesis protein FlhB [Pseudomonas fluorescens Pf0-1]
 gi|77381782|gb|ABA73295.1| flagellar biosynthetic protein flhb [Pseudomonas fluorescens Pf0-1]
          Length = 379

 Score =  351 bits (902), Expect = 8e-95,   Method: Composition-based stats.
 Identities = 92/353 (26%), Positives = 175/353 (49%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+++  +KTE P+ K+ +D+  +G    S+E +  + +LA    LL F       +  
Sbjct: 1   MAESESGQDKTEDPTEKRKKDSREKGEIARSKELNTLAIMLAGSAALLIFGGMLAQELMD 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +     + ++  + D   +   L    L A   + P ++  ++      +     +   
Sbjct: 61  LMRQNF-TLSREVIMDERSMATFLMSSGLQALLAIQPIMITLLLAAFLGPIALGGWLFAA 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++   G+KR++S+  +V  +K+  K ++   +  + L  +   +L      
Sbjct: 120 GSLAPKFSRMNPAAGLKRMFSMKAVVELLKALAKFLITLGVALVVLNSDIDDLLRIAHEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V    + +   +  +  +D+     +   KLKM+KQE++DE K   G P
Sbjct: 180 LDRAIIHSLQLVGWSSLWLACGLIIIAAVDVPVQIWESIKKLKMTKQEVRDEHKDQEGRP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM A   A ++ITNPTHYA+AL+Y   +  AP+L+AKG + +A
Sbjct: 240 EVKQRIRQLQREMSQRRMMAAIPDADVVITNPTHYAVALKYDAEKGGAPMLLAKGSDFLA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA  +N+ + E P+LARS++    +   IP   Y AVAQ++  +Y  +
Sbjct: 300 LKIREIAVANNVMLLESPALARSIYYSTELEEEIPGGLYLAVAQVLAYVYQIR 352


>gi|269961633|ref|ZP_06175995.1| Flagellar biosynthetic protein flhB [Vibrio harveyi 1DA3]
 gi|269833674|gb|EEZ87771.1| Flagellar biosynthetic protein flhB [Vibrio harveyi 1DA3]
          Length = 376

 Score =  351 bits (902), Expect = 8e-95,   Method: Composition-based stats.
 Identities = 91/353 (25%), Positives = 174/353 (49%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+D    +TE  + ++++ A  +G    S+E +  S ++   I L++F      S+ S
Sbjct: 1   MAESD-GQERTEEATPRRLQQAREKGQVARSKELASASVLIVGAIALMWFGESLARSLFS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L     + ++ D + +  +           +   L+   +  +           + 
Sbjct: 60  IMSRLFD-LKRDEIFDTAKLFDIAFGAMTDLLFPLFLILITLFVAAMIGAAGVGGISFSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   +++   G+KR+  + + V  +KS +K+ LV  +    +  +   ++      
Sbjct: 119 EAAMPKLSKMNPLSGLKRMVGMQSWVELIKSILKVALVTGMAIYLIQASQADLIQLSMDV 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               ++HA   +   +++I   +  +  LDI +   Q   +LKM+KQEIKDE K++ G P
Sbjct: 179 YPQNIFHALDILLNFILLISCSLLIVVALDIPFQIWQHADQLKMTKQEIKDEYKETEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM    +A +IITNP H+++ALRY Q  + APV++AKG + +A
Sbjct: 239 EVKGRIRMLQREAAQRRMMADVPQADVIITNPEHFSVALRYKQKTDRAPVVIAKGTDHMA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++A EH+I I   P LAR+L+    +   IP   + AVAQ++  ++  K
Sbjct: 299 MKIREVAREHDITIVPAPPLARALYHTTELEQEIPDGLFTAVAQVLAFVFQLK 351


>gi|209695727|ref|YP_002263657.1| flagellar biosynthesis protein FlhB [Aliivibrio salmonicida
           LFI1238]
 gi|208009680|emb|CAQ79979.1| polar flagellar assembly protein FlhB [Aliivibrio salmonicida
           LFI1238]
          Length = 376

 Score =  351 bits (902), Expect = 8e-95,   Method: Composition-based stats.
 Identities = 99/353 (28%), Positives = 187/353 (52%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++D    +TE  +SK+++ A ++G    S+E +  S ++   I L++F      ++ S
Sbjct: 1   MADSD-GQERTEDATSKRLQQAKDKGQVARSKELASVSVLVCGAISLMWFGDEVGKALLS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +     S ++ ++ D + ++ ++    ++    V+  LL+  +  +           + 
Sbjct: 60  IMSRFF-SISREEIFDTNKLLEIVGGALVALVFPVLKILLMLFVAALIGAAGLGGISFSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   +++   GIKR++ + + V  +KS +K+ LVG      + ++   +       
Sbjct: 119 EAAMPKPSKMNPMSGIKRMFGMQSWVELLKSILKVSLVGGTAFYLINKSKADLFQLSLDT 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             S ++H+   +   +++I   +  +  +DI +   Q  ++LKM+KQEIKDE K++ G P
Sbjct: 179 YPSNIFHSLDILLNFILLISCTLLIVVAIDIPFQIWQHANQLKMTKQEIKDEYKETEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM     A +I+TNP HY++ALRY QT++ AP++VAKG + IA
Sbjct: 239 EVKGRIRMLQREMTQRRMMADVPSADVIVTNPEHYSVALRYDQTKDSAPIVVAKGVDHIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA EHNI I   P LAR+L+    +   IP   + AVAQ++  I+  K
Sbjct: 299 MKIREIAREHNIDILPAPPLARALYHSTEVEQQIPDGLFAAVAQILAYIFQMK 351


>gi|76581465|gb|ABA50940.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei
           1710b]
          Length = 470

 Score =  351 bits (902), Expect = 8e-95,   Method: Composition-based stats.
 Identities = 103/350 (29%), Positives = 179/350 (51%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+  ++TEA + K+ E A  EG    SRE + F+ + A          P    + + LH
Sbjct: 72  EDSDLDRTEAATPKRREKAREEGQVARSRELASFALLSAGFYGAWMLSGPIGEHLRTMLH 131

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
               S  +    D + ++     LSL     + P L L  +  + + +     +++    
Sbjct: 132 TAF-SFDRAAAFDTNRMLSHAGTLSLEGLYALAPVLALTGVAALAAPMAMGGWLVSTKTF 190

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +  F+R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +   H+
Sbjct: 191 ELKFERLNPITGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELLGLATQPLHA 250

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            L  A   V     M +  +  +  LD+ +   Q+  KL+M+K+EIK E +++ G+P +K
Sbjct: 251 ALADALHLVAVCCGMTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEIKREHRENEGDPHVK 310

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R +   R+  R +MM     A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A ++
Sbjct: 311 GRIRQQQRAMARRRMMANVPTADVVVTNPTHFAVALKYTDGEMRAPKVVAKGVNLVAARI 370

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R++A EH++P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 371 RELAAEHHVPLLEAPPLARALYHNVELEREIPGTLYSAVAEVLAWVYQLK 420


>gi|88813214|ref|ZP_01128454.1| flagellar biosynthesis protein [Nitrococcus mobilis Nb-231]
 gi|88789536|gb|EAR20663.1| flagellar biosynthesis protein [Nitrococcus mobilis Nb-231]
          Length = 385

 Score =  351 bits (901), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 103/354 (29%), Positives = 186/354 (52%), Gaps = 2/354 (0%)

Query: 1   MSEN-DAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVT 59
           M+E     + KTEAP++K+  +A  +G  P SRE +   ++L+    LL F +    S+ 
Sbjct: 1   MAEEHSNGEEKTEAPTAKRRHEAKEQGQVPRSRELTTLLAMLSAAGGLLIFGNYMTDSLA 60

Query: 60  SDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLN 119
             L   L    +  + D    + LL  +       V P  L+ ++  + + +       +
Sbjct: 61  DALRQGL-HVGRDAIFDPQAPIRLLREMIAQGLWAVGPLALVLLLVALVAPVALGGWTFS 119

Query: 120 LNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISA 179
              + P   ++   +G+KR++ ++ LV   KS  K++LVG + T +L ++        + 
Sbjct: 120 AKALAPKLSKLDPVKGLKRLFGVHGLVELGKSLAKVMLVGAVGTYALWQSLDDFQALAAE 179

Query: 180 NPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
                L HA        +M+   +  + ++D+ +       KL+M+KQE+KDE+KQ+ G 
Sbjct: 180 ALFPALQHAARIFNTTFLMLATALILIALVDVPFQLWDHTRKLRMTKQELKDELKQTEGK 239

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLI 299
           P +K+R + + +   + +MME   +A +++TNPTH+A+ALRY      AP L+AKG +LI
Sbjct: 240 PEVKSRIRQLQQQAAQGRMMEQVPKADVVVTNPTHFAVALRYDPLHMRAPRLMAKGTDLI 299

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A+++R+IA ++ +P+FE P LAR+L     ++  +P   Y AVAQ++  IY  +
Sbjct: 300 AQRIRRIAEDNGVPLFEAPPLARALHYTTELDQEVPAGLYLAVAQVLAYIYQLR 353


>gi|90406806|ref|ZP_01214998.1| flagellar biosynthesis protein [Psychromonas sp. CNPT3]
 gi|90312043|gb|EAS40136.1| flagellar biosynthesis protein [Psychromonas sp. CNPT3]
          Length = 379

 Score =  351 bits (901), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 89/353 (25%), Positives = 177/353 (50%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+    ++E  + ++I  +  +G    S+E +  S +++  I ++ F     Y ++ 
Sbjct: 1   MAENENGTERSEEATPERIRKSKEKGQVARSKELATASVLISAAIAMMTFGGRLAYELSI 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +     +  +  L    +I   L+      +  +   L +  +  I    +    + + 
Sbjct: 61  MMKRSF-TFERSVLFSPEYIWLHLSTSFYGLAWPMFIILFMLFVISILGSSLLGGMLFST 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P + R+S + G+KR+  +   V  +KS +K+++V       L   +  +L    ++
Sbjct: 120 KALMPKWNRLSPKAGLKRMLGMQAWVELLKSILKVLVVVGAAWWILGATFEHILHLSVSS 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               +Y A   +  + +M+   +  +  +D+ +  ++   +LKM+KQEIKDE + S G P
Sbjct: 180 LPGSVYEALDMLLWMFLMLCCSLLIIVAIDVPYQIYKHKEELKMTKQEIKDEYRNSEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + +     + KMME    A +I+TNPTHY++AL+Y Q    AP +VAKG + +A
Sbjct: 240 EVKQRIRQLQYEASQRKMMEDVPDADVIVTNPTHYSVALKYEQNGERAPYVVAKGVDFMA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++A ++ IP+ E P L R+++    IN  +P   + A+AQ++  IY  +
Sbjct: 300 LKIREVARDNEIPVMESPPLCRAIYHTTEINEEVPEELFIAIAQILAYIYQLE 352


>gi|297538882|ref|YP_003674651.1| flagellar biosynthetic protein FlhB [Methylotenera sp. 301]
 gi|297258229|gb|ADI30074.1| flagellar biosynthetic protein FlhB [Methylotenera sp. 301]
          Length = 394

 Score =  351 bits (901), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 97/354 (27%), Positives = 182/354 (51%), Gaps = 2/354 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   KTE  SSK++E+A  EG+ P SRE +  + +    + +L        ++ +
Sbjct: 1   MAE-DSDLEKTEQASSKRLEEARKEGDVPRSRELATVTVLFTAGLTILIMSEHLNQALKT 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L    +    + + ++        S      P  L+ +   I + ++    + + 
Sbjct: 60  TMSAGL-QFDRTAAFEPTVLLMRTADSISSLLTAFAPLALILVAVAIAAPVLVGGWIFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P F R++  +G+  I S N+LV  +KS  K++LVG +  + ++ +   +L   +  
Sbjct: 119 KAFVPQFSRLNPIKGLTNIISKNSLVELVKSIAKVMLVGIVAYVVISHDMEPILTLSTLP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             S +      +    + I+  +  +  +D+ +  + + +KLKM+K+E++ E K+S GNP
Sbjct: 179 LKSSIAQVGSLMLTGFLTIVSTLVFIAAIDVPYQLYHYANKLKMTKEEVRQESKESDGNP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK + +   R   + +MM     A ++ITNPTHYA+A++Y      APV+VAKG + +A
Sbjct: 239 EIKAKIRQQQREMAKRRMMSEIPNADVVITNPTHYAVAIKYQDEGMRAPVVVAKGADEVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKKI 354
            K+R++A EH + I E P LAR+L+    + + IP   Y AVA+++  ++  +I
Sbjct: 299 LKIREVAGEHKVLIMESPKLARALYAHTELGNEIPEALYSAVAEILAYVFQMRI 352


>gi|88858095|ref|ZP_01132737.1| flagellar biosynthesis protein [Pseudoalteromonas tunicata D2]
 gi|88819712|gb|EAR29525.1| flagellar biosynthesis protein [Pseudoalteromonas tunicata D2]
          Length = 376

 Score =  351 bits (901), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 95/353 (26%), Positives = 169/353 (47%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  +   KTE P+SKK+EDA  +G    S+E      ++   I L+ +       +  
Sbjct: 1   MAEG-SDQEKTEEPTSKKLEDARKKGQIARSKETGTVVVLIMSAISLIIYGPEIGMGLKR 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  LL    + +  D + +  +   ++      +   +L+ ++              + 
Sbjct: 60  VMARLLD-LNRTEAFDTTKMFAVWGDIAKELWFGMTMFVLVILVAAFIGNTFLGGFNFSW 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           +   P   ++S  +G+ R++     +   K  +K +LV     + +   ++ +L      
Sbjct: 119 SAAAPQANKLSPAKGLVRMFGPQAAIELFKGLLKFLLVAVTAVLLIKFYFYEILHLSLET 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             S + HA   +  + + +   +  + V+D  +       +LKM+ QE+KDE K S G+P
Sbjct: 179 APSNIQHALTMLAWMFLGLSCTLILVAVVDAPFQLWNHNKQLKMTLQEVKDEYKNSEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R +   R   + +MM+    A +I+TNPTHY++AL+Y      AP+++AKG + IA
Sbjct: 239 QIKARIRRTQREMSQRRMMQDVPDADVIVTNPTHYSVALKYDTDRAGAPIVLAKGIDEIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++RKIA EH++PI E P L RSLF    I   IP   + AVAQ++  +Y  K
Sbjct: 299 LQIRKIAKEHDVPILESPMLTRSLFHTTDIGQQIPDQLFIAVAQVLAYVYQLK 351


>gi|85859183|ref|YP_461385.1| flagellar biosynthesis pathway component [Syntrophus aciditrophicus
           SB]
 gi|85722274|gb|ABC77217.1| flagellar biosynthesis pathway component [Syntrophus aciditrophicus
           SB]
          Length = 354

 Score =  351 bits (900), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 103/353 (29%), Positives = 188/353 (53%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E++    +TE  + K+ E+A  +G    SR+ +  + + ACL+Y  F  +  ++ +  
Sbjct: 1   MAESNKDQERTEEATPKRREEAREQGQVAKSRDLASVAILSACLLYFYFGANSFLHQLMD 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +    +S     +    +I  LL         L+ P LL+  +  + S ++Q    ++ 
Sbjct: 61  LMKSSFSSLDSSLVTT-ENIQSLLFSAFYKTITLMTPFLLVVCIAALSSNILQVGFKIST 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   ++   +G  R++S+ +L+ F+KS  KI + G +  +++      +L    ++
Sbjct: 120 KAIAPKLSKIDPAKGFARLFSLQSLIEFIKSIFKISIAGFVAYLTVKSELVDILPLADSS 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
              IL +   T  ++L+     +  L ++D  +   ++   LKMS+QEIKDE KQ+ G+P
Sbjct: 180 VWEILVYITGTSFRILLTTCWVLIILALMDYLYQRWEYERNLKMSRQEIKDENKQTEGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           I+K R + + R   + +MM    +A +IITNPTH A+AL+Y Q    AP ++AKG   +A
Sbjct: 240 IVKARIRRLQREMAQRRMMANVPKADVIITNPTHLAVALQYDQDSMIAPKVIAKGAGYLA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +K+++IA E  +P+ E   LA+ L+K V ++  IP   YKAVA+++  IY  K
Sbjct: 300 EKIKEIARESRVPLVENKPLAQVLYKMVEVSGTIPDSLYKAVAEILAYIYSIK 352


>gi|296133030|ref|YP_003640277.1| flagellar biosynthetic protein FlhB [Thermincola sp. JR]
 gi|296031608|gb|ADG82376.1| flagellar biosynthetic protein FlhB [Thermincola potens JR]
          Length = 368

 Score =  351 bits (900), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 93/347 (26%), Positives = 175/347 (50%), Gaps = 1/347 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE  ++KK + A  EG    S E +    +LA  I +  FF   +  ++     +  
Sbjct: 19  QEKTEKATAKKRQKARQEGQVLKSMEFNSAVVLLATFISIKLFFPYMLEQLSGFFREIYR 78

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRL-VIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
               +     +     L   ++  S + V+P   + ++ G+ + L+Q   +     +KP+
Sbjct: 79  MWGSQDFVLNARTSHQLYFSTIKVSFMTVLPIAGIAVVSGVAANLLQSGFIFTTKPLKPN 138

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
              ++   GIKR++ + +LV  +KS VK+ +VG I        +      +  N  +   
Sbjct: 139 ISALNPINGIKRMFGVRSLVELVKSLVKVAIVGYIAYTGYKSEFNKFPQLLDMNIRASSL 198

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
                +  +   I + +   +  D  + + ++   LKM+KQE+K+E+KQ+ G+P +K   
Sbjct: 199 FIGRLILNMAFKIAVCLLIFSGFDYWYQWWEYERSLKMTKQEVKEELKQTEGDPKVKAAI 258

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           +   +     +MM+A  +A ++ITNPTHYA+AL+Y      AP +VAKGQ+ +A++++++
Sbjct: 259 RRKQQQMSVARMMQAVPKADVVITNPTHYAVALKYDADTMSAPEVVAKGQDYLAQRIKQV 318

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A EH + + E   LA++L+  V I  +IP   Y+AVA+++  +Y  K
Sbjct: 319 AKEHGVVLVENKPLAQALYNAVEIGESIPAELYQAVAEVLAFVYKLK 365


>gi|261344152|ref|ZP_05971796.1| flagellar biosynthetic protein FlhB [Providencia rustigianii DSM
           4541]
 gi|282567746|gb|EFB73281.1| flagellar biosynthetic protein FlhB [Providencia rustigianii DSM
           4541]
          Length = 383

 Score =  351 bits (900), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 100/353 (28%), Positives = 179/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS+  +   KTE P+  K + A ++G    S+E S    +LA +  L          +  
Sbjct: 1   MSDE-SDVEKTEEPTPHKKQKAKDDGQIVRSKELSSLMMMLAGVSLLWLSGGHLAAQLRQ 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +           L++   ++  L  +   A   ++P +    + GI +  +    + N 
Sbjct: 60  IMRQGFI-FDGHYLQNTKLMLNYLGSVVSEALFALLPVIGGLALVGISASSLVGGLLFNS 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K   K++   +G+KRI+S+N L    K+ +K + VG    I L +++ ++L  +   
Sbjct: 119 KLIKFDPKKLDPIKGLKRIFSMNALSELFKAILKSLFVGLGTWIFLWQSWPSLLHLVMEP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + L +A   V     +I+  +  +   D+ + +     KL+MS+QEIKDE KQ  G+P
Sbjct: 179 PVTALGNALEKVIFAGYLIVFMLIPMVAFDVFYQFRSHLKKLRMSRQEIKDEFKQQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK + +   R+  R++MM     A +I+TNPTHYA+AL+Y   +  AP ++AKG  +IA
Sbjct: 239 HIKAKIRQQQRAIARNRMMADVPSADVIVTNPTHYAVALKYDDKKMGAPKVLAKGAGVIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +++++I  E+ I   E P LAR+L++   I  +IP   Y AVA+++  +Y  +
Sbjct: 299 QRIKEIGEENRILQLEAPPLARALYRHAEIGQSIPVALYAAVAEVLAWVYQLR 351


>gi|192360845|ref|YP_001982207.1| flagellar biosynthesis protein FlhB [Cellvibrio japonicus Ueda107]
 gi|190687010|gb|ACE84688.1| flagellar biosynthetic protein FlhB [Cellvibrio japonicus Ueda107]
          Length = 379

 Score =  351 bits (900), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 96/354 (27%), Positives = 172/354 (48%), Gaps = 2/354 (0%)

Query: 1   MSE-NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVT 59
           M+E +D+   KTE PS++++E A  EG  P SR+ +  + +L   I L  F       + 
Sbjct: 1   MAEGDDSSQEKTEEPSARRLEKAREEGQIPRSRDLTTTAVLLLAAIGLWVFAEFMGGKLL 60

Query: 60  SDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLN 119
                     ++  + D + ++  L          + P ++L ++  I   +     +++
Sbjct: 61  GITRENFI-ISRTDIFDTNAMISHLVRAIYQGMLSMAPLMVLLLIASIVGPIALGGWLMS 119

Query: 120 LNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISA 179
              + P   R+    G+KRI+S+ +L+   K+ +K+ ++       L      M      
Sbjct: 120 SKAMMPKLSRMDPIAGLKRIFSLKSLIELFKALLKVSIILLTTIWLLFLYAQDMFRISDE 179

Query: 180 NPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
              + + H+        I +      +  +DI    ++   KLKMS+Q++KDE K + G 
Sbjct: 180 AVGNAIVHSLEISIYATIALAATTIVIAAVDIPLQLYEHNKKLKMSRQDLKDEAKDTDGK 239

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLI 299
           P +K R + + R   + +MM     A ++ITNPTH+A+AL+Y     D P+++AKG + I
Sbjct: 240 PEVKGRIRQLQREMAQRRMMANVPMADVVITNPTHFAVALKYDPETMDTPIMLAKGGDNI 299

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A K+R+IA  HNI   E P LAR+++    I+ AIP   Y AVAQ++  ++  +
Sbjct: 300 ALKIREIAKAHNIETIESPPLARAIYYTTEIDQAIPSGLYLAVAQVLAYVFQLR 353


>gi|167838295|ref|ZP_02465154.1| flagellar biosynthesis protein FlhB [Burkholderia thailandensis
           MSMB43]
          Length = 401

 Score =  351 bits (900), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 100/353 (28%), Positives = 177/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+  ++TEA + K+ E A  EG    SRE + F+ + A          P    + +
Sbjct: 1   MAE-DSDLDRTEAATPKRREKAREEGQVARSRELASFALLSAGFYGAWMLSGPIGEHLRT 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +     S  +    D + ++     LSL     + P L L  +  + + +     +++ 
Sbjct: 60  MMRAAF-SFDRAAAFDTNRMLSHAGTLSLEGLYALAPVLALTGVAALAAPMALGGWLVST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
              +  F R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +  
Sbjct: 119 KTFELKFDRLNPVTGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELLGLATQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             + L  A   V     M +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P
Sbjct: 179 LDAALAGALHLVAVCCGMTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEVKREHRENEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM     A +++TNPT +A+AL+Y   E  AP +VAKG NL+A
Sbjct: 239 HVKGRIRQQQRAMARRRMMANVPTADVVVTNPTRFAVALKYTDGEMRAPKVVAKGVNLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EH +P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 299 ARIRELAAEHRVPLLEAPPLARALYHNVDLEREIPGTLYSAVAEVLAWVYQLK 351


>gi|84388124|ref|ZP_00991020.1| flagellar biosynthesis protein [Vibrio splendidus 12B01]
 gi|84377191|gb|EAP94061.1| flagellar biosynthesis protein [Vibrio splendidus 12B01]
          Length = 376

 Score =  351 bits (900), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 89/353 (25%), Positives = 180/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+D    +TE  + K+++ A  +G    S+E +  S ++   I L++F      ++  
Sbjct: 1   MAESD-GQERTEDATPKRLQQAKEKGQVARSKELASASVLIVGAISLMWFGESMAKALFE 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L  S ++ ++ D + ++ +     ++    +   L+   +  +           ++
Sbjct: 60  AMQRLF-SLSRDEIFDTNKLLEIAGGALVNLLFPLFLILITLFVAAVIGAAGVGGVNFSM 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   +++   GIKR++ + + V  +KS +K+ LV  +    +  +   ++      
Sbjct: 119 QAAMPKASKLNPLSGIKRMFGLQSWVELLKSILKVALVSGMAIYLIQASQHDLMQLSMDV 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               ++HA   +   +++I   +  +  +DI +   Q   +LKM+KQE+KDE K + G P
Sbjct: 179 YPQNIFHALDILLNFILLISCSLLIVVAIDIPFQIWQHADQLKMTKQEVKDEFKDTEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM    +A +I+TNP H+++ALRY Q ++ AP++VAKG + +A
Sbjct: 239 EVKGRIRMLQREAAQRRMMADVPQADVIVTNPEHFSVALRYKQNQDKAPIVVAKGVDHMA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA E++I I   P LAR+L+    +   IP   + AVAQ++  ++  K
Sbjct: 299 MKIREIARENDIYIIPAPPLARALYHTTELEQQIPDGLFAAVAQVLAYVFQLK 351


>gi|59712446|ref|YP_205222.1| flagellar biosynthesis protein FlhB [Vibrio fischeri ES114]
 gi|59480547|gb|AAW86334.1| flagellar export pore protein FlhB [Vibrio fischeri ES114]
          Length = 376

 Score =  351 bits (900), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 94/353 (26%), Positives = 186/353 (52%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+D    +TE  +SK+++ A ++G    S+E +  S ++   + L++F      ++ S
Sbjct: 1   MAESD-GQERTEDATSKRLQQAKDKGQVARSKELASVSVLVCGAVALMWFGEDVARALFS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +     S ++ ++ D + ++ ++    ++    V   L+   +  +           + 
Sbjct: 60  VMERFF-SISREEIYDTNKLLEIVGGALIALVFPVFLILITLFVAALAGAAGLGGISFSS 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P F +++   GIKR++ + + V  +KS +K+ LVG +    +  +   +       
Sbjct: 119 EAAMPKFSKMNPMSGIKRMFGMQSWVELLKSILKVSLVGGMAFYLIEGSKEDLFQLSLDT 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             + ++H+   +   +++I   +  +  +DI +   Q  ++LKM+KQE+KDE K++ G P
Sbjct: 179 YPANIFHSLDILLNFILLISCTLLIVVAIDIPFQIWQHANQLKMTKQEVKDEYKETEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM     A +++TNP HY++ALRY Q+++ AP++VAKG + +A
Sbjct: 239 EVKGRIRMLQREMTQRRMMADVPSADVVVTNPEHYSVALRYDQSKDAAPIVVAKGVDHVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA EHNI I   P LAR+L+    +   IP   + AVAQ++  I+  K
Sbjct: 299 MKIREIAREHNIDILPAPPLARALYHSTELEQQIPDGLFAAVAQILAYIFQMK 351


>gi|312962260|ref|ZP_07776752.1| flagellar biosynthetic protein FlhB [Pseudomonas fluorescens WH6]
 gi|311283597|gb|EFQ62186.1| flagellar biosynthetic protein FlhB [Pseudomonas fluorescens WH6]
          Length = 378

 Score =  351 bits (900), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 98/353 (27%), Positives = 174/353 (49%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+++  +KTE P+ K+ +D+  +G    S+E +  ++++A    LL +       +  
Sbjct: 1   MAESESGQDKTEDPTEKRKKDSREKGEIARSKELNTVATMMAGSGALLIYGGGLALDLLE 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +     S  +  L +   +   L H    A   V P L+  ++  +   +     +   
Sbjct: 61  LMKHNF-SLPREVLLNPDSMGQYLMHSGKIALLAVQPILITLLLAALIGPVALGGWLFAA 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++   G+KR++S   LV  +K+  K IL+  +    L+ +   +L      
Sbjct: 120 GSMAPKFSRMNPAAGLKRMFSAKALVELLKALAKFILILFVALSVLSSDVDDLLRIAHEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             S + H+   V    + +   +  +  +D      + + KL M+KQE++DE K   G P
Sbjct: 180 LESAIIHSVQVVGWSALWMSAGLIIIAAVDAPIQLWESHKKLLMTKQEVRDEHKDQEGRP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + KMM A   A ++ITNPTHYA+AL+Y   +  AP+L+AKG +  A
Sbjct: 240 EVKQRIRQLQREMSQRKMMAAVPDADVVITNPTHYAVALKYDPEKGGAPMLLAKGSDFTA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA  + I + E P LARS+F    ++  IP   Y AVAQ++  +Y  +
Sbjct: 300 LKIREIAVANEILLLESPELARSIFYSTDLDHEIPAGLYLAVAQVLAYVYQIR 352


>gi|183598609|ref|ZP_02960102.1| hypothetical protein PROSTU_02008 [Providencia stuartii ATCC 25827]
 gi|188020787|gb|EDU58827.1| hypothetical protein PROSTU_02008 [Providencia stuartii ATCC 25827]
          Length = 383

 Score =  351 bits (900), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 101/353 (28%), Positives = 179/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS+  +   KTE P+  K + A ++G    S+E S    +LA +  L          +  
Sbjct: 1   MSDE-SDVEKTEEPTPHKKQKAKDDGQIVRSKELSSLMMMLAGVSLLWLSGGHLADELRQ 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
                        +++   +V     +   A   ++P +    + GI +  +    + N 
Sbjct: 60  IFRQGFI-FDGHYIQNTLLMVSYFGRMVGEALFALLPVIGGLALVGISASSLVGGLLFNS 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K   K+++   G+KRI+S+N L    K+ +K + VG    I L +N+ ++L  ++ +
Sbjct: 119 KLIKFDLKKLNPISGLKRIFSMNALSELFKAILKSLFVGLGAAIFLWQNWSSLLHLVTES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + L +A   V     +I+  +  +   D+ + +     KL+MS+QEIKDE KQ  G+P
Sbjct: 179 PVTALGNAMHKVIFAGYLIVFLLIPMVAFDVFYQFRSHLKKLRMSRQEIKDEFKQQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK + +   R+  R++MM    +A +I+TNPTHYA+AL+Y      AP ++AKG  +IA
Sbjct: 239 QIKAKIRQQQRAIARNRMMADVPQADVIVTNPTHYAVALKYDDKRMGAPKVLAKGAGVIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +++++I  EH I   E P LAR+L++   I  +IP   Y AVA+++  +Y  +
Sbjct: 299 QRIKEIGQEHRILQLEAPPLARALYRHAEIGQSIPVALYAAVAEVLAWVYQLR 351


>gi|270262410|ref|ZP_06190681.1| flagellar biosynthetic protein FlhB [Serratia odorifera 4Rx13]
 gi|270043094|gb|EFA16187.1| flagellar biosynthetic protein FlhB [Serratia odorifera 4Rx13]
          Length = 398

 Score =  351 bits (900), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 100/350 (28%), Positives = 181/350 (51%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+   K+EAP++ ++E A  +G  P SRE +    ++A L  +          + + L 
Sbjct: 18  EDSDLEKSEAPTAHRVEKAREDGQIPRSRELTSVLMLVAGLSIIWVAGGGMAQQLAAMLT 77

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L +     + +   ++  L  L   A   ++P +   ++  I + ++    +L+   +
Sbjct: 78  QGL-NFDHTMVSNDKQMLRQLGMLLRQAVWALLPIMAGLVLVAITAPMLLGGLLLSGKSL 136

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           K   KR++   G+KR++S   L   +K  +K  LVG I  + L  ++  ML  ++  P  
Sbjct: 137 KFDVKRMNPLSGLKRMFSSQVLAELLKGLLKATLVGWITGLYLWHHWAEMLHLVTQQPLD 196

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            L +A   +    ++++L +  +   D+ +     + KLKM+KQ+I+DE K   G+P +K
Sbjct: 197 ALGNALRMIIFCGLLVVLGLTPMVAFDVFYQLWSHFKKLKMTKQDIRDEFKDQEGDPHVK 256

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R +   R+  R +MM    +A +I+TNPTHYA+AL+Y   +  AP ++AKG   IA ++
Sbjct: 257 GRIRQQQRAIARRRMMADVPKADVIVTNPTHYAVALQYNDQKMSAPKVLAKGAGEIALRI 316

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R++  EH IP+ E P LAR+L++   I   IP   Y AVA+++  +Y  +
Sbjct: 317 RELGTEHRIPMLEAPPLARALYRHSEIGQHIPATLYAAVAEVLAWVYQLR 366


>gi|323158635|gb|EFZ44649.1| flagellar biosynthetic protein FlhB [Escherichia coli E128010]
          Length = 382

 Score =  350 bits (899), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 102/350 (29%), Positives = 189/350 (54%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGGVSLARRLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       + D + I+  +  L   A   ++P +   ++  + S ++    V +   +
Sbjct: 62  AGL-HFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKR++S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V   +++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNAMDLVGLCVLLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R + + R+  R +MM    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++
Sbjct: 241 GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|290474957|ref|YP_003467841.1| putative part of export apparatus for flagellar proteins
           [Xenorhabdus bovienii SS-2004]
 gi|289174274|emb|CBJ81064.1| putative part of export apparatus for flagellar proteins
           [Xenorhabdus bovienii SS-2004]
          Length = 383

 Score =  350 bits (899), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 99/353 (28%), Positives = 176/353 (49%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   KTE P+  K E A  +G    S+E +    +L   + LL+     I    S
Sbjct: 1   MAE-DSDLEKTEEPTPHKREKARKDGQIARSKELTS-ILMLVGGVSLLWMSGNSITHELS 58

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +     +     + +   ++  +  L   A   ++P  +  ++  + +  +    + + 
Sbjct: 59  LMVFEGFNFDHNMVSNDKQMIQQVGRLLKQAVWALLPVFVGLVLVALSAPTLMGGLIFSS 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K    ++S   G+K+I+S+N L    K+ +K  LVG    + +  N+  ML+  +  
Sbjct: 119 KSIKFDLAKLSPISGLKKIFSMNALAELFKAILKASLVGGGTALFIWLNWPAMLNLTAQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   L  A   +     ++L  +  +   D+ +       KL+M++QEIKDE K+  G+P
Sbjct: 179 PLMALSDAMMMLIFAGYIVLFMLIPMVAFDVLYQIRSHLKKLRMTRQEIKDEFKEQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A +I+TNPTHYA+AL+Y   +  AP ++AKG  LIA
Sbjct: 239 HVKARIRQQQRAAARKRMMSDVPKADVIVTNPTHYAVALQYDSKKMGAPKVLAKGAGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++++I  E+ IP+ E P LAR+LF+   +   IP   Y AVA+++  +Y  K
Sbjct: 299 LRIKEIGAENRIPLLEAPPLARALFRHAEVGGFIPATLYAAVAEVLAWVYQLK 351


>gi|168180929|ref|ZP_02615593.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum
           NCTC 2916]
 gi|182668325|gb|EDT80304.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum
           NCTC 2916]
          Length = 609

 Score =  350 bits (899), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 104/347 (29%), Positives = 186/347 (53%), Gaps = 2/347 (0%)

Query: 7   PDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLL 66
            + KTE  + +K  DA  +G    S+E +L  ++LAC + L+     G   +   +   L
Sbjct: 262 SEEKTEEATPRKKMDARKKGQVAKSKELALAFTLLACTLVLVALGEYGANELKETMAGFL 321

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
            +    +L + +++  L     L   ++V+P  L  M FGI +  +Q   +     +KP 
Sbjct: 322 NNYLNMEL-NYNNLNSLAILTVLRVGKIVLPVALPIMCFGIAANYLQTGFLFTKEPLKPD 380

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
           FK+++   G KR++S+  ++  +K    I +VG +    L +NY  +L+  +  P  ++ 
Sbjct: 381 FKKLNPINGFKRMFSLRTVMELLKDLTIITVVGIVGYKFLQDNYLKILNLGTLRPWYMIT 440

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
                   +   I L +  + V D  +  +Q+   LKM+KQE+K+E KQ  G+P IK++ 
Sbjct: 441 GLLSLAISIFFRITLIMLFIAVADYVYQKYQYNKDLKMTKQEVKEEYKQDEGDPQIKSKI 500

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           K   R     +MM+   +AT+++TNPTH A+ALRY +  + AP +VAKG + +A K++ I
Sbjct: 501 KQKQREMAMQRMMQEVPKATVVVTNPTHIAIALRYEKG-DTAPKVVAKGADYVAIKIKDI 559

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A  + +P+ E   LAR ++++V I+S +P   Y+AVA+++  +Y  K
Sbjct: 560 AKNNEVPVIENKPLARLIYEKVEIDSEVPQDMYEAVAEILAIVYTLK 606


>gi|163856421|ref|YP_001630719.1| flagellar biosynthesis protein FlhB [Bordetella petrii DSM 12804]
 gi|163260149|emb|CAP42450.1| flagellar biosynthesis protein FlhB [Bordetella petrii]
          Length = 379

 Score =  350 bits (899), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 109/353 (30%), Positives = 181/353 (51%), Gaps = 3/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++  +   KTEA S +++E A  EG    SRE   F  + A +  L    S     +T 
Sbjct: 1   MADE-SDLEKTEAASPRRLEKAREEGQIARSRELGTFLLLAAGVGGLWLSGSMLYRGLTG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L     R   D   +V      +  A  LV+P   + M   + + ++    V + 
Sbjct: 60  VLRNGLG-FDARIGRDPGIMVAQAVDGAGQALLLVLPIFGVLMAVAVLASVVLGGFVFSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F ++SL  G+KR+ S   +V  +K+  K +LVG +    +  +   ML  + A 
Sbjct: 119 KPLQPDFAKLSLFSGLKRMVSAQTVVELLKAVAKALLVGGVAVAVIGGHRDEMLALMHAA 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   L  A   V     +I+  +  + +LD+ W       KL+MSK++++ E K+S G+P
Sbjct: 179 PTEALVKALTLVALCAALIVASLGIIVLLDVPWQIWSHLKKLRMSKEDVRQEHKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R +   RS  R +MM    RA +++TNPTHYA+ALRY + +  AP +VAKG  L+A
Sbjct: 239 HIKARIRQQQRSMARRRMMSEVPRADVVVTNPTHYAVALRYAEGQA-APRVVAKGTGLVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A  H +P+ + P LAR+L++ V +   IP   Y AVA+++  ++  +
Sbjct: 298 ARIRELAAGHRVPLLQAPPLARALYQHVELGQEIPAALYTAVAEVLAWVFQLR 350


>gi|170757192|ref|YP_001782263.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           botulinum B1 str. Okra]
 gi|169122404|gb|ACA46240.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum B1
           str. Okra]
          Length = 609

 Score =  350 bits (898), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 104/347 (29%), Positives = 186/347 (53%), Gaps = 2/347 (0%)

Query: 7   PDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLL 66
            + KTE  + +K  DA  +G    S+E +L  ++LAC + L+     G   +   +   L
Sbjct: 262 SEEKTEEATPRKKMDARKKGQVAKSKELALAFTLLACTLVLVALGEYGANELKETMAGFL 321

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
            +    +L + +++  L     L   ++V+P  L  M FGI +  +Q   +     +KP 
Sbjct: 322 NNYLNMEL-NYNNLNSLAILTVLRVGKIVLPVALPIMCFGIAANYLQTGFLFTKEPLKPD 380

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
           FK+++   G KR++S+  ++  +K    I +VG +    L +NY  +L+  +  P  ++ 
Sbjct: 381 FKKLNPINGFKRMFSLRTVMELLKDLTIITVVGIVGYKFLQDNYLKILNLGTLRPWYMIT 440

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
                   +   I L +  + V D  +  +Q+   LKM+KQE+K+E KQ  G+P IK++ 
Sbjct: 441 GLLSLAISIFFRITLIMLFIAVADYVYQKYQYNKDLKMTKQEVKEEYKQDEGDPQIKSKI 500

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           K   R     +MM+   +AT+++TNPTH A+ALRY +  + AP +VAKG + +A K++ I
Sbjct: 501 KQKQREMAMQRMMQEVPKATVVVTNPTHIAVALRYEKG-DTAPKVVAKGADYVAIKIKDI 559

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A  + +P+ E   LAR ++++V I+S +P   Y+AVA+++  +Y  K
Sbjct: 560 AKNNEVPVIENKPLARLIYEKVEIDSEVPQDMYEAVAEILAIVYTLK 606


>gi|88704274|ref|ZP_01101988.1| Flagellar biosynthetic protein flhB [Congregibacter litoralis KT71]
 gi|88701325|gb|EAQ98430.1| Flagellar biosynthetic protein flhB [Congregibacter litoralis KT71]
          Length = 384

 Score =  350 bits (898), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 82/353 (23%), Positives = 174/353 (49%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E      +TE P+ ++ E+A  +G  P SRE +   S+L   + L       +  + +
Sbjct: 1   MAEEQTGQERTEPPTERRKEEARKKGQVPRSRELNTMLSLLITGVGLWVLGGSLVDDLFA 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
                  S  +    D   +     H++ +    + P   + ++  +   L+      ++
Sbjct: 61  ITISGF-SVDRAAAFDAEQLPVRFMHMASATLLALAPLFAVTVVAALAGPLLMGGWSFSV 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +    +++   +G+ R++S+  L    K+ +K +L+  +  + +      +L   +  
Sbjct: 120 QAMAFKLEKLDPVKGLGRVFSLKGLAELAKALIKFLLLMAVAYLMIMAFERDILTLSALT 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P          +   LI++   +  + + D+ +    +  +L+M++QE++DE+K++ G P
Sbjct: 180 PGEASSRVVSMLVIALIVLSSAMVLIVMFDVPFELWNFNKQLRMTRQEVRDEMKETDGRP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +++ R   + +MM+    A ++ITNPTH ++AL Y      AP +VAKG++L+A
Sbjct: 240 EVKQRIRNLQREVSQRRMMQDVPTADVVITNPTHVSIALSY-ADGAGAPRVVAKGRDLLA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R IA EH++P++E P LAR+L+    +   IP   Y AVA+++  ++  +
Sbjct: 299 LQIRTIATEHDVPLYEAPPLARALYASTEVGDEIPGDLYLAVARVLAYLFQLR 351


>gi|315127306|ref|YP_004069309.1| flagellar biosynthesis protein FlhB [Pseudoalteromonas sp. SM9913]
 gi|315015820|gb|ADT69158.1| flagellar biosynthesis protein FlhB [Pseudoalteromonas sp. SM9913]
          Length = 376

 Score =  350 bits (898), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 87/353 (24%), Positives = 167/353 (47%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   KTE P+ KK++DA  +G    S+E      ++   I LL +       +  
Sbjct: 1   MAE-DSGQEKTEEPTPKKVDDAKKKGQIARSKELGTMFVLIFSAISLLMYGPEIGKGLYR 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  +L S  + +  D + +  +   ++      +   +L+ ++       +      + 
Sbjct: 60  IMGRML-SLNRNETYDTTKMFAVWGEVADVLLFPMSMFVLIIVLAAFIGNTMLGGFNFSW 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   ++S  +G  R++     +  +KS +K  LV       +   +  +L     +
Sbjct: 119 QAAAPKASKMSPMKGFTRMFGPQAAIELLKSLLKFGLVAAFAIFLINTFFDEILHLSIES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + HA   +  + + +   +  +  +D  +  +    +LKM+ QE+KDE K S G+P
Sbjct: 179 APGNIVHALEILAWMFLGMSCTLIIIAAIDAPFQSYSHNKQLKMTMQEVKDEYKNSEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R +   R   + +MM+    A +I+TNPTHY++AL+Y      AP+++AKG + +A
Sbjct: 239 QIKARIRQTQRQMSQKRMMQDVPDADVIVTNPTHYSVALKYDTERAGAPIVLAKGVDELA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++RKIA  + +PI E P+L R+L+    +   IP   + AVAQ++  ++  K
Sbjct: 299 MQIRKIALGNEVPIVESPTLTRALYHTAEVGEQIPDQLFTAVAQVLAYVFQLK 351


>gi|323705428|ref|ZP_08117003.1| flagellar biosynthetic protein FlhB [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323535330|gb|EGB25106.1| flagellar biosynthetic protein FlhB [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 357

 Score =  349 bits (897), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 100/348 (28%), Positives = 182/348 (52%), Gaps = 2/348 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE  + K+ +DA  +G    SRE +     +A  + + F     I  + + +  L  
Sbjct: 8   GEKTEPATPKRRQDARKKGQVFQSREVTSALVTIAGFLVIYFTVQNSIAEIMNLIKFLFL 67

Query: 68  SAT--QRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           +       +  I+ I  L   +     +L++P +    +  + S   Q   V  L  +  
Sbjct: 68  NYGGASDNVFTINGIYKLFEMVFSVFIKLILPTIATVFIIALISTYAQVGFVFTLETLNF 127

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
             +R++  +G+KR++S  +L+  +KS +KI ++  ++   L   Y  +   +  +   ++
Sbjct: 128 KLERLNPLDGLKRMFSKRSLLELVKSIIKISILAYVMYSFLIGQYKGIPQLLDMSVQDLI 187

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
            +       +L+ I L +  L  +D  + + ++ S L+MSK++IK+E K++ GNP IK+ 
Sbjct: 188 KYNMNIFAGILLRISLVLVVLGAIDYVYQWREYESNLRMSKEDIKEEFKETEGNPQIKSE 247

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
            +   R     +MM+   +A ++ITNPTH A+AL Y    NDAPV+VAKGQ+ IA+K+++
Sbjct: 248 IRKKQRQISMRRMMQNIKKADVVITNPTHIAVALMYDNEINDAPVVVAKGQDYIAQKIKE 307

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            A +++I I E   LA+SL+K   I  +IPP  YKAVA+++  +Y  +
Sbjct: 308 EAIKYSIAIVENKPLAQSLYKTTEIGDSIPPELYKAVAEVLAYVYSLR 355


>gi|82702438|ref|YP_412004.1| flagellar biosynthesis protein FlhB [Nitrosospira multiformis ATCC
           25196]
 gi|82410503|gb|ABB74612.1| flagellar biosynthetic protein FlhB [Nitrosospira multiformis ATCC
           25196]
          Length = 392

 Score =  349 bits (897), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 99/353 (28%), Positives = 179/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE  +   +TE  S +++E +  EG AP S E S F+ ++A    L          +  
Sbjct: 1   MSEE-SDQERTEPASPRRLEKSREEGQAPRSTELSTFALLIAAGTGLWLMGGHLSSQLAR 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   +    +    + + +   L   S  A     P L+L ++  + + ++    + + 
Sbjct: 60  LMKEGM-HIPRETGFEPARLAERLFDQSFHALITFAPFLILMILVALVAPMLLSGWLFSW 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P FKR++   G+ R++S+++L+   K+ +K  L+G     ++     ++L  I+  
Sbjct: 119 KSLNPDFKRINPLSGLSRMFSLHSLLELAKALLKAALIGGAGVWTIWHYKESVLSLIARP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               L H    V      I   +  +  +D+ +     Y KL+M+K+E++ E K++ GNP
Sbjct: 179 LVPGLTHMGELVALSFFSIAGTMILIATVDVPFKLWDHYRKLRMTKEEVRQENKETEGNP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R ++  R   R +MM    RA +IITNPTHY++ALRY   +  AP +VAKG +L+A
Sbjct: 239 QIKGRIRAQQREMARKRMMTEIPRADVIITNPTHYSVALRYEDGKMRAPRVVAKGMHLLA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+I ++H +P+ E P LAR+L++   +   IP   Y  VA+++  +Y  +
Sbjct: 299 LKIREIGHQHKVPVLEAPPLARALYQHTELGDEIPQTLYNVVAEVLAYVYQLR 351


>gi|266618907|ref|ZP_06111845.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum Bf]
 gi|263528671|gb|EEZ28380.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum Bf]
          Length = 413

 Score =  349 bits (897), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 104/347 (29%), Positives = 186/347 (53%), Gaps = 2/347 (0%)

Query: 7   PDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLL 66
            + KTE  + +K  DA  +G    S+E +L  ++LAC + L+     G   +   +   L
Sbjct: 66  SEEKTEEATPRKKMDARKKGQVAKSKELALAFTLLACTLVLVALGEYGANELKETMAGFL 125

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
            +    +L + +++  L     L   ++V+P  L  M FGI +  +Q   +     +KP 
Sbjct: 126 NNYLNMEL-NYNNLNSLAILTVLRVGKIVLPVALPIMCFGIAANYLQTGFLFTKEPLKPD 184

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
           FK+++   G KR++S+  ++  +K    I +VG +    L +NY  +L+  +  P  ++ 
Sbjct: 185 FKKLNPINGFKRMFSLRTVMELLKDLTIITVVGIVGYKFLQDNYLKILNLGTLRPWYMIT 244

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
                   +   I L +  + V D  +  +Q+   LKM+KQE+K+E KQ  G+P IK++ 
Sbjct: 245 GLLSLAISIFFRITLIMLFIAVADYVYQKYQYNKDLKMTKQEVKEEYKQDEGDPQIKSKI 304

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           K   R     +MM+   +AT+++TNPTH A+ALRY +  + AP +VAKG + +A K++ I
Sbjct: 305 KQKQREMAMQRMMQEVPKATVVVTNPTHIAVALRYEKG-DTAPKVVAKGADYVAIKIKDI 363

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A  + +P+ E   LAR ++++V I+S +P   Y+AVA+++  +Y  K
Sbjct: 364 AKNNEVPVIENKPLARLIYEKVEIDSEVPQDMYEAVAEILAIVYTLK 410


>gi|299534768|ref|ZP_07048098.1| flagellar biosynthesis protein FlhB [Lysinibacillus fusiformis ZC1]
 gi|298729856|gb|EFI70401.1| flagellar biosynthesis protein FlhB [Lysinibacillus fusiformis ZC1]
          Length = 362

 Score =  349 bits (897), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 106/346 (30%), Positives = 183/346 (52%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE  + KK +DA  +G    S++ S    +L   I+L FF       + +       
Sbjct: 14  GEKTEKATPKKRQDARKKGQVVKSQDISSAIVMLMVFIFLFFFAGSLRDELLAFFRQTFI 73

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
              + +   I  ++ L T   +  + +++P + +  +  +    +Q   +  L  +K   
Sbjct: 74  HNIRIESLTIDSVMHLFTETLIQMAFIIVPIMAIAFVGALAGNFMQFGFLFTLEPMKFDL 133

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
           K++   +G+K+I+S+  +V  +KS +KI  +G++ TI +  N   +L     +P   L  
Sbjct: 134 KKMDPIKGLKKIFSVKAIVELIKSVLKIGFIGSVTTIIIWSNLPEVLALSFKSPWMTLIT 193

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
               V  + I   L +  ++VLD  +  H++   LKMSKQ+IKDE K S G+P+IK++ K
Sbjct: 194 VGKLVGIMGIAASLVLLCVSVLDWMYQKHEYEKNLKMSKQDIKDEYKNSEGDPLIKSKIK 253

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              R     +MM     A ++ITNPTHYA+AL+Y +   DAP ++AKG + IA+K++ IA
Sbjct: 254 QRQREMAMRRMMSEVPSADVVITNPTHYAIALKYNEDSMDAPRVIAKGTDFIAQKIKLIA 313

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            EH++ + E   LAR+++ QV I   +P  F+KAVA+++  +Y  K
Sbjct: 314 KEHDVIMVENRPLARAMYDQVEIGDQVPEEFFKAVAEILAYVYRIK 359


>gi|148380604|ref|YP_001255145.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum A
           str. ATCC 3502]
 gi|153931538|ref|YP_001384891.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           botulinum A str. ATCC 19397]
 gi|153937825|ref|YP_001388360.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           botulinum A str. Hall]
 gi|148290088|emb|CAL84207.1| flagellar biosynthetic protein [Clostridium botulinum A str. ATCC
           3502]
 gi|152927582|gb|ABS33082.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum A
           str. ATCC 19397]
 gi|152933739|gb|ABS39238.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum A
           str. Hall]
          Length = 609

 Score =  349 bits (897), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 104/347 (29%), Positives = 186/347 (53%), Gaps = 2/347 (0%)

Query: 7   PDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLL 66
            + KTE  + +K  DA  +G    S+E +L  ++LAC + L+     G   +   +   L
Sbjct: 262 SEEKTEEATPRKKMDARKKGQVAKSKELALAFTLLACTLVLVALGEYGANELKETMAGFL 321

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
            +    +L + +++  L     L   ++V+P  L  M FGI +  +Q   +     +KP 
Sbjct: 322 NNYLNMEL-NYNNLNSLAILTVLRVGKIVLPVALPIMCFGIAANYLQTGFLFTKEPLKPD 380

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
           FK+++   G KR++S+  ++  +K    I +VG +    L +NY  +L+  +  P  ++ 
Sbjct: 381 FKKLNPINGFKRMFSLRTVMELLKDLTIITVVGIVGYKFLQDNYLKILNLGTLRPWYMIT 440

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
                   +   I L +  + V D  +  +Q+   LKM+KQE+K+E KQ  G+P IK++ 
Sbjct: 441 GLLSLAISIFFRITLIMLFIAVADYVYQKYQYNKDLKMTKQEVKEEYKQDEGDPQIKSKI 500

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           K   R     +MM+   +AT+++TNPTH A+ALRY +  + AP +VAKG + +A K++ I
Sbjct: 501 KQKQREMAMQRMMQEVPKATVVVTNPTHIAVALRYEKG-DTAPKVVAKGADYVAIKIKDI 559

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A  + +P+ E   LAR ++++V I+S +P   Y+AVA+++  +Y  K
Sbjct: 560 AKNNEVPVIENKPLARLIYEKVEIDSEVPQDMYEAVAEILAIVYTLK 606


>gi|226939714|ref|YP_002794787.1| FlhB1 [Laribacter hongkongensis HLHK9]
 gi|226714640|gb|ACO73778.1| FlhB1 [Laribacter hongkongensis HLHK9]
          Length = 389

 Score =  349 bits (897), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 90/353 (25%), Positives = 172/353 (48%), Gaps = 3/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   +TE  + ++ E A  EG  P SRE + F+  +  +  L+ +       +  
Sbjct: 1   MAE-DSDLERTEEATPRRREQAREEGQVPRSRELATFTVTMTGVAMLVAYGGVLYQQLKE 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
                L + T+  L+        L          ++P L +  +  + +  +     L+ 
Sbjct: 60  LFARTL-TFTRATLDAEDAAQLALRGGLTDGLVSILPILGVLFVLALVTPALIGGWNLSW 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             V+P F +++   GIKRI+S+   +   K+ +K +L+G + T  +      ++     +
Sbjct: 119 KAVEPKFSKINPLSGIKRIFSVQGAIEGAKAILKSLLIGGVATWVIWNERAELVSLTRLS 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               L  A       L+++   +  L ++D+ +   Q+   L+M+K+++K E+K+S G+P
Sbjct: 179 LDQALARAVDLTLHTLLIVAGAMVLLVLIDVPFQLWQYSKNLRMTKEDVKKEMKESEGSP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   R +MM     A+++ITNPTHYA+ALRY      AP ++AKG   +A
Sbjct: 239 EVKGRIRQLQREAARRRMMSDVPNASVVITNPTHYAVALRYEDG-MAAPKVIAKGSMKVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +++ ++A E+ + I   P  AR+L+    I   IP   Y A AQ++  ++  +
Sbjct: 298 ERIIELARENRVTILRAPPFARALYFNSEIGDDIPAALYSAAAQVLAYVFQLR 350


>gi|238025868|ref|YP_002910099.1| flagellar biosynthesis protein FlhB [Burkholderia glumae BGR1]
 gi|124695889|gb|ABN14283.1| FlhB [Burkholderia glumae BGR1]
 gi|237875062|gb|ACR27395.1| FlhB [Burkholderia glumae BGR1]
          Length = 408

 Score =  349 bits (897), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 99/353 (28%), Positives = 175/353 (49%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   KTE  + ++ E A  EG    SRE + F+ + A          P    + +
Sbjct: 1   MAE-DSDLEKTEDATPRRREKAREEGQVARSREFASFALLAAGFYGAWLLSGPIGEHLRT 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L +  +    D   ++       +     + P L L  +  + + +     +L+ 
Sbjct: 60  MLRGSL-TFDRASAFDTHQMLTGAGRAGMEGLSAIAPVLALTGLAALAAPIALGGWLLST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +   F R+    G+ RI+S   ++    +  K ++VG I  I++  ++  ML  ++  
Sbjct: 119 KAIGFKFDRLDPISGLGRIFSPQGVIQLGMALAKTVIVGGIGGIAIWRSHDEMLGLLNLP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            H  L      V     M +  +  +  +D+ +   Q+  KL+M+K+E+K E ++S G+P
Sbjct: 179 LHEALAGTLHLVAVCCGMTVAGMLVVAGMDVPYQIWQYNKKLRMTKEEVKREHRESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A +++TNPTH+A+ALRY   E  AP ++AKG NL+A
Sbjct: 239 HVKGRIRQQQRAMARRRMMANVPKADVVVTNPTHFAVALRYTDGEMRAPKVIAKGVNLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EH +PI E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 299 LRIRELAEEHRVPILEAPPLARALYHNVDLEREIPGSLYSAVAEVLAWVYQLK 351


>gi|237796086|ref|YP_002863638.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum Ba4
           str. 657]
 gi|229263066|gb|ACQ54099.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum Ba4
           str. 657]
          Length = 609

 Score =  349 bits (897), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 104/347 (29%), Positives = 186/347 (53%), Gaps = 2/347 (0%)

Query: 7   PDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLL 66
            + KTE  + +K  DA  +G    S+E +L  ++LAC + L+     G   +   +   L
Sbjct: 262 SEEKTEEATPRKKMDARKKGQVAKSKELALAFTLLACTLVLVALGEYGANELKETMAGFL 321

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
            +    +L + +++  L     L   ++V+P  L  M FGI +  +Q   +     +KP 
Sbjct: 322 NNYLNMEL-NYNNLNSLAILTVLRVGKIVLPVALPIMCFGIAANYLQTGFLFTKEPLKPD 380

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
           FK+++   G KR++S+  ++  +K    I +VG +    L +NY  +L+  +  P  ++ 
Sbjct: 381 FKKLNPINGFKRMFSLRTVMELLKDLTIITVVGIVGYKFLQDNYLKILNLGTLRPWYMIT 440

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
                   +   I L +  + V D  +  +Q+   LKM+KQE+K+E KQ  G+P IK++ 
Sbjct: 441 GLLSLAISIFFRITLIMLFIAVADYVYQKYQYNKDLKMTKQEVKEEYKQDEGDPQIKSKI 500

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           K   R     +MM+   +AT+++TNPTH A+ALRY +  + AP +VAKG + +A K++ I
Sbjct: 501 KQKQREMAMQRMMQEVPKATVVVTNPTHIAVALRYEKG-DTAPKVVAKGADYVAIKIKDI 559

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A  + +P+ E   LAR ++++V I+S +P   Y+AVA+++  +Y  K
Sbjct: 560 AKNNEVPVIENKPLARLIYEKVEIDSEVPQDMYEAVAEILAIVYTLK 606


>gi|161723151|ref|YP_443664.2| flagellar biosynthesis protein FlhB [Burkholderia thailandensis
           E264]
          Length = 405

 Score =  349 bits (897), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 101/350 (28%), Positives = 179/350 (51%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+   +TEA + K+ E A  EG    SRE + F+ + A          P    + + LH
Sbjct: 7   EDSDLERTEAATPKRREKAREEGQVARSRELASFALLSAGFYGAWMLSGPIGEHLRTMLH 66

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
               S  +    D + ++     LSL     ++P L L  +  + + +     +++    
Sbjct: 67  TAF-SFDRATAFDTNRMLSHAGILSLEGLYALVPVLALTGVAALAAPMALGGWLVSTKTF 125

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +  F+R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +   H+
Sbjct: 126 ELKFERLNPVAGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELLGLATQPLHA 185

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            L  A   +     M +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P +K
Sbjct: 186 ALADALHLIAVCCGMTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEVKREHRENEGDPHVK 245

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R +   R+  R +MM     A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A ++
Sbjct: 246 GRIRQQQRAMARRRMMANVPTADVVVTNPTHFAVALKYTDGEMRAPKVVAKGVNLVAARI 305

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R++A EH++P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 306 RELAAEHHVPLLEAPPLARALYHNVDLEREIPGTLYSAVAEVLAWVYQLK 355


>gi|322806976|emb|CBZ04546.1| flagellar biosynthesis protein FlhB [Clostridium botulinum H04402
           065]
          Length = 609

 Score =  349 bits (897), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 104/347 (29%), Positives = 186/347 (53%), Gaps = 2/347 (0%)

Query: 7   PDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLL 66
            + KTE  + +K  DA  +G    S+E +L  ++LAC + L+     G   +   +   L
Sbjct: 262 SEEKTEEATPRKKMDARKKGQVAKSKELALAFTLLACTLVLVALGEYGTNELKETMAGFL 321

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
            +    +L + +++  L     L   ++V+P  L  M FGI +  +Q   +     +KP 
Sbjct: 322 NNYLNMEL-NYNNLNSLAILTVLRVGKIVLPVALPIMCFGIAANYLQTGFLFTKEPLKPD 380

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
           FK+++   G KR++S+  ++  +K    I +VG +    L +NY  +L+  +  P  ++ 
Sbjct: 381 FKKLNPINGFKRMFSLRTVMELLKDLTIITVVGIVGYKFLQDNYLKILNLGTLRPWYMIT 440

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
                   +   I L +  + V D  +  +Q+   LKM+KQE+K+E KQ  G+P IK++ 
Sbjct: 441 GLLSLAISIFFRITLIMLFIAVADYVYQKYQYNKDLKMTKQEVKEEYKQDEGDPQIKSKI 500

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           K   R     +MM+   +AT+++TNPTH A+ALRY +  + AP +VAKG + +A K++ I
Sbjct: 501 KQKQREMAMQRMMQEVPKATVVVTNPTHIAVALRYEKG-DTAPKVVAKGADYVAIKIKDI 559

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A  + +P+ E   LAR ++++V I+S +P   Y+AVA+++  +Y  K
Sbjct: 560 AKNNEVPVIENKPLARLIYEKVEIDSEVPQDMYEAVAEILAIVYTLK 606


>gi|253998503|ref|YP_003050566.1| flagellar biosynthetic protein FlhB [Methylovorus sp. SIP3-4]
 gi|253985182|gb|ACT50039.1| flagellar biosynthetic protein FlhB [Methylovorus sp. SIP3-4]
          Length = 384

 Score =  349 bits (896), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 101/353 (28%), Positives = 175/353 (49%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   KTE  + K++E A  EGN P SRE    + +LA  + +    S    ++  
Sbjct: 1   MAE-DSDLEKTEPATPKRLEKAREEGNVPRSREFVTCAMLLAGGMGIAMMSSQFGDALKH 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L    +    D + ++  ++    S      P   L  +  I +  +     ++ 
Sbjct: 60  TMGGSL-HFERALAYDSNLLLMKISDSIYSLLITFAPLAGLLFIMAIAAPTLIGGWNVSN 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P F R++   G+  + S N LV  +K+  K ILVG++  + +  +  T+L      
Sbjct: 119 QAFVPKFNRLNPVSGLGNMVSKNALVELLKAVGKTILVGSVAYVVVAHDVDTILSLALLP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            H+ +      + K    I+  +  +  +D+ +    + + LKM+K+E+K E K+S GNP
Sbjct: 179 LHTSIAEVEDMLLKSFFFIVGALVLIAAIDVPYQLTTYANNLKMTKEEVKQESKESEGNP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R +   R   R +MM    +A ++ITNPTHYA+A++Y +    APV++AKG + +A
Sbjct: 239 QIKARIRQQQREIARRRMMSEIPKADVVITNPTHYAVAIQYKELGMRAPVVIAKGADAVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++A EH I   E P LAR+L+    +   IP   Y AVA++I  ++  +
Sbjct: 299 LKIREVAAEHKIMTLESPKLARALYAHTELGDEIPQALYSAVAEIIAYVFQMR 351


>gi|167582700|ref|ZP_02375574.1| flagellar biosynthesis protein FlhB [Burkholderia thailandensis
           TXDOH]
          Length = 405

 Score =  349 bits (896), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 101/350 (28%), Positives = 179/350 (51%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+   +TEA + K+ E A  EG    SRE + F+ + A          P    + + LH
Sbjct: 7   EDSDLERTEAATPKRREKAREEGQVARSRELASFALLSAGFYGAWMLSGPIGEHLRTMLH 66

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
               S  +    D + ++     LSL     ++P L L  +  + + +     +++    
Sbjct: 67  TAF-SFDRATAFDTNRMLSHAGILSLEGLYALVPVLALTGVAALAAPMALGGWLVSTKTF 125

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +  F+R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +   H+
Sbjct: 126 ELKFERLNPVAGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELLGLATQPLHA 185

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            L  A   +     M +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P +K
Sbjct: 186 ALADALHLIAVCCGMTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEVKREHRENEGDPHVK 245

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R +   R+  R +MM     A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A ++
Sbjct: 246 GRIRQQQRAMARRRMMANVPTADVVVTNPTHFAVALKYTDGEMRAPKVVAKGVNLVAARI 305

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R++A EH++P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 306 RELAAEHHVPLLEAPPLARALYHNVDLEREIPGTLYSAVAEVLAWVYQLK 355


>gi|114570480|ref|YP_757160.1| flagellar biosynthetic protein FlhB [Maricaulis maris MCS10]
 gi|114340942|gb|ABI66222.1| flagellar biosynthetic protein FlhB [Maricaulis maris MCS10]
          Length = 363

 Score =  349 bits (896), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 96/352 (27%), Positives = 183/352 (51%), Gaps = 1/352 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E +    KTE P+ ++++DA  +G+   S+E   +  + A L  L F F     ++  
Sbjct: 1   MAEGEDDSQKTEEPTQRRLDDARKKGDVAKSQEIPGWFVLAAGLALLSFIFPMMSRALAG 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           +L V         + +   ++ L+  ++     +V   + L  + G   + +Q+  +   
Sbjct: 61  NLEVFFEQPHDFAI-NPGAMMGLMQAVAWQVVAIVGLPIGLLAVAGFAGHYVQQGMLFTT 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P   +++  EG KR +    L NF+K   K+ LV     + +      +    + +
Sbjct: 120 EKIQPKLSKLNPIEGFKRNFGPQGLANFLKGVGKMALVAVAAFLVIYPKREILAGLPALD 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             S+L        ++L+  L   A +  LD  +    +  + +MS++EIKDE+KQS G+P
Sbjct: 180 IGSLLSLVRQGAIELLLAALTVYAVIAGLDYIFQRQSFMKRNRMSRREIKDEMKQSEGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           +++ + + + + R + +MM     AT+++TNPTHYA+AL Y+Q E  APV VAKG + +A
Sbjct: 240 LVRAKLRQLRQERSQRRMMTKVPDATVVVTNPTHYAIALHYVQGETPAPVCVAKGVDEVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
            ++R++A EH++PI E+P LAR+L     ++  IP   ++AVA+++  +   
Sbjct: 300 LRIRELAEEHSVPIVEDPPLARALHATADLDEEIPTEHFQAVAKVVGYVLSL 351


>gi|170761528|ref|YP_001787967.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           botulinum A3 str. Loch Maree]
 gi|169408517|gb|ACA56928.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum A3
           str. Loch Maree]
          Length = 609

 Score =  349 bits (896), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 105/347 (30%), Positives = 186/347 (53%), Gaps = 2/347 (0%)

Query: 7   PDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLL 66
            + KTE  + +K  DA  +G    S+E +L  ++LAC + L+     G   +   +   L
Sbjct: 262 SEEKTEEATPRKKMDARKKGQVAKSKELALAFTLLACTLVLVALGEYGANELKETMAGFL 321

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
            +    +L + +++  L     L   ++V+P  L  M FGI +  +Q   +     +KP 
Sbjct: 322 NNYLNMEL-NYNNLNSLAILTVLRVGKIVLPVALPIMCFGIAANYLQTGFLFTKEPLKPD 380

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
           FK+++   G KR++S+  ++  +K    I +VG +    L +NY  +L+  +  P  ++ 
Sbjct: 381 FKKLNPINGFKRMFSLRTVMELLKDLTIITVVGIVGYKFLQDNYLKILNLGTLRPWYMIT 440

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
                   +   I L +  + V D  +  +Q+   LKM+KQE+K+E KQ  G+P IK++ 
Sbjct: 441 GLLSLAISIFFRITLIMLFIAVADYVYQKYQYNKDLKMTKQEVKEEYKQDEGDPQIKSKI 500

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           K   R     +MM+   +AT+++TNPTH A+ALRY +  + AP +VAKG + +A K++ I
Sbjct: 501 KQKQREMAMQRMMQEVPKATVVVTNPTHIAVALRYEKG-DTAPKVVAKGADYVAIKIKDI 559

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A  + IP+ E   LAR ++++V I+S +P   Y+AVA+++  +Y  K
Sbjct: 560 AKNNEIPVIENKPLARLIYEKVEIDSEVPQDMYEAVAEILAIVYTLK 606


>gi|53720905|ref|YP_109891.1| flagellar biosynthesis protein FlhB [Burkholderia pseudomallei
           K96243]
 gi|53724312|ref|YP_104358.1| flagellar biosynthesis protein FlhB [Burkholderia mallei ATCC
           23344]
 gi|167817864|ref|ZP_02449544.1| flagellar biosynthesis protein FlhB [Burkholderia pseudomallei 91]
 gi|167847750|ref|ZP_02473258.1| flagellar biosynthesis protein FlhB [Burkholderia pseudomallei
           B7210]
 gi|52211319|emb|CAH37308.1| flagellar biosynthetic protein FlhB [Burkholderia pseudomallei
           K96243]
 gi|52427735|gb|AAU48328.1| flagellar biosynthetic protein FlhB [Burkholderia mallei ATCC
           23344]
          Length = 405

 Score =  349 bits (896), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 102/350 (29%), Positives = 179/350 (51%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+  ++TEA + K+ E A  EG    SRE + F+ + A          P    + + LH
Sbjct: 7   EDSDLDRTEAATPKRREKAREEGQVARSRELASFALLSAGFYGAWMLSGPIGEHLRTMLH 66

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
               S  +    D + ++     LSL     + P L L  +  + + +     +++    
Sbjct: 67  TAF-SFDRAAAFDTNRMLSHAGTLSLEGLYALAPVLALTGVAALAAPMAMGGWLVSTKTF 125

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +  F+R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +   H+
Sbjct: 126 ELKFERLNPITGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELLGLATQPLHA 185

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            L  A   V     M +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P +K
Sbjct: 186 ALADALHLVAVCCGMTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEVKREHRENEGDPHVK 245

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R +   R+  R +MM     A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A ++
Sbjct: 246 GRIRQQQRAMARRRMMANVPTADVVVTNPTHFAVALKYTDGEMRAPKVVAKGVNLVAARI 305

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R++A EH++P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 306 RELAAEHHVPLLEAPPLARALYHNVELEREIPGTLYSAVAEVLAWVYQLK 355


>gi|333004498|gb|EGK24027.1| flagellar biosynthetic protein FlhB [Shigella flexneri K-272]
 gi|333017872|gb|EGK37178.1| flagellar biosynthetic protein FlhB [Shigella flexneri K-227]
          Length = 397

 Score =  349 bits (896), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 101/350 (28%), Positives = 186/350 (53%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        ++  L 
Sbjct: 2   SDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGGVSLARRLSGMLS 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       ++D + I+  +  L   A   ++P +   ++  + S ++    V +   +
Sbjct: 62  AGL-HFDHSIIKDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSGKSL 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P F +++   GIKRI+S       +K+ +K ILVG++    L  ++  M+  ++ +P +
Sbjct: 121 QPKFSKLNPLPGIKRIFSAQTSAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPIT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K
Sbjct: 181 AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R   + R+  R +MM    +A +I+ NP HY++AL+Y + +  AP +VAKG  L+  ++
Sbjct: 241 GRICQMQRAAARRRMMADVPKADVIVNNPNHYSVALQYDENKMSAPKVVAKGAGLVVLRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R+I  E+N+P  E P LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 301 REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 350


>gi|226950059|ref|YP_002805150.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum A2
           str. Kyoto]
 gi|226843732|gb|ACO86398.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum A2
           str. Kyoto]
          Length = 609

 Score =  349 bits (896), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 104/347 (29%), Positives = 186/347 (53%), Gaps = 2/347 (0%)

Query: 7   PDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLL 66
            + KTE  + +K  DA  +G    S+E +L  ++LAC + L+     G   +   +   L
Sbjct: 262 SEEKTEEATPRKKMDARKKGQVAKSKELALAFTLLACTLVLVALGEYGANELKETMAGFL 321

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
            +    +L + +++  L     L   ++V+P  L  M FGI +  +Q   +     +KP 
Sbjct: 322 NNYLNMEL-NYNNLNSLAILTVLRVGKIVLPVALPIMCFGIAANYLQTGFLFTKEPLKPD 380

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
           FK+++   G KR++S+  ++  +K    I +VG +    L +NY  +L+  +  P  ++ 
Sbjct: 381 FKKLNPINGFKRMFSLRTVMELLKDLTIITVVGIVGYKFLQDNYLKILNLGTLRPWYMIT 440

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
                   +   I L +  + V D  +  +Q+   LKM+KQE+K+E KQ  G+P IK++ 
Sbjct: 441 GLLSLAISIFFRITLIMLFIAVADYVYQKYQYNKDLKMTKQEVKEEYKQDEGDPQIKSKI 500

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           K   R     +MM+   +AT+++TNPTH A+ALRY +  + AP +VAKG + +A K++ I
Sbjct: 501 KQKQREMAMQRMMQEVPKATVVVTNPTHIAVALRYEKG-DTAPKVVAKGADYVAIKIKDI 559

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A  + +P+ E   LAR ++++V I+S +P   Y+AVA+++  +Y  K
Sbjct: 560 AKNNEVPVIENKPLARLIYEKVEIDSEVPQDMYEAVAEILAIVYTLK 606


>gi|320325130|gb|EFW81199.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320329389|gb|EFW85382.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 378

 Score =  349 bits (896), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 102/353 (28%), Positives = 188/353 (53%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+   +KTE P+ KK++D+  +G    S+E +    +L     LL F S GI  + S
Sbjct: 1   MAENENGQDKTEDPTEKKVKDSRADGQIARSKELTTLVVMLMGAGGLLMFGS-GIAQMMS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           +L     + ++  L D S++   L    L A  +++P L+  ++  +   ++    +   
Sbjct: 60  ELMRDNFTISRETLMDQSYMGKALLSSGLHALVVMLPFLIAMLVAALVGPIMLGGWLFAT 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++   G+KR++S + LV  +KSF K +++  +  + L+     ++  +   
Sbjct: 120 KSLMPKFSRMNPAAGLKRMFSPHALVELLKSFGKFLIILAVALVVLSNERNDLVAIVHEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V      +   +  +   D+ +  ++ + KL M+KQE++DE K S G+P
Sbjct: 180 LEQAMIHSLLVVGWSSFWMACGLIFIAAADVPFVLYEAHKKLLMTKQEVRDEHKNSEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM +   A +IITNPTH+A+AL+Y   +  AP+L+AKG +L+A
Sbjct: 240 EVKQRIRQLQREMSQRRMMASIPEADVIITNPTHFAVALKYDPEQGGAPMLLAKGTDLVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+I   + I I E  +LARS++    ++  IP   Y AVAQ++  +Y  +
Sbjct: 300 LKIREIGAHNQILILESAALARSIYYSTELDQEIPAGLYLAVAQVLAYVYQIR 352


>gi|167721674|ref|ZP_02404910.1| flagellar biosynthesis protein FlhB [Burkholderia pseudomallei
           DM98]
          Length = 405

 Score =  349 bits (896), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 102/350 (29%), Positives = 179/350 (51%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+  ++TEA + K+ E A  EG    SRE + F+ + A          P    + + LH
Sbjct: 7   EDSDLDRTEAATPKRREKAREEGQVARSRELASFALLSAGFYGAWMLSGPIGEHLRTMLH 66

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
               S  +    D + ++     LSL     + P L L  +  + + +     +++    
Sbjct: 67  AAF-SFDRAAAFDTNRMLSHAGTLSLEGLYALAPVLALTGVAALAAPMAMGGWLVSTKTF 125

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +  F+R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +   H+
Sbjct: 126 ELKFERLNPITGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELLGLATQPLHA 185

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            L  A   V     M +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P +K
Sbjct: 186 ALADALHLVAVCCGMTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEVKREHRENEGDPHVK 245

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R +   R+  R +MM     A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A ++
Sbjct: 246 GRIRQQQRAMARRRMMANVPTADVVVTNPTHFAVALKYTDGEMRAPKVVAKGVNLVAARI 305

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R++A EH++P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 306 RELAAEHHVPLLEAPPLARALYHNVELEREIPGTLYSAVAEVLAWVYQLK 355


>gi|30250406|ref|NP_842476.1| flagellar biosynthesis protein FlhB [Nitrosomonas europaea ATCC
           19718]
 gi|30181201|emb|CAD86399.1| FlhB HrpN YscU SpaS Family [Nitrosomonas europaea ATCC 19718]
          Length = 376

 Score =  349 bits (896), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 96/353 (27%), Positives = 186/353 (52%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++ D    +TE  S +++E A  EG    S+E + F+ ++A    L    S  I  +++
Sbjct: 1   MAD-DNDLERTEPASPRRLEKAREEGQVARSQELTTFTLLIAASSSLWVIGSIIIQKLSA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L    Q    + + ++  L  L+L     + P L   ++  + + ++    + + 
Sbjct: 60  VLESGLR-MEQEVAFNPALLLPRLFQLALDGLLAIAPLLGWLVIIALVAPMLLSGWLFSS 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P  KR++   G+KRI+S   L+  +K+  K++++G +    +  +   +LD +   
Sbjct: 119 KALFPDLKRLNPVNGLKRIFSSRGLIELVKAIAKVMVIGGVAAGIIWSHKQDVLDLVGMP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             + L      +    ++I+  +  + V+D+ +       +L+MS+++++ E K+  G+P
Sbjct: 179 LDTSLISMSRLIGLTFMLIVGAMLLIVVIDVPFQIWNHARQLRMSREDLRKEAKEDEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +++ R   R +MM    +A +++TNPTHYA+AL+Y      AP +VAKG  LIA
Sbjct: 239 QVKGRIRNMQRQIARRRMMAEVPKADVVVTNPTHYAVALKYQDRSMRAPKVVAKGTQLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EH+IP+ E P LAR+L+  V +++ IP   Y AVA ++  I+  K
Sbjct: 299 ARIRELADEHHIPVLEVPPLARALYHHVELDTEIPETLYTAVAHVLAYIFQLK 351


>gi|258621117|ref|ZP_05716151.1| Flagellar biosynthetic protein flhB [Vibrio mimicus VM573]
 gi|262170893|ref|ZP_06038571.1| flagellar biosynthesis protein FlhB [Vibrio mimicus MB-451]
 gi|258586505|gb|EEW11220.1| Flagellar biosynthetic protein flhB [Vibrio mimicus VM573]
 gi|261891969|gb|EEY37955.1| flagellar biosynthesis protein FlhB [Vibrio mimicus MB-451]
          Length = 376

 Score =  349 bits (896), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 89/353 (25%), Positives = 179/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+D    +TE  + ++++ A  +G    S+E +  S ++   + L++F       + +
Sbjct: 1   MAESD-GQERTEEATPRRLQQAKEKGQVARSKELASVSVLVVGAVSLMWFGEALAQGLFT 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L  S  + ++ DI  +  ++    ++    ++  L+   +  +           + 
Sbjct: 60  AMQRLF-SLDREEIFDIGKLFDIIGGSLVNLLLPLLMILITLFIAALIGAAGVGGINFSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   +++   G KR++ + + V  +KS +K++LV  +    +  +   +       
Sbjct: 119 EAAMPKLSKMNPLSGFKRMFGLQSWVELLKSILKVMLVAGVAFYLIEASQKDLFQLSLDV 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               ++HA   +   +++I   +  +  +DI +   Q  ++LKM+KQE+KDE K + G P
Sbjct: 179 YPQNIFHALDILLNFVLLISCSLLVVVAIDIPFQIWQHANQLKMTKQEVKDEYKDTEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM A  +A +IITNP H+++ALRY Q  + APV++AKG + +A
Sbjct: 239 EVKGRIRMLQREAAQRRMMAALPQADVIITNPEHFSVALRYKQNTDKAPVVIAKGVDHMA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA E++I I   P LAR+L+    +   IP   + AVAQ++  ++  K
Sbjct: 299 LKIREIAREYDIAIVPAPPLARALYHTTELEQQIPDGLFVAVAQVLAFVFQLK 351


>gi|134094535|ref|YP_001099610.1| part of export apparatus for flagellar proteins [Herminiimonas
           arsenicoxydans]
 gi|133738438|emb|CAL61483.1| Flagellar biosynthetic protein FlhB [Herminiimonas arsenicoxydans]
          Length = 390

 Score =  349 bits (896), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 96/353 (27%), Positives = 170/353 (48%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  +   KTE  S +K+E A  +G+ P SRE +  + +L       F     I  + S
Sbjct: 1   MAEE-SDLEKTEPASPRKLEQAREQGDVPRSRELATCTLLLGASAAFWFTGGNMIAELNS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L S  +    D+  ++       +       P  L+ ++  + S ++    + + 
Sbjct: 60  MLASGL-SFDREMAFDMELLLAHAAASIIKLLIAFAPAALILIVVALASPMLIGGWLFSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P+F R++  +G+  + S  + V   K+  K IL+G I    +      +L      
Sbjct: 119 QALQPNFGRMNPIKGLGNMVSTRSAVELGKAIAKTILIGCIAWTVMKYEIDGVLALSVTP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             S +      +      I+  +  +  +D  +   Q   KL MS+Q+++ E K+S GNP
Sbjct: 179 LQSGIEQVGHILLISFTFIVSGLIIIAGIDAPYQMWQHAKKLMMSRQDVRQESKESDGNP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK + +   R   R +MM     A +++TNPTHYA+AL+Y +    AP +VAKG + +A
Sbjct: 239 EIKAKIRQQQREMARRRMMTEVPTADVVVTNPTHYAVALKYSENGMRAPTVVAKGADEVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA E+N+ + E P LAR+LF+   +   IP   Y AVA+++  ++  +
Sbjct: 299 AKIREIALENNVVMLEAPPLARALFRHAELGDEIPEALYIAVAEVLAYVFQLR 351


>gi|28869179|ref|NP_791798.1| flagellar biosynthetic protein FlhB [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213967544|ref|ZP_03395692.1| flagellar biosynthetic protein FlhB [Pseudomonas syringae pv.
           tomato T1]
 gi|301382881|ref|ZP_07231299.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           tomato Max13]
 gi|302061091|ref|ZP_07252632.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           tomato K40]
 gi|302131293|ref|ZP_07257283.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|28852419|gb|AAO55493.1| flagellar biosynthetic protein FlhB [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213927845|gb|EEB61392.1| flagellar biosynthetic protein FlhB [Pseudomonas syringae pv.
           tomato T1]
 gi|331016989|gb|EGH97045.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 378

 Score =  349 bits (896), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 102/353 (28%), Positives = 188/353 (53%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+   +KTE P+ KK++D+  EG    S+E +    +L     LL F + GI  + S
Sbjct: 1   MAENENGQDKTEDPTEKKVKDSRAEGQIARSKELTTLVVMLMGAGGLLMFGA-GIAQMMS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           DL     + ++  + D S++   L    L A  +++P L+  +   +   ++    + + 
Sbjct: 60  DLMRDNFTISRETIMDQSYMGKALLSSGLHALVVMLPFLIAMLAAALVGPILLGGWLFST 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++   G+KR++S + LV  +KSF K +++  +  + L++    ++      
Sbjct: 120 KSLMPKFSRMNPAAGLKRMFSPHALVELLKSFGKFLIILAVALVVLSKERNDLVAIAHEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V      +   +  +   D+ +  ++ + KL M+KQE++DE K S G+P
Sbjct: 180 LEQAMIHSLLVVGWSSFWMACGLMFIAAADVPFVLYEAHKKLLMTKQEVRDEHKNSEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM +   A +IITNPTH+A+AL+Y   +  AP+L+AKG +L+A
Sbjct: 240 EVKQRIRQLQREMSQRRMMASIPEADVIITNPTHFAVALKYDPEQGGAPMLLAKGTDLVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+I   + I I E  +LARS++    ++  IP   Y AVAQ++  +Y  +
Sbjct: 300 LKIREIGAHNQILILESAALARSIYYSTELDQEIPAGLYLAVAQVLAYVYQIR 352


>gi|114566403|ref|YP_753557.1| flagellar biosynthesis/type III secretory pathway protein
           [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
 gi|114337338|gb|ABI68186.1| flagellar biosynthesis/type III secretory pathway protein
           [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
          Length = 369

 Score =  349 bits (896), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 100/350 (28%), Positives = 184/350 (52%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D    KTE  + ++ E+A  +G    S + +    ++A  +     F   + ++ S   
Sbjct: 17  DDGMGEKTEKATPRRREEARKKGQVFKSTDLNSAIILIAGSVASFMAFPYMVNNLKSFTT 76

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
           + L   TQ+   +  +I F+L  + +   +++ P  L   +  +    +Q   V +   +
Sbjct: 77  LYLLQRTQQDFSN-DYIYFMLLEVLIIMGKMIFPIFLTTFIVALLITYLQVGFVFSGESL 135

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
            P  +R++  EG KRI+S   LV   KS +K+I+ G I+   + ++Y     FI     +
Sbjct: 136 TPKLERLNPVEGFKRIFSKRALVELGKSLLKVIVTGYIVYSVMRKHYILFPRFIDMELIA 195

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            L      V ++ + + L    + + D  + +++    LKMSK EIK E KQ+ G+P +K
Sbjct: 196 GLQVLSSIVFEMAMKVGLVFIIIGIADYIFQWYEHEKSLKMSKYEIKQEYKQTEGDPQLK 255

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
           +RQ+ I R     +MM    +A ++ITNPTH+A+ L+Y  ++ +APV+VA+G++ +A K+
Sbjct: 256 SRQRRIQRDIAMQRMMAEVPKADVVITNPTHFAVVLKYEASKMEAPVVVARGKDFMALKI 315

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           ++IA  H + I E P LAR+L+    I   +P   Y+AVA+++  +Y +K
Sbjct: 316 KEIARMHGVVIVENPVLARTLYYNTEIGDLVPEELYQAVAEVLAFVYKQK 365


>gi|186477710|ref|YP_001859180.1| flagellar biosynthesis protein FlhB [Burkholderia phymatum STM815]
 gi|184194169|gb|ACC72134.1| flagellar biosynthetic protein FlhB [Burkholderia phymatum STM815]
          Length = 411

 Score =  349 bits (896), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 99/350 (28%), Positives = 183/350 (52%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+   KTE+ + +++E A  EG    SRE + F+ + A  +            V + L 
Sbjct: 12  EDSDLEKTESATPRRLEKAREEGQVARSRELATFALVAAGFLGAWGMSGMIGEHVQTMLR 71

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
               +     + D          ++   + +++P L L  +  + + +     +L+   +
Sbjct: 72  TAF-TFNHETVFDPKRAFISAGAVTREGAYMLMPLLALLGLAALLAPMAMGGWLLSTKSL 130

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
            P+F+R++   G+ RI+SIN  +    S  KI++VG I  +++      +L   +   H 
Sbjct: 131 APNFQRLNPVSGLGRIFSINGWIQLGMSLAKIVVVGLIGGLAIWHRREDILALATQPLHV 190

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            L +A   +     M +  +  L  +D+ +    ++ KL+M+K+E+K E ++S G+P +K
Sbjct: 191 ALSNAGHLIAVCCAMTVGGMFLLAAMDVPYQLWSFHKKLRMTKEEVKREHRESEGDPHVK 250

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R +S  R+  R +MM    +A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A ++
Sbjct: 251 ARIRSQQRAMARRRMMANVPKADVVVTNPTHFAVALQYTDGEMGAPKVVAKGVNLVAARI 310

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R++A E+N+P+ E P LAR+L+  V +N  IP   Y AVA+++  +Y  +
Sbjct: 311 RELAVENNVPLLEAPPLARALYHNVELNREIPGALYGAVAEVLAWVYQLR 360


>gi|302185378|ref|ZP_07262051.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           syringae 642]
          Length = 378

 Score =  349 bits (895), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 100/353 (28%), Positives = 183/353 (51%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+   +KTE P+ KK++DA  +G    S+E +    +L     LL F S     ++ 
Sbjct: 1   MAENENGQDKTEDPTEKKVKDARADGQIARSKELTTLVVMLMGAGGLLMFGSDIALMMSE 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +     + ++  L D S++   L    + A  +V+P L+  ++  +   ++    +   
Sbjct: 61  LMRDNF-TISRETLMDQSYMGKALLSSGMHALIVVLPFLIAMLVAALVGPIMLGGWLFAT 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++   G+KR++S + LV  +KSF K +++  +  + L      ++      
Sbjct: 120 KSLMPKFSRMNPAAGLKRMFSPHALVELLKSFGKFLIILAVALVVLNNERKDLVAIAHEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V      +   +  +   D+ +  ++ + KL M+KQE++DE K S G+P
Sbjct: 180 LEQAMIHSLMVVGWSSFWMACGLIFIAAADVPFVLYEAHKKLLMTKQEVRDEHKNSEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R + + R   + +MM +   A +IITNPTH+A+AL+Y   +  AP+L+AKG +L+A
Sbjct: 240 EIKQRIRQLQREMSQRRMMASVPEADVIITNPTHFAVALKYDPEQGGAPMLLAKGTDLVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+I   + I I E  +LARS++    ++  IP   Y AVAQ++  +Y  +
Sbjct: 300 LKIREIGAHNEILILESAALARSIYYSTELDQEIPAGLYLAVAQVLAYVYQIR 352


>gi|254506872|ref|ZP_05119011.1| flagellar biosynthetic protein FlhB [Vibrio parahaemolyticus 16]
 gi|219550157|gb|EED27143.1| flagellar biosynthetic protein FlhB [Vibrio parahaemolyticus 16]
          Length = 376

 Score =  349 bits (895), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 89/353 (25%), Positives = 176/353 (49%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+D    +TE  + ++++ A  +G    S+E +  S ++   + L++F       + +
Sbjct: 1   MAESD-GQERTEDATPRRLQQAREKGQVARSKELASVSVLVVGAVALMWFGDSLARGLYT 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L  S ++ ++ D   +  +      S    +I  L+   +  +           ++
Sbjct: 60  VMERLF-SLSREEIFDHVKLFDIALGSLTSLILPLILILVTLFVAAVAGAAGVGGISFSV 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   +++   G+KR+  I + V  +KS +K+ LV  +    +      +       
Sbjct: 119 EAAMPKLSKMNPLSGLKRMVGIQSWVELIKSILKVALVSGMAFYLINAAKEDLFQLSMDV 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               ++HA   +   +++I   +  +  +DI +   Q  ++LKM+KQE+KDE K++ G P
Sbjct: 179 FPQNIFHALDILLNFVLLISCSLLIVVAIDIPFQIWQHANQLKMTKQEVKDEYKETEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM    +A +I+TNP H+++ALRY Q  + AP++VAKG + +A
Sbjct: 239 EVKGRIRMLQREAAQRRMMAEVPQADVIVTNPEHFSVALRYKQNTDRAPIVVAKGTDHMA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA EH+I +   P LAR+L+    +   IP   + AVAQ++  ++  K
Sbjct: 299 LKIREIAREHDIYVIPAPPLARALYHSTELEQEIPDGLFTAVAQVLAYVFQLK 351


>gi|307264886|ref|ZP_07546448.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|306920144|gb|EFN50356.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter wiegelii
           Rt8.B1]
          Length = 363

 Score =  349 bits (895), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 107/348 (30%), Positives = 186/348 (53%), Gaps = 2/348 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
           + KTE  + K+ +DA  +G    SRE +    I+A  + +     P +  + + +  LL 
Sbjct: 14  EEKTEPATPKRRQDARKKGQVFQSREITSALVIVAGFLAVNILAMPSLGKMMALIKYLLY 73

Query: 68  SAT--QRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           + +     + ++  I  L T++   A  +++P +LL  +  + S  +Q   V     +  
Sbjct: 74  TYSGANDDVFNVVGIRNLFTYVLQQAISIIMPIILLIFVVSLASTYLQVGFVFTTEPLAF 133

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
            F+R++  EG KRI+S   LV   KS  K+ ++  I+   L   Y  +   +  +   IL
Sbjct: 134 KFERLNPVEGFKRIFSKRALVELAKSIAKVAVLFYIMYSFLASQYKGIPMLLDMSVQDIL 193

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
            +A   +  + I I + +  L  LD  + + ++ + LKMSK++IK+E K++ GNP IK  
Sbjct: 194 KYALNILLGITIRIGIVLIVLGALDYFFQWREYETSLKMSKEDIKEEFKETEGNPQIKAE 253

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
            +   R     +MM+   +A ++ITNPTH A+AL Y    NDAPV++AKGQ++IA ++++
Sbjct: 254 IRRKQRQVSMRRMMQDLKKADVVITNPTHLAVALMYDSNVNDAPVVIAKGQDMIALRIKE 313

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            A + NIPI E   LA++L++   I   IPP  Y+AVA+++  +Y  K
Sbjct: 314 EAKKLNIPIVENKPLAQALYRSTEIGDMIPPELYQAVAEVLAYVYSLK 361


>gi|323496542|ref|ZP_08101596.1| flagellar biosynthesis protein FlhB [Vibrio sinaloensis DSM 21326]
 gi|323318386|gb|EGA71343.1| flagellar biosynthesis protein FlhB [Vibrio sinaloensis DSM 21326]
          Length = 376

 Score =  349 bits (895), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 87/353 (24%), Positives = 178/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+D    +TE  + ++++ A  +G    S+E +  S ++   + L++F      ++ +
Sbjct: 1   MAESD-GQERTEDATPRRLQQAREKGQVARSKELASVSVLVVGAVSLMWFGESLARALFT 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L  + ++ ++ D   +  L      S    +I  L+   +  +           ++
Sbjct: 60  VMERLF-TLSREEIFDQVKLFDLALGSLTSLILPLILILVTLFIAAVAGAAGVGGISFSV 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P + +++   G+KR+  + + V  +KS +K+ LV  +    +      +       
Sbjct: 119 EAAMPKWSKMNPLSGLKRMVGLQSWVELIKSILKVALVSGMAFYLINAAKEDLFQLSMDV 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               ++H+   +   +++I   +  +  +DI +   Q  ++LKM+KQE+KDE K++ G P
Sbjct: 179 FPQNIFHSLDILLNFILLISCTLLIVVAIDIPFQIWQHANQLKMTKQEVKDEYKETEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM    +A +I+TNP H+++ALRY Q  + AP++VAKG + +A
Sbjct: 239 EVKGRIRMLQREAAQRRMMAEVPQADVIVTNPEHFSVALRYKQNSDRAPIVVAKGTDHMA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA EH+I +   P LAR+L+    +   IP   + AVAQ++  ++  K
Sbjct: 299 LKIREIAREHDIYVIPAPPLARALYHSTELEQEIPDGLFTAVAQVLAYVFQLK 351


>gi|317492437|ref|ZP_07950866.1| flagellar biosynthetic protein FlhB [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316919776|gb|EFV41106.1| flagellar biosynthetic protein FlhB [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 383

 Score =  349 bits (895), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 110/353 (31%), Positives = 183/353 (51%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE D+   KTE P+S K+E A  +G  P SRE +    + A +  LL         + +
Sbjct: 1   MSE-DSDLEKTEDPTSHKLEKAREKGQVPRSRELTSMLMLAAGISILLIGGEHLARQLAA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L    Q  + +   ++  L +L   A   ++P LL  M+ G  + ++      N 
Sbjct: 60  MISQGL-QFDQLLISNDKQMLRQLGNLLQQAVAALMPVLLGLMLVGWAAPMLIGGFFFNP 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K    ++SL  G+KR++S   L   +K  +K+ILV  +    L   +  ML  I+ +
Sbjct: 119 GSIKFDLSKMSLLSGLKRLFSSQALAELLKGVLKVILVSWVAGWFLWHYWGQMLALIAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   +  A   +    ++I+L +  +   D+ +      +KLKM+KQEIKDE K+  G+P
Sbjct: 179 PLDAMGDALHLIGMCGLLIVLGLVPMVAFDVFYQIWSNLNKLKMTKQEIKDEFKEQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A +I+TNPTHYA+AL+Y + +  AP ++AKG   IA
Sbjct: 239 HVKGRIRQQQRAAARRRMMSDVPKADVIVTNPTHYAVALQYQENKMSAPKVLAKGAGEIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            +++++  +H IP  E P LAR+L++   I   IP   Y AVA+++  +Y  K
Sbjct: 299 LRIKELGNQHRIPQLEAPPLARALYRHSEIGHHIPATLYAAVAEVLAWVYQLK 351


>gi|313200589|ref|YP_004039247.1| flagellar biosynthetic protein flhb [Methylovorus sp. MP688]
 gi|312439905|gb|ADQ84011.1| flagellar biosynthetic protein FlhB [Methylovorus sp. MP688]
          Length = 384

 Score =  349 bits (895), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 101/353 (28%), Positives = 175/353 (49%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   KTE  + K++E A  EGN P SRE    + +LA  + +    S    ++  
Sbjct: 1   MAE-DSDLEKTEPATPKRLEKAREEGNVPRSREFVTCAMLLAGGMGIAMMSSQFGDALKH 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L    +    D + ++  ++    S      P   L  +  I +  +     ++ 
Sbjct: 60  TMGGSL-HFERALAYDSNLLLMKISDSIYSLLITFAPLAGLLFIMAIAAPTLIGGWNVSN 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P F R++   G+  + S N LV  +K+  K ILVG++  + +  +  T+L      
Sbjct: 119 QAFVPKFNRLNPVSGLGNMVSKNALVELLKAVGKTILVGSVAYVVVAHDVDTILSLALLP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            H+ +      + K    I+  +  +  +D+ +    + + LKM+K+E+K E K+S GNP
Sbjct: 179 LHTSIAEVEDMLLKSFFFIVGALVLIAAIDVPYQLTTYANNLKMTKEEVKQESKESEGNP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R +   R   R +MM    +A ++ITNPTHYA+A++Y +    APV++AKG + +A
Sbjct: 239 QIKARIRQQQREIARRRMMSEIPKADVVITNPTHYAVAIQYKELGMRAPVVIAKGADAVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++A EH I   E P LAR+L+    +   IP   Y AVA++I  ++  +
Sbjct: 299 LKIREVAAEHKIMTLESPKLARALYAHTELGDEIPQALYSAVAEIIAYVFQMR 351


>gi|71736663|ref|YP_275525.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257484900|ref|ZP_05638941.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|289651607|ref|ZP_06482950.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|298487818|ref|ZP_07005858.1| Flagellar biosynthesis protein flhB [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|71557216|gb|AAZ36427.1| flagellar biosynthetic protein FlhB [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|298157543|gb|EFH98623.1| Flagellar biosynthesis protein flhB [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|330889044|gb|EGH21705.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv. mori
           str. 301020]
 gi|330986505|gb|EGH84608.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331011080|gb|EGH91136.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 378

 Score =  349 bits (895), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 102/353 (28%), Positives = 187/353 (52%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+   +KTE P+ KK++D+  +G    S+E +    +L     LL F S GI  + S
Sbjct: 1   MAENENGQDKTEDPTEKKVKDSRADGQIARSKELTTLVVMLMGAGGLLMFGS-GIAQMMS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           +L     + ++  L D S++   L    L A  +++P L+  ++  +   ++    +   
Sbjct: 60  ELMRDNFTISRETLMDQSYMGKALLSSGLHALVVMLPFLIAMLVAALVGPIMLGGWLFAT 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++   G+KR++S + LV  +KSF K +++  +  + L+     ++      
Sbjct: 120 KSLMPKFSRMNPAAGLKRMFSPHALVELLKSFGKFLIILAVALVVLSNERNDLVAIAHEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V      +   +  +   D+ +  ++ + KL M+KQE++DE K S G+P
Sbjct: 180 LEQAMIHSLLVVGWSSFWMACGLIFIAAADVPFVLYEAHKKLLMTKQEVRDEHKNSEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM +   A +IITNPTH+A+AL+Y   +  AP+L+AKG +L+A
Sbjct: 240 EVKQRIRQLQREMSQRRMMASIPEADVIITNPTHFAVALKYDPEQGGAPMLLAKGTDLVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+I   + I I E  +LARS++    ++  IP   Y AVAQ++  +Y  +
Sbjct: 300 LKIREIGAHNQILILESAALARSIYYSTELDQEIPAGLYLAVAQVLAYVYQIR 352


>gi|238755333|ref|ZP_04616676.1| Flagellar biosynthetic protein flhB [Yersinia ruckeri ATCC 29473]
 gi|238706469|gb|EEP98843.1| Flagellar biosynthetic protein flhB [Yersinia ruckeri ATCC 29473]
 gi|253317686|gb|ACT22775.1| flagellar biosynthesis protein FlhB [Yersinia ruckeri]
          Length = 383

 Score =  349 bits (895), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 102/353 (28%), Positives = 179/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   KTE P++ K+E A  +G  P SRE +    + A L  L  F       + +
Sbjct: 1   MAE-DSDLEKTEEPTAHKLEKAREKGQIPRSRELTSMLMLGAGLSILWVFGESIGRQLAA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L       + +   ++  +  L +   + ++P  +  ++  I   ++      + 
Sbjct: 60  MIAQGL-QFNHGVIGNEKQMLRQVGMLLMQTVKALLPVFIGLVLVAISVPMLLGGIAFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
              K   KR++   G+KR++S   L   +K+ +K  LVG +  + L   +  ML  I+A 
Sbjct: 119 ESFKFDLKRMNPISGLKRMFSSQVLAELLKAILKATLVGWVTGMFLWHYWPDMLRLIAAP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + L  A   +     +++L +  +   D+ +       KL+M+KQEI+DE K   G+P
Sbjct: 179 PIAALGDALHLILFCGFIVVLGLTPMVGFDVFYQIMSHIKKLRMTKQEIRDEFKDQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A +I+TNPTHYA+AL+Y + +  AP ++AKG   +A
Sbjct: 239 HVKGRIRQQQRAMARRRMMADVPQADVIVTNPTHYAVALQYNENKMSAPKVLAKGAGEVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++  EH IP+ E P LAR+L++   I   IP   Y AVA+++  +Y  K
Sbjct: 299 LRIRELGAEHRIPMLEAPPLARALYRHSEIGQHIPATLYAAVAEVLAWVYQLK 351


>gi|167740656|ref|ZP_02413430.1| flagellar biosynthesis protein FlhB [Burkholderia pseudomallei 14]
 gi|167826242|ref|ZP_02457713.1| flagellar biosynthesis protein FlhB [Burkholderia pseudomallei 9]
 gi|167896340|ref|ZP_02483742.1| flagellar biosynthesis protein FlhB [Burkholderia pseudomallei
           7894]
 gi|167904714|ref|ZP_02491919.1| flagellar biosynthesis protein FlhB [Burkholderia pseudomallei NCTC
           13177]
 gi|167912992|ref|ZP_02500083.1| flagellar biosynthesis protein FlhB [Burkholderia pseudomallei 112]
 gi|42766716|gb|AAS45441.1| FlhB [Burkholderia pseudomallei]
          Length = 405

 Score =  349 bits (895), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 102/350 (29%), Positives = 179/350 (51%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+  ++TEA + K+ E A  EG    SRE + F+ + A          P    + + LH
Sbjct: 7   EDSDLDRTEAATPKRREKAREEGQVARSRELASFALLSAGFYGAWMLSGPIGEHLRTMLH 66

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
               S  +    D + ++     LSL     + P L L  +  + + +     +++    
Sbjct: 67  AAF-SFDRAAAFDTNRMLSHAGTLSLEGLYALAPVLALTGVAALAAPMAMGGWLVSTKTF 125

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +  F+R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +   H+
Sbjct: 126 ELKFERLNPITGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELLGLATQPLHA 185

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            L  A   V     M +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P +K
Sbjct: 186 ALADALHLVAVCCGMTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEVKREHRENEGDPHVK 245

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R +   R+  R +MM     A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A ++
Sbjct: 246 GRIRQQQRAMARRRMMANVPTADVVVTNPTHFAVALKYTDGEMRAPKVVAKGVNLVAARI 305

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R++A EH++P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 306 RELAAEHHVPLLEAPPLARALYHNVELEREIPGTLYSAVAEVLAWVYQLK 355


>gi|153939695|ref|YP_001391947.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           botulinum F str. Langeland]
 gi|152935591|gb|ABS41089.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum F
           str. Langeland]
 gi|295319965|gb|ADG00343.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum F
           str. 230613]
          Length = 609

 Score =  348 bits (894), Expect = 6e-94,   Method: Composition-based stats.
 Identities = 104/347 (29%), Positives = 186/347 (53%), Gaps = 2/347 (0%)

Query: 7   PDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLL 66
            + KTE  + +K  DA  +G    S+E +L  ++LAC + L+     G   +   +   L
Sbjct: 262 SEEKTEDATPRKKMDARKKGQVAKSKELALAFTLLACTLVLVALGEYGANELKETMAGFL 321

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
            +    +L + +++  L     L   ++V+P  L  M FGI +  +Q   +     +KP 
Sbjct: 322 NNYLNMEL-NYNNLNSLAILTVLRVGKIVLPVALPIMCFGIAANYLQTGFLFTKEPLKPD 380

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
           FK+++   G KR++S+  ++  +K    I +VG +    L +NY  +L+  +  P  ++ 
Sbjct: 381 FKKLNPINGFKRMFSLRTVMELLKDLTIITVVGIVGYKFLQDNYLKILNLGTLRPWYMIT 440

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
                   +   I L +  + V D  +  +Q+   LKM+KQE+K+E KQ  G+P IK++ 
Sbjct: 441 GLLSLAISIFFRITLIMLFIAVADYVYQKYQYNKDLKMTKQEVKEEYKQDEGDPQIKSKI 500

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           K   R     +MM+   +AT+++TNPTH A+ALRY +  + AP +VAKG + +A K++ I
Sbjct: 501 KQKQREMAMQRMMQEVPKATVVVTNPTHIAVALRYEKG-DTAPKVVAKGADYVAIKIKDI 559

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A  + +P+ E   LAR ++++V I+S +P   Y+AVA+++  +Y  K
Sbjct: 560 AKNNEVPVIENKPLARLIYEKVEIDSEVPQDMYEAVAEILAIVYTLK 606


>gi|330876032|gb|EGH10181.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 378

 Score =  348 bits (894), Expect = 6e-94,   Method: Composition-based stats.
 Identities = 102/353 (28%), Positives = 187/353 (52%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+   +KTE P+ KK++D+  EG    S+E +    +L     LL F   GI  + S
Sbjct: 1   MAENENGQDKTEDPTEKKVKDSRAEGQIARSKELTTLVVMLMGAGGLLMF-GTGIAQMMS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           +L     + ++  + D S++   L    L A  +++P L+  +   +   ++    + + 
Sbjct: 60  ELMRDNFTISRETIMDQSYMGKALLSSGLHALVVMLPFLIAMLAAALVGPILLGGWLFST 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++   G+KR++S + LV  +KSF K +++  +  + L++    ++      
Sbjct: 120 KSLMPKFSRMNPAAGLKRMFSPHALVELLKSFGKFLIILAVALVVLSKERNDLVAIAHEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V      +   +  +   D+ +  ++ + KL M+KQE++DE K S G+P
Sbjct: 180 LEQAMIHSLLVVGWSSFWMACGLMFIAAADVPFVLYEAHKKLLMTKQEVRDEHKNSEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R + + R   + +MM +   A +IITNPTH+A+AL+Y   +  AP+L+AKG +L+A
Sbjct: 240 EIKQRIRQLQREMSQRRMMASIPEADVIITNPTHFAVALKYDPEQGGAPMLLAKGTDLVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+I   + I I E  +LARS++    ++  IP   Y AVAQ++  +Y  +
Sbjct: 300 LKIREIGAHNQILILESAALARSIYYSTELDQEIPAGLYLAVAQVLAYVYQIR 352


>gi|269138573|ref|YP_003295273.1| flagellar biosynthetic protein [Edwardsiella tarda EIB202]
 gi|267984233|gb|ACY84062.1| flagellar biosynthetic protein [Edwardsiella tarda EIB202]
 gi|304558582|gb|ADM41246.1| Flagellar biosynthesis protein FlhB [Edwardsiella tarda FL6-60]
          Length = 440

 Score =  348 bits (894), Expect = 6e-94,   Method: Composition-based stats.
 Identities = 104/350 (29%), Positives = 174/350 (49%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            ++   KTE P+  +IE A  +G  P SRE +    +   L  LL        ++   + 
Sbjct: 55  EESDLEKTEDPTPHRIEKAREKGQIPRSRELTSILMLATGLAILLLGGEYLARALAVMIA 114

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       L +   ++  L  L   A   ++P LL  M+ G  + ++    + + + +
Sbjct: 115 QGL-HFDHLLLSNDRQMLIQLGMLLQQAVAALMPVLLGLMLVGWCAPMLIGGFLFSPSSI 173

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           K    R++   G KR++S   L   +K  +K  LVG +    L   +  ML  I+     
Sbjct: 174 KCDLNRLNPLSGFKRMFSSQVLAELLKGILKATLVGWVCGWFLLHYWPRMLRLITEPTLD 233

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            +  A   V    ++++L +  +   D+ +      SKL+M+KQEIKDE K+  G+P +K
Sbjct: 234 AMGDALHLVGMCGLLVVLGLLPMVGFDVFYQVWSNLSKLRMTKQEIKDEFKEQEGDPHVK 293

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R +   R+  R +MM    +A +I+TNPTHYA+AL+Y + +  AP ++AKG   IA+++
Sbjct: 294 GRIRQQQRAAARRRMMSDVPKADVIVTNPTHYAVALQYQENKMSAPKVLAKGAGEIAQRI 353

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           + +  EH IP  E P LAR+L++   I  AIP   Y AVA+++  +Y  K
Sbjct: 354 KALGAEHRIPQLEAPPLARALYRHSEIGQAIPATLYAAVAEVLAWVYQLK 403


>gi|304404263|ref|ZP_07385925.1| flagellar biosynthetic protein FlhB [Paenibacillus curdlanolyticus
           YK9]
 gi|304347241|gb|EFM13073.1| flagellar biosynthetic protein FlhB [Paenibacillus curdlanolyticus
           YK9]
          Length = 369

 Score =  348 bits (894), Expect = 6e-94,   Method: Composition-based stats.
 Identities = 90/347 (25%), Positives = 179/347 (51%), Gaps = 1/347 (0%)

Query: 7   PDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLL 66
              KTE+ + KK ++A  +G    S+E      +L   +            + +    L 
Sbjct: 18  SQEKTESATPKKRQEAREKGQVAKSQELPGAFILLFVFMSFYMIGPYYKSRILAMFGDLF 77

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
                  L  + +++ L T L      ++ P   + ++  +    +Q   +   + +K  
Sbjct: 78  EDWLTLDL-TMGNVMSLFTQLMYEMLMMLAPIFAIALLVALLGNYVQVGILFTGDPLKMK 136

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
           F ++S  +G K I+++  +V F+K+ +K++++G ++ ++L   +  ++   +     +L 
Sbjct: 137 FSKLSPIQGFKNIFAMRTVVEFIKNILKLVVIGLVVFMTLKSQWGRIIQLDTLPVEYVLG 196

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
                  K+ I I + +  L + D  +  +++   L+MSKQ+IKDE K++ GNP+IK R 
Sbjct: 197 FTGGIALKLGIEIGVILVVLALGDYFYKKYEYEKGLRMSKQDIKDEFKKTEGNPLIKGRI 256

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           +   R     +MM+   +A +IITNPTH+A+AL+Y  ++ +APV++AKG + +A ++R+ 
Sbjct: 257 RERQRKMALQRMMQDVPKADVIITNPTHFAVALKYDASKMEAPVVLAKGMDHVALRIRET 316

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A EH +   E   LAR+L+ +  I  +IP   ++AVA+++  +Y  K
Sbjct: 317 AKEHGVITMENKPLARALYDRSEIGDSIPSDLFQAVAEVLAYVYKLK 363


>gi|261252335|ref|ZP_05944908.1| flagellar biosynthesis protein FlhB [Vibrio orientalis CIP 102891]
 gi|260935726|gb|EEX91715.1| flagellar biosynthesis protein FlhB [Vibrio orientalis CIP 102891]
          Length = 376

 Score =  348 bits (894), Expect = 6e-94,   Method: Composition-based stats.
 Identities = 87/353 (24%), Positives = 178/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+D    +TE  + ++++ A  +G    S+E +  S ++   I L++F      ++ +
Sbjct: 1   MAESD-GQERTEDATPRRLQQAREKGQVARSKELASVSVLVVGSIALMWFGESLARALFT 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L  S ++ ++ D   +  ++     S    ++  L+   +  +           ++
Sbjct: 60  VMSRLF-SLSREEIFDHVKLFDIVVGSIGSLILPLLLILVTLFVAAVVGAAGVGGVSFSV 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   +++   G+KR+  + + V  +KS +K+ LV  +    ++     +       
Sbjct: 119 EAAMPKASKMNPLSGLKRMVGMQSWVELIKSILKVALVSGMAFYLISAAREDLFQLSMDV 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               ++HA   +   +++I   +  +  +DI +   Q   +LKM+KQE+KDE K++ G P
Sbjct: 179 YPQNIFHALDILLNFVLLISCTLLIVAAIDIPFQIWQHADQLKMTKQEVKDEYKETEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM    +A +I+TNP H+++ALRY Q  + AP++VAKG + +A
Sbjct: 239 EVKGRIRMLQREAAQRRMMAEVPQADVIVTNPEHFSVALRYKQDTDKAPIVVAKGTDHMA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++A EH+I +   P LAR+L+    +   IP   + AVAQ++  ++  K
Sbjct: 299 LKIREVAREHDIYVIPAPPLARALYHSTELEQEIPDGLFTAVAQILAYVFQLK 351


>gi|118588696|ref|ZP_01546104.1| flagellar biosynthesis protein B [Stappia aggregata IAM 12614]
 gi|118438682|gb|EAV45315.1| flagellar biosynthesis protein B [Stappia aggregata IAM 12614]
          Length = 359

 Score =  348 bits (894), Expect = 7e-94,   Method: Composition-based stats.
 Identities = 112/353 (31%), Positives = 196/353 (55%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++     KTE P+ K++++A ++G+ P S+E S + ++    + +  F      S+  
Sbjct: 1   MADDSDDSEKTEDPTHKRLKEAHDKGDVPKSQEVSTWFTLAGATLMIAIFAPSTAVSLGE 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L  A Q  + D   +  L      S + +V   LL  ++  +   L+Q  P+L  
Sbjct: 61  MMKGYLEHAHQIAV-DGYALKALWRDTGQSVALIVGIPLLALVIMAVAGNLVQHQPLLTA 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +KP   +VS   G KR++S  +LVNF K  +KI +VG I+   +  +       + A+
Sbjct: 120 ETIKPKLSKVSPASGFKRLFSSESLVNFAKGMIKISVVGAIMVAVMWPHRDEAEVMVFAD 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            + IL  A   + ++L  +L  +  +   D  +  ++W++K KMS +E+K+E KQ+ G+P
Sbjct: 180 TNIILEEARILILQLLSAVLAVMTVVAGADFIYQRNKWFNKQKMSLREVKEEYKQTEGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK + + +   R R +MM A  +AT+++TNPTHYA+AL+Y +    AP+ +AKG + IA
Sbjct: 240 QIKGKIRQLRMERSRKRMMSAVPQATVVVTNPTHYAVALKYEEG-MGAPLCLAKGTDAIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA E +IP+ E P LAR+L+  V I+  +P   YKAVA++I  ++  +
Sbjct: 299 LKIREIAKESDIPVVENPPLARALYATVEIDQEVPEEHYKAVAEVIGFVFRMR 351


>gi|66046670|ref|YP_236511.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           syringae B728a]
 gi|63257377|gb|AAY38473.1| Flagellar biosynthetic protein FlhB [Pseudomonas syringae pv.
           syringae B728a]
 gi|330899444|gb|EGH30863.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           japonica str. M301072PT]
          Length = 378

 Score =  348 bits (893), Expect = 8e-94,   Method: Composition-based stats.
 Identities = 98/353 (27%), Positives = 182/353 (51%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+   +KTE P+ KK++D+  +G    S+E +    +L     LL F S     ++ 
Sbjct: 1   MAENENGQDKTEDPTEKKVKDSRADGQIARSKELTTLVVMLMGAGGLLMFGSDIALMMSE 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +     + ++  L D S++   L    + A  +V+P L+  ++  +   ++    +   
Sbjct: 61  LMRDNF-TISRETLMDQSYMGKALLSSGMHALVVVLPFLIAMLVAALVGPIMLGGWLFAT 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++   G+KR++S + LV  +KSF K ++   +  + L      ++      
Sbjct: 120 KSLMPKFSRMNPAAGLKRMFSPHALVELLKSFGKFLITLAVALVVLNNERKDLVAIAHEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V      +   +  +   D+ +  ++ + KL M+KQE++DE K S G+P
Sbjct: 180 LEQAMIHSLVVVGWSSFWMACGLIFIAAADVPFVLYEAHKKLLMTKQEVRDEHKNSEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM +   A +IITNPTH+A+AL+Y   +  AP+L+AKG +L+A
Sbjct: 240 EVKQRIRQLQREMSQRRMMASVPEADVIITNPTHFAVALKYDPEQGGAPMLLAKGTDLVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+I   + I I E  +LARS++    ++  IP   Y AVAQ++  +Y  +
Sbjct: 300 LKIREIGAHNEILILESAALARSIYYSTELDQEIPAGLYLAVAQVLAYVYQIR 352


>gi|289629017|ref|ZP_06461971.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|330866461|gb|EGH01170.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           aesculi str. 0893_23]
          Length = 378

 Score =  348 bits (893), Expect = 8e-94,   Method: Composition-based stats.
 Identities = 102/353 (28%), Positives = 187/353 (52%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+   +KTE P+ KK++D+  +G    S+E +    +L     LL F S GI  + S
Sbjct: 1   MAENENGQDKTEDPTEKKVKDSRADGQIARSKELTTLLVMLMGAGGLLMFGS-GIAQMMS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           +L     + ++  L D S++   L    L A  +++P L+  ++  +   ++    +   
Sbjct: 60  ELMRDNFTISRETLMDQSYMGKALLSSGLHALVVMLPFLIAMLVAALVGPIMLGGWLFAT 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++   G+KR++S + LV  +KSF K +++  +  + L+     ++      
Sbjct: 120 KSLMPKFSRMNPAAGLKRMFSPHALVELLKSFGKFLIILAVALVVLSNERNDLVAIAHEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V      +   +  +   D+ +  ++ + KL M+KQE++DE K S G+P
Sbjct: 180 LEQAMIHSLLVVGWSSFWMACGLIFIAAADVPFVLYEAHKKLLMTKQEVRDEHKNSEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM +   A +IITNPTH+A+AL+Y   +  AP+L+AKG +L+A
Sbjct: 240 EVKQRIRQLQREMSQRRMMASIPEADVIITNPTHFAVALKYDPEQGGAPMLLAKGTDLVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+I   + I I E  +LARS++    ++  IP   Y AVAQ++  +Y  +
Sbjct: 300 LKIREIGAHNQILILESAALARSIYYSTELDQEIPAGLYLAVAQVLAYVYQIR 352


>gi|330940692|gb|EGH43704.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 378

 Score =  348 bits (893), Expect = 8e-94,   Method: Composition-based stats.
 Identities = 98/353 (27%), Positives = 182/353 (51%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+   +KTE P+ KK++D+  +G    S+E +    +L     LL F S     ++ 
Sbjct: 1   MAENENGQDKTEDPTEKKVKDSRADGQIARSKELTTLVVMLMGAGGLLVFGSDIALMMSE 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +     + ++  L D S++   L    + A  +V+P L+  ++  +   ++    +   
Sbjct: 61  LMRDNF-TISRETLMDQSYMGKALLSSGMHALIVVLPFLIAMLVAALVGPIMLGGWLFAT 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++   G+KR++S + LV  +KSF K ++   +  + L      ++      
Sbjct: 120 KSLMPKFSRMNPAAGLKRMFSPHALVELLKSFGKFLITLAVALVVLNNERKDLVAIAHEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V      +   +  +   D+ +  ++ + KL M+KQE++DE K S G+P
Sbjct: 180 LEQAMIHSLVVVGWSSFWMACGLIFIAAADVPFVLYEAHKKLLMTKQEVRDEHKNSEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM +   A +IITNPTH+A+AL+Y   +  AP+L+AKG +L+A
Sbjct: 240 EVKQRIRQLQREMSQRRMMASVPEADVIITNPTHFAVALKYDPEQGGAPMLLAKGTDLVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+I   + I I E  +LARS++    ++  IP   Y AVAQ++  +Y  +
Sbjct: 300 LKIREIGAHNEILILESAALARSIYYSTELDQEIPAGLYLAVAQVLAYVYQIR 352


>gi|94500293|ref|ZP_01306826.1| Flagellar biosynthesis pathway, component FlhB [Oceanobacter sp.
           RED65]
 gi|94427592|gb|EAT12569.1| Flagellar biosynthesis pathway, component FlhB [Oceanobacter sp.
           RED65]
          Length = 375

 Score =  348 bits (893), Expect = 8e-94,   Method: Composition-based stats.
 Identities = 90/352 (25%), Positives = 180/352 (51%), Gaps = 1/352 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+    KTE P+ ++++ A ++G  P S+E S    ++  ++ +    +  ++S   
Sbjct: 1   MAENENSQEKTEEPTPRRLQKAKDDGQIPRSKELSTSLVLIVGVLSIWLL-ADLLFSGAK 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           ++        + ++ D   ++  L   +  A   + P ++L ++    + L     + + 
Sbjct: 60  NIFQYNFVIEREQIFDEKQMLKHLGASAYEAILTMTPTMMLILLAAALAPLALGGWMFSG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   R+S   G+KR++ + +LV  +KS+ K+++V     +        +L      
Sbjct: 120 KALLPKANRISPLSGLKRMFGVKSLVELIKSWAKVLVVIGCTFLLFFIFNDKVLFLHREP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               +  +   V     ++      ++V+D+ +  +++  K++MS QE+KDE K++ G P
Sbjct: 180 GTRAIADSADLVMLCAFILACSTLLVSVIDVPYQIYEYMQKMRMSLQEVKDEHKETEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + +     + +MM+    A ++ITNPTHYA+AL+Y   +  AP++VAKG + +A
Sbjct: 240 EVKQRIRRLQYEMSQRRMMDDVKDADVVITNPTHYAVALKYDSDQMGAPLMVAKGTDEVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
            K+R+IA ++ I + E P LARS++    I   IP   Y AVAQ++  +Y  
Sbjct: 300 LKIREIAKQNKIAVVEAPPLARSIYAFTKIGKEIPEGLYVAVAQVLAYVYQL 351


>gi|302389679|ref|YP_003825500.1| flagellar biosynthetic protein FlhB [Thermosediminibacter oceani
           DSM 16646]
 gi|302200307|gb|ADL07877.1| flagellar biosynthetic protein FlhB [Thermosediminibacter oceani
           DSM 16646]
          Length = 357

 Score =  348 bits (893), Expect = 8e-94,   Method: Composition-based stats.
 Identities = 105/347 (30%), Positives = 180/347 (51%)

Query: 7   PDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLL 66
              KTE  + ++ + A   G    SRE +    +LA  + L  F      +  S L    
Sbjct: 7   SQEKTEKATPRRRQKARERGQVFSSRELNSALILLASFVLLKIFGIYIFENTGSFLRQFF 66

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
                R+   IS I  +     +   +   P  +  ++ G+    +Q   V +L  + P 
Sbjct: 67  IENLIRQDLSISDIYGIFYSSIVFVLKSTAPVAVGIVLVGLLVNFLQVGFVFSLEPISPK 126

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
             R++  EG KRI+S  +L+  +K+ VKIIL+  I      E   T+   +  +    L 
Sbjct: 127 LDRINPVEGAKRIFSKRSLIELVKALVKIILIIYIFYGGFVEIKDTVALMLDMSFTESLG 186

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
           +    + ++ + + + +  L+VLD G+ ++++   L MSK+++K+E+K+  GNP IK+R 
Sbjct: 187 YFTSMMFRLGLKVGIALLVLSVLDYGYQWYEYEKSLMMSKEDVKEELKEVEGNPQIKSRI 246

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           + + R   R +MM+   +A ++ITNPTH A+AL Y  + + APV++AKG   IA+K+++I
Sbjct: 247 RQVQRQMSRRRMMQEVKKADVVITNPTHIAIALGYDASVHAAPVVLAKGTGAIAEKIKEI 306

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A   +IPI E   LA++LFK V +   IP  FY AVA+++  +Y  K
Sbjct: 307 AEREDIPIVENKPLAQTLFKSVEVGDIIPEEFYNAVAEILAFVYSLK 353


>gi|157371217|ref|YP_001479206.1| flagellar biosynthesis protein FlhB [Serratia proteamaculans 568]
 gi|157322981|gb|ABV42078.1| flagellar biosynthetic protein FlhB [Serratia proteamaculans 568]
          Length = 398

 Score =  348 bits (893), Expect = 8e-94,   Method: Composition-based stats.
 Identities = 101/350 (28%), Positives = 179/350 (51%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+   K+EAP+  ++E A  +G  P SRE +    ++A L  +    S     +   L 
Sbjct: 18  EDSDLEKSEAPTPHRVEKAREDGQIPRSRELTSVLMLVAGLSIIWVAGSNMSQQLAMMLT 77

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L +     + +   ++  L  L   A   ++P +    +  I + ++    +L+   +
Sbjct: 78  QGL-NFDHSMVSNDKQMLRQLGMLLRQAVWALLPVMAGLTLVAITAPMLLGGLLLSGKSL 136

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           K   KR++   G+KRI+S   L   +K  +K  LVG +  + L  N+  ML  ++  P  
Sbjct: 137 KFDLKRMNPLTGLKRIFSSQVLAELLKGILKATLVGWVTGLYLWHNWAAMLHLVTQQPLD 196

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            L +A   +    ++++L +  +   D+ +     + KLKM+KQ+I+DE K   G+P +K
Sbjct: 197 ALANALQMIIFCGLLVVLALTPMVAFDVFYQLWSHFKKLKMTKQDIRDEFKDQEGDPHVK 256

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R +   R+  R +MM    +A +I+TNPTHYA+AL+Y   +  AP ++AKG   IA ++
Sbjct: 257 GRIRQQQRAIARRRMMADVPKADVIVTNPTHYAVALQYNDKKMSAPKVLAKGAGEIALRI 316

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R++  +H IP+ E P LAR+L++   I   IP   Y AVA+++  +Y  +
Sbjct: 317 RELGMQHRIPMLEAPPLARALYRHSEIGQHIPATLYAAVAEVLAWVYQLR 366


>gi|326389464|ref|ZP_08211031.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter ethanolicus
           JW 200]
 gi|325994469|gb|EGD52894.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter ethanolicus
           JW 200]
          Length = 363

 Score =  348 bits (893), Expect = 8e-94,   Method: Composition-based stats.
 Identities = 107/348 (30%), Positives = 186/348 (53%), Gaps = 2/348 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
           + KTE  + K+ +DA  +G    SRE +    I+A  + +     P +  + + +  LL 
Sbjct: 14  EEKTEPATPKRRQDARKKGQVFQSREITSALVIVAGFLAVNILAMPSLGKMMALIKYLLY 73

Query: 68  SAT--QRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           + +     + ++  I  L T++   A  +++P +LL  +  + S  +Q   V     +  
Sbjct: 74  TYSGANDDVFNVVGIRNLFTYVLQQAISIIMPIILLIFVVSLASTYLQVGFVFTTEPLAF 133

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
            F+R++  EG KRI+S   LV   KS  K+ ++  I+   L   Y  +   +  +   IL
Sbjct: 134 KFERLNPVEGFKRIFSKRALVELAKSIAKVAVLFYIMYSFLASQYKGIPMLLDMSVQDIL 193

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
            +A   +  + I I + +  L  LD  + + ++ + LKMSK++IK+E K++ GNP IK  
Sbjct: 194 KYALNILLGITIRIGIVLIVLGALDYFFQWREYETSLKMSKEDIKEEFKETEGNPQIKAE 253

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
            +   R     +MM+   +A ++ITNPTH A+AL Y    NDAPV++AKGQ++IA ++++
Sbjct: 254 IRRKQRQVSMKRMMQDLKKADVVITNPTHLAVALMYDSNVNDAPVVIAKGQDMIALRIKE 313

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            A + NIPI E   LA++L++   I   IPP  Y+AVA+++  +Y  K
Sbjct: 314 EAKKLNIPIVENKPLAQALYRSTEIGDMIPPELYQAVAEVLAYVYSLK 361


>gi|288942622|ref|YP_003444862.1| flagellar biosynthetic protein FlhB [Allochromatium vinosum DSM
           180]
 gi|288897994|gb|ADC63830.1| flagellar biosynthetic protein FlhB [Allochromatium vinosum DSM
           180]
          Length = 384

 Score =  348 bits (893), Expect = 8e-94,   Method: Composition-based stats.
 Identities = 89/353 (25%), Positives = 175/353 (49%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+    ++EAP++K++ ++  +G    SRE + F  ++    +LLF        ++ 
Sbjct: 1   MAENENGQERSEAPTAKRLRESREKGQVARSRELNTFIILIVGGAFLLFLGGGMAARISQ 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +     +  +  + D   +V  L HL   A  ++ P   L M+  +   ++      + 
Sbjct: 61  LMIDGW-TLERGLIFDEGLLVPHLQHLLGRALLILAPLFGLLMVIALMGPILVGGLNFST 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F +V+   G+KR++S+  L+  +K   K  LVG + T+++   +  +L      
Sbjct: 120 QALMPKFSKVNPISGLKRVFSVQGLMELVKGLGKFGLVGIVATLAIMSIWGNLLTLGELP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               +         + ++    +  +  +D+ +       +L+M+ QEIKDE K++ G P
Sbjct: 180 VEQAIVQTVHMAAWLFLIAAAALLVVAAIDVPFQVWNHQKQLRMTLQEIKDEFKETEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + +     + +MM    +A ++ITNPTHYA+A+ Y+     AP L+AKG + +A
Sbjct: 240 EVKGRIRQLQHEMSQRRMMSEVPKADVVITNPTHYAVAISYVPAIMPAPRLLAKGTDAVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           + +R +A EH I   E P +AR+++    +N  IP   + AVA+++  +Y  +
Sbjct: 300 QAIRALAEEHRIVRVEAPRVARAIYFTTDLNQEIPNGLFVAVARILAYVYQIR 352


>gi|332533113|ref|ZP_08408982.1| flagellar biosynthesis protein FlhB [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332037395|gb|EGI73849.1| flagellar biosynthesis protein FlhB [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 376

 Score =  348 bits (893), Expect = 8e-94,   Method: Composition-based stats.
 Identities = 87/353 (24%), Positives = 168/353 (47%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE D+   KTE P+ KK++++  +G    S+E      ++   I LL +       + +
Sbjct: 1   MSE-DSGQEKTEEPTGKKVDESKKKGQVARSKELGTMFVLIFSAISLLLYGPEIGKGLYN 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  +L S  + +  D + +  +   +S      +   + + +  GI    +      + 
Sbjct: 60  IMGRML-SLNRNEAYDTTKMFAVWASVSDVLIFPMAMFVFIILFAGIIGNTLLGGFNFSW 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   ++S  +G KR++     V   K+ +K  +V       +   +  +L      
Sbjct: 119 QAAAPKASKMSPFKGFKRMFGPQAAVELTKAILKFSVVAGFAVFLINTFFDEILHLSIEP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             + + HA   +  + + +   +  +  +D  +  +  + +LKM+ QE+KDE K S G+P
Sbjct: 179 APNNIIHALEILAWMFLALSCTLVIIAAIDAPYQSYTHHKQLKMTMQEVKDEYKNSEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R +   R   + +MM+    A +I+TNPTHY++AL+Y      AP+++AKG + +A
Sbjct: 239 QIKARIRQTQRQMSQRRMMQDVPDADVIVTNPTHYSVALKYDTERAGAPIVLAKGIDEMA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++RK+A  + +PI E P L R+L+    +   IP   + AVAQ++  ++  K
Sbjct: 299 MQIRKVAIGNEVPILESPMLTRALYHTAEVGEQIPDQLFTAVAQVLAYVFQLK 351


>gi|308187224|ref|YP_003931355.1| Flagellar biosynthetic protein flhB [Pantoea vagans C9-1]
 gi|308057734|gb|ADO09906.1| Flagellar biosynthetic protein flhB [Pantoea vagans C9-1]
          Length = 383

 Score =  348 bits (893), Expect = 9e-94,   Method: Composition-based stats.
 Identities = 107/351 (30%), Positives = 185/351 (52%), Gaps = 2/351 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+ ++KTE+P++ ++E A  EG  P SRE +    +LA ++ L    +   + + +
Sbjct: 1   MAE-DSDEDKTESPTAHRLEKAREEGQIPRSRELTSLLMLLAGIMILWMGGNMMAHRLAA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L       + D   IV  +  L   A   ++P +   ++  I + ++    V + 
Sbjct: 60  MVATGLR-FDHGMVRDDKIIVSHIGSLITQALMALLPLMGGLVLVAIAAPMLLGGLVFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K   K++S   G KR+++        K  +K ILVG +    +  ++  ML  IS  
Sbjct: 119 KSIKFDLKKMSPMAGFKRMFAAQAWTELFKGILKTILVGAVGWWYIWSHWPEMLRLISEA 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + L H    +     +++L +  +   D+ W  +  + KLKMS QEI+DE KQ  G+P
Sbjct: 179 PVTALIHGMEMIAVCCSLVMLGLIPMVGYDVFWQLYSHFKKLKMSMQEIRDEHKQQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A +I+TNPTHY++AL+Y + +  AP +VAKG   IA
Sbjct: 239 HVKGRIRQQMRAAARRRMMADVPKADVIVTNPTHYSVALQYNEKKMSAPKVVAKGAGEIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            ++R++A EH IP+ E P LAR+L++   I   IP   Y AVA+++  ++ 
Sbjct: 299 LRIRELAAEHRIPVLEAPPLARALYRHTEIGQHIPGALYAAVAEVLAWVWQ 349


>gi|162210026|ref|YP_331480.2| flagellar biosynthesis protein FlhB [Burkholderia pseudomallei
           1710b]
          Length = 405

 Score =  348 bits (893), Expect = 9e-94,   Method: Composition-based stats.
 Identities = 103/350 (29%), Positives = 179/350 (51%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            D+  ++TEA + K+ E A  EG    SRE + F+ + A          P    + + LH
Sbjct: 7   EDSDLDRTEAATPKRREKAREEGQVARSRELASFALLSAGFYGAWMLSGPIGEHLRTMLH 66

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
               S  +    D + ++     LSL     + P L L  +  + + +     +++    
Sbjct: 67  TAF-SFDRAAAFDTNRMLSHAGTLSLEGLYALAPVLALTGVAALAAPMAMGGWLVSTKTF 125

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +  F+R++   G+ RI+SI   +    S  K ++VG I  I++  +   +L   +   H+
Sbjct: 126 ELKFERLNPITGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIAIWRSKDELLGLATQPLHA 185

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            L  A   V     M +  +  +  LD+ +   Q+  KL+M+K+EIK E +++ G+P +K
Sbjct: 186 ALADALHLVAVCCGMTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEIKREHRENEGDPHVK 245

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R +   R+  R +MM     A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A ++
Sbjct: 246 GRIRQQQRAMARRRMMANVPTADVVVTNPTHFAVALKYTDGEMRAPKVVAKGVNLVAARI 305

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R++A EH++P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 306 RELAAEHHVPLLEAPPLARALYHNVELEREIPGTLYSAVAEVLAWVYQLK 355


>gi|330972452|gb|EGH72518.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 378

 Score =  348 bits (893), Expect = 9e-94,   Method: Composition-based stats.
 Identities = 97/353 (27%), Positives = 182/353 (51%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+   +KTE P+ KK++D+  +G    S+E +    +L     LL F S     ++ 
Sbjct: 1   MAENENGQDKTEDPTEKKVKDSRADGQIARSKELTTLVVMLMGAGGLLVFGSDIALMMSE 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +     + ++  L D S++   L    + A  +V+P L+  ++  +   ++    +   
Sbjct: 61  LMRDNF-TISRETLMDQSYMGKALLSSGMHALVVVLPFLIAMLVAALVGPIMLGGWLFAT 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++   G+KR++S + LV  +KS  K +++  +  + L      ++      
Sbjct: 120 KSLMPKFSRMNPAAGLKRMFSPHALVELLKSLGKFLIILAVALVVLNNERKDLVAIAHEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V      +   +  +   D+ +  ++ + KL M+KQE++DE K S G+P
Sbjct: 180 LEQAMIHSLLVVGWSSFWMACGLIFVAAADVPFVLYEAHKKLLMTKQEVRDEHKNSEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM +   A +IITNPTH+A+AL+Y   +  AP+L+AKG +L+A
Sbjct: 240 EVKQRIRQLQREMSQRRMMASVPEADVIITNPTHFAVALKYDPEQGGAPMLLAKGTDLVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+I   + I I E  +LARS++    ++  IP   Y AVAQ++  +Y  +
Sbjct: 300 LKIREIGAHNEILILESAALARSIYYSTELDQEIPAGLYLAVAQVLAYVYQIR 352


>gi|253996636|ref|YP_003048700.1| flagellar biosynthetic protein FlhB [Methylotenera mobilis JLW8]
 gi|253983315|gb|ACT48173.1| flagellar biosynthetic protein FlhB [Methylotenera mobilis JLW8]
          Length = 387

 Score =  348 bits (893), Expect = 9e-94,   Method: Composition-based stats.
 Identities = 101/354 (28%), Positives = 178/354 (50%), Gaps = 2/354 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  +   KTE  S K++E A  EG+ P SRE +  + +LA  + +L        ++ +
Sbjct: 1   MAEE-SDLEKTEDASPKRLEQAREEGDVPRSRELATVTVLLAAGLAMLMMGGQLADALKT 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L S  +    D   ++  ++    +      P  L+     I S  +    V + 
Sbjct: 60  SMSSGL-SFQRAYAYDPMLLLMKISDNIYNLLLAFSPLALILFFVAIASPALIGGWVFSE 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F +++   G   ++S N+L   +KS  K ILVG +  + ++ +  ++L      
Sbjct: 119 KALIPKFGKLNPITGFSNMFSKNSLAELIKSIAKAILVGFVSYVVISHDMESILSLSLLP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               +      +    + I+  +  +  +D+ +  +Q+  KLKM+K+E+K E K+S GNP
Sbjct: 179 LDQSIAELNHLLLTSFLAIVSVLVLIAAIDVPFQLYQYADKLKMTKEEVKRESKESDGNP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK+R +   R   R +MM     A ++ITNPTHYA+A++Y +    APV+VAKG + IA
Sbjct: 239 EIKSRIRQQQREMARRRMMAEIPNADVVITNPTHYAVAIKYKEGGMLAPVVVAKGADAIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKKI 354
            K+R+ A EH + I E P LAR+++    +   IP   Y AVA+++  ++  +I
Sbjct: 299 LKIREAAEEHKVLIVEAPKLARAIYTHTELTHEIPEALYTAVAEVLAYVFQMRI 352


>gi|20807870|ref|NP_623041.1| flagellar biosynthesis/type III secretory pathway protein
           [Thermoanaerobacter tengcongensis MB4]
 gi|20516434|gb|AAM24645.1| Flagellar biosynthesis/type III secretory pathway protein
           [Thermoanaerobacter tengcongensis MB4]
          Length = 362

 Score =  348 bits (892), Expect = 9e-94,   Method: Composition-based stats.
 Identities = 98/348 (28%), Positives = 180/348 (51%), Gaps = 2/348 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE  + K+ ++A  +G    SRE +    ++   + +  F    +  V + L  LL 
Sbjct: 13  GEKTEPATPKRRQEARKKGQVFQSREITSALVVVTGFLMINLFLQSFLGRVGNLLKFLLI 72

Query: 68  SAT--QRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           + +     + + + I  +  ++      + +P +L      + S   Q   V     +  
Sbjct: 73  TYSGANDDVFNTAGIWKIFYYVVNQIVLISVPVILAIFAVSLISTYFQVGFVFTAEPLTL 132

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
            F+R++  EG KRI+S   LV  +KS  K++++  I+   L   Y  +   +  +   +L
Sbjct: 133 KFERLNPVEGFKRIFSRRALVELLKSVAKVVVLFYIMYSFLASQYKGIPMLLDMSVQDLL 192

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
            +    +  + I I + +  L V+D  + + ++ + LKMSK++IK+E K++ GNP IK  
Sbjct: 193 RYTSNILFGITIRIGIVLIVLGVIDYFFQWREYENSLKMSKEDIKEEFKETEGNPQIKAE 252

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
            +   R     +MM+   +A ++ITNPTH+A+AL Y    NDAPV+VAKG++L+A K+++
Sbjct: 253 IRKKQRQISTRRMMQDLKKADVVITNPTHFAVALMYDSEVNDAPVVVAKGKDLLALKIKE 312

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            A + +IPI E   LA++L+    +   IPP  Y+AVA+++  +Y  +
Sbjct: 313 EAEKLDIPIVENKPLAQALYNSTEVGQMIPPELYQAVAEVLAYVYSLR 360


>gi|330953765|gb|EGH54025.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae Cit 7]
          Length = 378

 Score =  348 bits (892), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 98/353 (27%), Positives = 182/353 (51%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+   +KTE P+ KK++D+  +G    S+E +    +L     LL F S     ++ 
Sbjct: 1   MAENENGQDKTEDPTEKKVKDSRADGQIARSKELTTLVVMLMGAGGLLMFGSDIALMMSE 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +     + ++  L D S++   L    + A  +V+P L+  ++  +   ++    +   
Sbjct: 61  LMRDNF-TISRETLMDQSYMGKALLSSGMHALIVVLPFLIAMLVAALVGPIMLGGWLFAT 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++   G+KR++S + LV  +KSF K ++   +  + L      ++      
Sbjct: 120 KSLMPKFSRMNPAAGLKRMFSPHALVELLKSFGKFLITLAVALVVLNNERKDLVAIAHEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V      +   +  +   D+ +  ++ + KL M+KQE++DE K S G+P
Sbjct: 180 LEQAMIHSLMVVGWSSFWMACGLIFIAAADVPFVLYEAHKKLLMTKQEVRDEHKNSEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM +   A +IITNPTH+A+AL+Y   +  AP+L+AKG +L+A
Sbjct: 240 EVKQRIRQLQREMSQRRMMASVPEADVIITNPTHFAVALKYDPEQGGAPMLLAKGTDLVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+I   + I I E  +LARS++    ++  IP   Y AVAQ++  +Y  +
Sbjct: 300 LKIREIGAHNEILILESAALARSIYYSTELDQEIPAGLYLAVAQVLAYVYQIR 352


>gi|237799251|ref|ZP_04587712.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331022106|gb|EGI02163.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 378

 Score =  348 bits (892), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 102/353 (28%), Positives = 184/353 (52%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+   +KTE P+ KK++DA  +G    S+E +    +L     LL F S  I ++ S
Sbjct: 1   MAENENGQDKTEDPTEKKVKDARADGQIARSKELTTLVVMLMGAGGLLMFGSD-IAAMMS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           +L     + T+  L D S++   L    L A  +++P L+  ++  +   ++    +   
Sbjct: 60  ELMRDNFTITRETLMDQSYMGKALLSSGLHALVVILPFLIAMLVAALVGPIMLGGWLFTT 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++   G+KR++S + LV  +KS  K +++  +    L      ++      
Sbjct: 120 KSLMPKFSRMNPAAGLKRMFSPHALVELLKSLGKFLIILAVALAVLNSERKDLVAIAHEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V      +   +  +   D+ +  ++ + KL M+KQE++DE K S G+P
Sbjct: 180 LEQAMIHSLMVVGWSSFWMACGLMFIAAADVPFVLYEAHKKLLMTKQEVRDEHKNSEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM +   A +IITNPTH+A+AL+Y   +  AP+L+AKG +L+A
Sbjct: 240 EVKQRIRQLQREMSQRRMMASIPEADVIITNPTHFAVALKYDPEKGGAPMLLAKGTDLVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+I   + I I E  +LARS++    ++  IP   Y AVAQ++  +Y  +
Sbjct: 300 LKIREIGAHNQILILESAALARSIYYSTDLDQEIPAGLYLAVAQVLAYVYQIR 352


>gi|293604994|ref|ZP_06687390.1| flagellar biosynthetic protein FlhB [Achromobacter piechaudii ATCC
           43553]
 gi|292816599|gb|EFF75684.1| flagellar biosynthetic protein FlhB [Achromobacter piechaudii ATCC
           43553]
          Length = 384

 Score =  348 bits (892), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 105/353 (29%), Positives = 183/353 (51%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  +   K+EA S +++E A  EG    SRE   F  + A +  +          ++ 
Sbjct: 1   MAEE-SDLEKSEAASPRRLEKAREEGQIARSRELGTFMMLAAGVGVIWAGGGSLYRGLSG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            LH  LA   QR + D   +V         A   ++P   +  +  + S ++    V++ 
Sbjct: 60  VLHNGLA-FDQRIVTDPGVMVEQAVIGFGHALLALLPVFGVLAVVAVLSSVLLGGIVISG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++ +F ++SL  G+KR++S   +V  +K+  K +LVG +    +   +  ML  +   
Sbjct: 119 KPLQANFSKLSLFAGLKRMFSSQTVVELIKALAKALLVGGVAVWVIWRYHDDMLGLMHVA 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + L  A   V     +I+  +  + +LD+ W       KL+MSK++++ E K+S G+P
Sbjct: 179 PSAALIKALSLVAICCALIVASLLVIVLLDVPWQIFSHLKKLRMSKEDVRQEHKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R   R +MM    RA +++TNPTHYA+AL+Y + ++ AP ++AKG  LIA
Sbjct: 239 HVKARIRQQQRQAARRRMMSEVPRADVVVTNPTHYAVALKYDEDKSGAPRVIAKGTGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++A E+ IP  E P LAR+L + V +   IP   Y AVA+++  ++  +
Sbjct: 299 AKIRELAAENRIPTLEAPPLARALHQHVELGKEIPAELYTAVAEVLAWVFQLR 351


>gi|261855327|ref|YP_003262610.1| flagellar biosynthetic protein FlhB [Halothiobacillus neapolitanus
           c2]
 gi|261835796|gb|ACX95563.1| flagellar biosynthetic protein FlhB [Halothiobacillus neapolitanus
           c2]
          Length = 379

 Score =  348 bits (892), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 96/353 (27%), Positives = 174/353 (49%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+    KTE PS K++ +A  +G    SRE    +      I  L      +  +  
Sbjct: 1   MAENENGQEKTEEPSEKRLREAREKGQVARSRELGSLALTAGSAIVFLVMGGHMLSRLEQ 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
                  + ++ ++ D + +   L          ++P  L  ++  + S L+      + 
Sbjct: 61  MFRHAF-TLSRAEIMDPATMFHRLALSFSEGFLALLPFFLAAVVLAVSSTLLVGGWNFST 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++   G KR++S+ +LV  +K+  K  L+  I            +      
Sbjct: 120 QALAPQFNRLNPLSGFKRMFSMKSLVELLKTLAKFFLIAAIAIGLFEAMEKDFVGLGLMG 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             + L  A   +    + + L +  + ++D+ +  +++   L+M++QE+ DE K+  G P
Sbjct: 180 LEAGLARAGTLLSWSFLGLSLGLLVVAMIDVPFQMYEYKKGLRMTRQEMIDEYKEVEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + + R   + +MMEA   A +IITNPTH+++AL+Y    + AP++VAKG + +A
Sbjct: 240 EVKQKIRQLQRQMAQRRMMEAVPTADVIITNPTHFSVALKYQPNSDAAPMVVAKGADEMA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
             +RKIA  +++P+FE P LARSLF  V +  AIP   Y AVAQ++  ++  K
Sbjct: 300 MTIRKIANANHVPLFESPQLARSLFAHVEVGDAIPSGLYVAVAQVLAYVFQMK 352


>gi|260772335|ref|ZP_05881251.1| flagellar biosynthesis protein FlhB [Vibrio metschnikovii CIP
           69.14]
 gi|260611474|gb|EEX36677.1| flagellar biosynthesis protein FlhB [Vibrio metschnikovii CIP
           69.14]
          Length = 376

 Score =  347 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 91/353 (25%), Positives = 175/353 (49%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+D    +TE  + ++++ A  +G    S+E +  S ++   + L++F       + +
Sbjct: 1   MAESD-GQERTEEATPRRLQQAKEKGQVARSKELASVSVLIIGSVALMWFGEMLASRLYT 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +     S ++ ++ D S +  ++          ++  L+   +  +           + 
Sbjct: 60  TMGRFF-SLSREEIFDSSKLFDIIAGTLTHLIFPLLLILITLFVAALIGAAGVGGVSFSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
              +P   ++S   G KR++ + +LV   KS +K++LV  +    +  +   +       
Sbjct: 119 EAARPKLSKISPLSGFKRMFGMQSLVELFKSILKVLLVAGVAFYLIDASKNDLFQLSMDV 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               ++HA   +   +++I   +  +  +D+ +   Q   KLKM+KQEIKDE K + G P
Sbjct: 179 YPQNIFHALEILLNFILLISCSLLVVVAIDVPFQIWQHAEKLKMTKQEIKDEYKDTEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM    +A +IITNP H+++ALRY Q  + AP++VAKG + +A
Sbjct: 239 EVKGRIRMLQREAAQRRMMADVPQADVIITNPDHFSVALRYKQGTDKAPIVVAKGGDFLA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA EH I I   P LAR+L+    +   IP   + AVAQ++  ++  K
Sbjct: 299 LKIREIAREHEIMIVAAPPLARALYYTTELEQEIPDGLFVAVAQVLAYVFQIK 351


>gi|307945650|ref|ZP_07660986.1| flagellar biosynthetic protein FlhB [Roseibium sp. TrichSKD4]
 gi|307771523|gb|EFO30748.1| flagellar biosynthetic protein FlhB [Roseibium sp. TrichSKD4]
          Length = 359

 Score =  347 bits (890), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 109/353 (30%), Positives = 194/353 (54%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++     KTE P+ K+++DAL++G+   S+E S + ++    + +  F      +V +
Sbjct: 1   MADDQDDAEKTEDPTQKRLKDALDKGDVAKSQEVSTWFTLAGTTLLIALFAPTIGAAVGN 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   +  A    + D   +  L      S + +V   L+  ++  I   ++Q   V   
Sbjct: 61  HLKGFMEHAHDIPV-DGFALKALWRDTGQSIALIVGLPLMALVVMAIAGNMVQHQLVFTA 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +KP   +VS   G KR++S ++LVNF K   KI +VG ++ + L  +       I A+
Sbjct: 120 ETMKPKLSKVSPLSGFKRLFSKDSLVNFAKGLAKIFVVGALMVLVLWPHRDEADIMIFAD 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P  +L  A F + ++L  ++ F+  +   D  +  ++W++K KMS +++KDE KQ+ G+P
Sbjct: 180 PVILLEEARFLILQLLGAVMAFMTVVAAADYAYQKNKWFNKQKMSLRDVKDEYKQTEGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + +   R R +MM A   AT+++TNPTH+A+AL+Y +    AP+ +AKG + +A
Sbjct: 240 HVKGKIRQLRMERSRKRMMAAVPDATVVVTNPTHFAVALKYEEG-MGAPLCLAKGTDAVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++A E  IP+ E P LAR+L+  V I   +P   YKAVA++I  +Y  +
Sbjct: 299 LKIRELAKEKKIPVVENPPLARALYASVEIEQEVPEEHYKAVAEVIGFVYRMR 351


>gi|254522000|ref|ZP_05134055.1| flagellar biosynthetic protein FlhB [Stenotrophomonas sp. SKA14]
 gi|219719591|gb|EED38116.1| flagellar biosynthetic protein FlhB [Stenotrophomonas sp. SKA14]
          Length = 377

 Score =  347 bits (890), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 92/353 (26%), Positives = 174/353 (49%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSEN++   KTE P+ K++ DA  +GN P SRE    +   A ++ ++          T+
Sbjct: 2   MSENESAGEKTEQPTEKRLRDAREQGNLPRSRELGTAAVFGAGVLAVMAMSGSIGRGATA 61

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L S  Q   ++   +      L L    ++ P +L+ ++    + L+      + 
Sbjct: 62  WMKHAL-SPEQSLRQNPKELFGHFGDLLLQFLLVIAPLVLVCLLASFVAPLVMGGLRWSQ 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   R++   G+KR+Y    +  F KS +++  VG    + +   + T+   I   
Sbjct: 121 KALLPDINRLNPMSGLKRLYGPEAIAEFTKSLLRVAFVGVAAGLVVWTGFDTLRGLIHHP 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             + +        ++L+     +  L  +D  +    W  KLKM+++E++ E+K+S G+P
Sbjct: 181 LETAITDGLGFTLRLLLATAGAMLVLAAIDAPYQRWNWMRKLKMTREELRREMKESEGSP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + +     +MMEA   A +++ NPTHYA+AL+Y     +AP +VA G +  A
Sbjct: 241 EVKGRIRQLQQQMANRRMMEAVPTADVVVVNPTHYAVALKYEGGAMNAPTVVALGVDETA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A  + + I   P LAR+L+++  +   IP   Y AVAQ++  +Y  +
Sbjct: 301 LRIREVADGNKVAIVSAPPLARALYREGQLGKEIPVRLYSAVAQVLSYVYQLR 353


>gi|294635599|ref|ZP_06714076.1| flagellar biosynthetic protein FlhB [Edwardsiella tarda ATCC 23685]
 gi|291091051|gb|EFE23612.1| flagellar biosynthetic protein FlhB [Edwardsiella tarda ATCC 23685]
          Length = 401

 Score =  346 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 105/350 (30%), Positives = 174/350 (49%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            ++   KTE P+  +IE A  +G  P SRE +    +   L  LL        S+   + 
Sbjct: 16  EESDLEKTEDPTPHRIEKAREKGQIPRSRELTSMLMLAVGLAILLLGGDYLASSLAVMIA 75

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       L +   ++  L  L   A   ++P LL  M+ G  + ++    + N   +
Sbjct: 76  QGL-HFDHLLLSNDRQMLIQLGMLLRQAVAALLPVLLGLMLVGWCAPMLIGGFLFNPGSI 134

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           K    R++   G KR++S   L   +K  +K  LVG +    L   +  ML  I+ +   
Sbjct: 135 KCELNRLNPLTGFKRMFSSQVLAELLKGVLKATLVGCVTGWFLWHYWPRMLRLITESSLE 194

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            +  A   V    ++++L +  +   D+ +      +KL+M+KQEIKDE K+  G+P +K
Sbjct: 195 AMGDALHLVGMCGLLVVLGLLPMVGFDVFYQLWSNLNKLRMTKQEIKDEFKEQEGDPHVK 254

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R +   R+  R +MM    +A +I+TNPTHYA+AL+Y + +  AP ++AKG   IA+++
Sbjct: 255 GRIRQQQRAAARRRMMSDVPKADVIVTNPTHYAVALQYQENKMSAPKVLAKGAGNIAQRI 314

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           + +  EH IP  E P LAR+L++   I  AIP   Y AVA+++  +Y  K
Sbjct: 315 KALGMEHRIPQLEAPPLARALYRHSEIGQAIPATLYAAVAEVLAWVYQLK 364


>gi|300311341|ref|YP_003775433.1| flagellar biosynthesis FlhB transmembrane protein [Herbaspirillum
           seropedicae SmR1]
 gi|300074126|gb|ADJ63525.1| flagellar biosynthesis FlhB transmembrane protein [Herbaspirillum
           seropedicae SmR1]
          Length = 391

 Score =  346 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 102/353 (28%), Positives = 190/353 (53%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   +TE  + K+IE A  +G+ P SRE +    +L     +  F  P + S+  
Sbjct: 1   MAE-DSDMERTEPATGKRIERAREQGDVPRSRELATCLVLLVGGSCVWMFSGPVVTSL-D 58

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            + V + S  +  + D   ++ L++   L  +  VIP   L  +  + + L     + N+
Sbjct: 59  RIMVAMMSLERAAIYDPVVLMNLISARCLDVAIAVIPLAFLMTLAAMAAPLTLGGWLFNV 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + + P F +++   G   ++S+N+LV   K+ +K +LVGT+  +++      ++     +
Sbjct: 119 SSLAPKFSKLNPISGFANMFSVNSLVELGKAVLKTLLVGTVAWVTIRSQLDAVMGLGVES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             +   HA   +    I ++  +  + VLD+ +    +  KL+M+++E+K E K+S G+P
Sbjct: 179 LKTAGAHAAQLLWISFITMVSALIFIAVLDVPYQLWNYGRKLRMTREEVKQEHKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK + +++ R+  R +MM     A +++TNPTHYA+AL+Y + +  AP +VAKG + IA
Sbjct: 239 HIKGKIRAMQRAMARRRMMAEVPTADVVVTNPTHYAVALKYSEGKMGAPKVVAKGSDEIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++A EH +P+ E P LAR+L     I   IP   Y AVA+++  ++  +
Sbjct: 299 AKIRELAREHRVPLLEAPPLARALHTHTEIGDEIPEALYTAVAEVLAYVFQLR 351


>gi|238927446|ref|ZP_04659206.1| flagellar biosynthesis protein FlhB [Selenomonas flueggei ATCC
           43531]
 gi|238884728|gb|EEQ48366.1| flagellar biosynthesis protein FlhB [Selenomonas flueggei ATCC
           43531]
          Length = 374

 Score =  346 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 102/347 (29%), Positives = 180/347 (51%), Gaps = 3/347 (0%)

Query: 7   PDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLL 66
              KTE P++KK  DA  +G    S+E +    +L     L   +     S+      + 
Sbjct: 25  GGEKTEEPTAKKRADARKKGQVGRSQELNTAFVLLIGFFSLKLLWDYIYLSIAGYTTYVF 84

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
           ++  Q  + D  +I+ +   +++  ++   P +   M+ G+     Q     N   ++  
Sbjct: 85  SNLNQ--VVDAENILRIFIGIAIVLAKTAFPIMFAIMLIGLAINFFQVGLTFNTESIEFK 142

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
             +++   G  RI+S  +LV   KSF KI+++G  +   + E    M  F+  +  + L 
Sbjct: 143 LDKLNPINGFGRIFSKRSLVELAKSFFKILVIGFFLYRFIHEQILAMPQFMFFDLTTSLS 202

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
                +  +  +++  I  + ++D G+   Q    LKM+KQE+KDE+KQS G+P IK + 
Sbjct: 203 LVAEIIFHMAFIVIGVIMVMALMDYGYQKWQTTQDLKMTKQEVKDEMKQSEGDPQIKGKI 262

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           +   R     +MM+   +A +IITNPTH+A+AL Y Q    AP++VAKGQ+++A+++++I
Sbjct: 263 RQKQRQMAMARMMKEVPKADVIITNPTHFAIALSYQQG-MSAPLVVAKGQDIVAQRIKEI 321

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A E  +PI E   LAR+++  V I  AIP   Y+AVA+++  +Y  K
Sbjct: 322 AREARVPIVENKPLARAIYAAVQIGDAIPQELYQAVAEVLAYVYRLK 368


>gi|149188098|ref|ZP_01866393.1| flagellar biosynthesis protein B [Vibrio shilonii AK1]
 gi|148838086|gb|EDL55028.1| flagellar biosynthesis protein B [Vibrio shilonii AK1]
          Length = 376

 Score =  346 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 89/353 (25%), Positives = 176/353 (49%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+D    +TE  + ++++ A  +G    S+E +  S ++   + L+ F      ++  
Sbjct: 1   MAESD-GQERTEDATPQRLKQAREKGQVARSKELASVSVLIVGALSLMMFGEGLARALFG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L  + ++ ++ D + +  +      S    ++  L +  +  +           + 
Sbjct: 60  SMARLF-NLSREEIYDSTKLFDVALGALSSLLLPLLLILFVLFIAALIGAAGVGGISFSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   +++   G+KR+  + + V  +KS +K+ LV  +    +  +   +       
Sbjct: 119 EAAMPKLSKMNPLSGLKRMVGMQSWVELIKSILKVTLVAGMAFYLVNASRADLFQLSMEV 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               ++HA   +   +++I   +  +  +DI +   Q  ++LKM+KQE+KDE K + G P
Sbjct: 179 FPQNIFHALDILLNFILLISATLLIVVAIDIPFQIWQHANQLKMTKQEVKDEFKDTEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM    +A +IITNP H+++ALRY Q ++ APV+VAKG + +A
Sbjct: 239 EVKGRIRMLQREAAQRRMMAEVPQADVIITNPEHFSVALRYKQGQDKAPVVVAKGIDHMA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++A EH+I +   P LARSL+    +   IP   + AVAQ++  +Y  K
Sbjct: 299 LKIREVAREHSIYVIPSPPLARSLYHTTELEQEIPDGLFAAVAQILAYVYQLK 351


>gi|261407965|ref|YP_003244206.1| flagellar biosynthetic protein FlhB [Paenibacillus sp. Y412MC10]
 gi|261284428|gb|ACX66399.1| flagellar biosynthetic protein FlhB [Paenibacillus sp. Y412MC10]
          Length = 362

 Score =  346 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 94/346 (27%), Positives = 173/346 (50%), Gaps = 1/346 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE  + KK +D   +G    S E S  S +LA    LL F              +  
Sbjct: 14  GEKTEKATPKKRQDTRKKGQVAKSMEVSGASVLLAAFFCLLIFGGYMRDRTVRLFTDIYI 73

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
           +     +    +++ L     +    L+ P  +   +  + +  +Q   +L    +K  F
Sbjct: 74  NRLSMNVTK-DNVMELFGEYGVQILLLLAPLFISIFVIALVANYLQVGFMLTGETLKMKF 132

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
            ++   +G K I+S+ +LV F+KS +K+ ++G ++  +L      +    +  P +I + 
Sbjct: 133 SKIDPIKGFKNIFSMRSLVEFLKSVIKLTIIGYLVYSTLWAAREDLSSLSTMGPDTIFHF 192

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
                  +   I + +  L VLD  +  + +   ++MSKQ+IKDE K+  G+P+IK + +
Sbjct: 193 VADITMSLGFKIAIGLIILAVLDYMYQKYDYEKNIRMSKQDIKDEYKKMEGDPLIKGKIR 252

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              R     +MM+    A +IITNPTH+A+A++Y  +  +AP ++AKGQ+ +A ++++IA
Sbjct: 253 ERQRRMALQRMMQEVPNADVIITNPTHFAVAIKYDGSTMEAPQIIAKGQDFMALRIKEIA 312

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            EH I   E   LAR+L+++  I  +IP   ++AVA+++  +Y  K
Sbjct: 313 KEHGIITMENKPLARALYQRSEIGDSIPGDLFQAVAEVLAYVYKLK 358


>gi|253573537|ref|ZP_04850880.1| flagellar biosynthetic protein FlhB [Paenibacillus sp. oral taxon
           786 str. D14]
 gi|251847065|gb|EES75070.1| flagellar biosynthetic protein FlhB [Paenibacillus sp. oral taxon
           786 str. D14]
          Length = 363

 Score =  346 bits (889), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 90/346 (26%), Positives = 178/346 (51%), Gaps = 1/346 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE  + KK ++A  +G    S+E +    ++A  + L  F       +      +  
Sbjct: 14  GEKTEKATPKKRQEARKKGQVAKSQELTGALLLMAGFLCLTAFAGYFKDRLIGLFVDVFY 73

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
                ++   ++++ ++   ++    L+ P  L+ ++  + +   Q   +L    +K  F
Sbjct: 74  HRLSMEVTK-TNVMAMMGEYAVQVLLLLAPIFLVVIVVAVVANYAQIGFMLVGEPLKIKF 132

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
            ++   +G K I+S+ +LV F+K+  K++++G ++  ++     ++      +     + 
Sbjct: 133 SKLDPIKGFKNIFSMRSLVQFVKTLFKLLIIGYLVYSTIWGYRGSLSALGHVSVDDTFHF 192

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
                  + + I   +  L VLD  +  ++    LKMSKQ+IKDE K+  G+P+IK + +
Sbjct: 193 TAQLTMNLGLKIAAALIVLAVLDYMYQRYEHEKNLKMSKQDIKDEYKKMEGDPLIKGKIR 252

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              R     +MM+   +A +IITNPTH+A+AL+Y  ++ DAP ++AKGQ+ +A ++++IA
Sbjct: 253 ERQRRMALQRMMQEVPKADVIITNPTHFAVALKYDGSKMDAPQVIAKGQDYVALRIKEIA 312

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            EH +   E   LAR+LF++  I   IP   ++AVA+++  +Y  K
Sbjct: 313 KEHGVITMENKPLARALFQRTEIGDTIPADLFQAVAEVLAYVYRIK 358


>gi|330880588|gb|EGH14737.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 378

 Score =  346 bits (888), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 101/353 (28%), Positives = 187/353 (52%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+   +KTE P+ KK++D+  +G    S+E +    +L     LL F S GI  + S
Sbjct: 1   MAENENGQDKTEDPTEKKVKDSRADGQIARSKELTTLVVMLMGAGGLLMFGS-GIAQMMS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           +L     + ++  L D S++   L    L A  +++P L+  ++  +   ++    +   
Sbjct: 60  ELMRDNFTISRETLMDQSYMGKALLSSGLHALVVMLPFLIAMLVAALVGPIMLGGWLFAT 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++   G+KR++S + LV  +KSF K +++  +  + L+     ++  +   
Sbjct: 120 KSLMPKFSRMNPAAGLKRMFSPHALVELLKSFGKFLIILAVALVVLSNERNDLVAIVHEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V      +   +  +   D+ +  ++ +  L M+KQE++DE K S G+P
Sbjct: 180 LEQAMIHSLLVVGWSSFWMACGLIFIAAADVPFVLYEAHKTLLMTKQEVRDEQKNSEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM +   A +IITNPTH+A+AL+Y   +  AP+L+AKG +L+A
Sbjct: 240 EVKQRIRQLQREMSQRRMMASIPEADVIITNPTHFAVALKYDPEQGGAPMLLAKGTDLVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+I   + I I E  +LARS++    ++  IP   Y AVAQ++  +Y  +
Sbjct: 300 LKIREIGAHNQILILESAALARSIYYSTELDQEIPAGLYLAVAQVLAYVYQIR 352


>gi|300717104|ref|YP_003741907.1| flagellar biosynthesis protein [Erwinia billingiae Eb661]
 gi|299062940|emb|CAX60060.1| Flagellar biosynthesis protein [Erwinia billingiae Eb661]
          Length = 381

 Score =  346 bits (888), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 101/353 (28%), Positives = 191/353 (54%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+  D+ + KTE+ +  +IE A  EG  P SRE +    ++A L  L    +     + +
Sbjct: 1   MA-GDSEEEKTESATPHRIEKAREEGQIPRSRELTSVLMLVAGLSILWITGATMARKIGA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L       + D S ++ LL +L       +IP +   ++  I + ++    V++ 
Sbjct: 60  LLADGLK-FNHSVVSDTSQMLHLLGNLVQQGIFTLIPMMAGLVLVAIAAPMLLGGVVISG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K    +++  +GI +++S       +KS +K ILVG +  + +  ++  ML  IS +
Sbjct: 119 KAIKFDVGKMNPIKGIGKLFSGQTAAELLKSVLKAILVGCVTWLYIRHHWPDMLRLISES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P++ L ++   +    ++++  ++ + + D+ W  + ++  L+M++Q+I+DE KQ  G+P
Sbjct: 179 PYNALANSLNMIAMCSVLVVFGLSPMVMFDVFWQLYSYFKGLRMTRQDIRDEYKQQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A +I+TNPTHY++AL+Y + +  AP +VAKG   IA
Sbjct: 239 HVKGRIRQQMRAAARRRMMADVPKADVIVTNPTHYSVALQYDERKMSAPKVVAKGAGEIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++  EH IPI E P LAR+L++   I   IP   Y AVA+++  ++  +
Sbjct: 299 LRIRELGKEHRIPILEAPPLARALYRHSEIGQHIPGTLYAAVAEVLAWVWQLR 351


>gi|229544411|ref|ZP_04433469.1| flagellar biosynthetic protein FlhB [Bacillus coagulans 36D1]
 gi|229324896|gb|EEN90573.1| flagellar biosynthetic protein FlhB [Bacillus coagulans 36D1]
          Length = 360

 Score =  346 bits (888), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 100/346 (28%), Positives = 181/346 (52%), Gaps = 1/346 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE  + KK  DA  +G    S++      +LA  ++L F  S     + +      +
Sbjct: 13  GEKTEKATPKKRRDARKKGQTAKSQDIVTAVMLLAVFLFLYFGASSIGSPMMALFRQAFS 72

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
               + + + S +  L+T +    + +++P + + ++ G+   + Q   +     +KP+ 
Sbjct: 73  KYMLQDVTEQS-VGKLMTGVMKQLASMLLPVMAVALLAGVVGNVAQTGLLFTGEGLKPNI 131

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
            +++   G+KRI+SI  LV  +KS +K+ +VG +    +  N   +      +    L  
Sbjct: 132 NKINPVAGLKRIFSIRALVELLKSVLKMAVVGVVAFYVIWANIQDISGLPFKSAGDTLAA 191

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
                    I   + +  L VLD  +    +   ++MSKQEIK+E K   G+P+IK++ +
Sbjct: 192 VGHLAAITGISASVALFVLAVLDYLYQRFDFEKNIRMSKQEIKEEFKNMEGDPLIKSKIR 251

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              R     +MM+    A ++ITNPTH+A+ LRY +T++DAP++VAKG + +A+K++ IA
Sbjct: 252 QKQREMAMRRMMQEVPNADVVITNPTHFAVCLRYDETKSDAPIVVAKGADFLAQKIKSIA 311

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            EH+I + E   LAR+L++QV +   IP  F+KAVA+++  +Y  K
Sbjct: 312 KEHDIVMLENRPLARALYEQVEVGGRIPEQFFKAVAEILAYVYKIK 357


>gi|304396256|ref|ZP_07378138.1| flagellar biosynthetic protein FlhB [Pantoea sp. aB]
 gi|304356625|gb|EFM20990.1| flagellar biosynthetic protein FlhB [Pantoea sp. aB]
          Length = 382

 Score =  346 bits (887), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 104/348 (29%), Positives = 183/348 (52%), Gaps = 1/348 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D+ ++KTE+P++ ++E A  EG  P SRE +    +LA ++ L    +   + + + + 
Sbjct: 2   SDSDEDKTESPTAHRLEKAREEGQIPRSRELTSVLMLLAGIMILWMGGNMMAHRLAAMVA 61

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       + D   IV  +  L   A   ++P +   ++  I + ++    V +   +
Sbjct: 62  TGLR-FDHGMVRDDKIIVSHIGSLITQALMALLPLMGGLVLVAIAAPMLLGGIVFSGKSI 120

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           K   K+++   G KR+++        K  +K ILVG +    +  ++  ML  IS  P +
Sbjct: 121 KFDPKKMNPIAGFKRMFAAQAWTELFKGILKTILVGAVGWWYIWSHWPEMLRLISEAPVT 180

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            L H    +     +++L +  +   D+ W  +  + KLKMS QEI+DE KQ  G+P +K
Sbjct: 181 ALIHGMEMIAVCCSLVMLGLIPMVGYDVFWQLYSHFKKLKMSMQEIRDEHKQQEGDPHVK 240

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R +   R+  R +MM    +A +I+TNPTHY++AL+Y + +  AP +VAKG   IA ++
Sbjct: 241 GRIRQQMRAAARRRMMADVPKADVIVTNPTHYSVALQYNEKKMSAPKVVAKGAGEIALRI 300

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           R++A EH IP+ E P LAR+L++   I   IP   Y AVA+++  ++ 
Sbjct: 301 RELAAEHRIPVLEAPPLARALYRHTEIGQHIPGALYAAVAEVLAWVWQ 348


>gi|304316890|ref|YP_003852035.1| flagellar biosynthetic protein FlhB [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302778392|gb|ADL68951.1| flagellar biosynthetic protein FlhB [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 357

 Score =  346 bits (887), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 99/348 (28%), Positives = 181/348 (52%), Gaps = 2/348 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE  + K+ +DA  +G    SRE +     +A  + + F     I  + + +  L  
Sbjct: 8   GEKTEPATPKRRQDARKKGQVFQSREVTSAIITIAGFLVIYFTVQNSIEEIMNLIKYLFL 67

Query: 68  SAT--QRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           +          ++ I  L   +     +L++P +    +  + S   Q   V     +  
Sbjct: 68  NYGGASDNTFTVNGIYKLFEIILPVFLKLILPTVATVFLVALVSTYAQVGFVFTSESLNI 127

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
             +R++  EGIKR++S   ++  +K+ VKI ++G ++   L   Y  +   +  +   ++
Sbjct: 128 KLERLNPLEGIKRMFSRRTILELLKAVVKIGILGYVMYSFLIGQYKGIPQLLDMSVQDLI 187

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
            ++      +L+ I + +  L V+D  + +  + S L+MSK++IK+E K++ GNP IK+ 
Sbjct: 188 KYSLNIFGGILLRIFIVLIVLGVVDYIFQWRDYESNLRMSKEDIKEEFKETEGNPQIKSE 247

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
            K   R     +M++   +A ++ITNPTH A+AL Y    NDAPV+VAKGQ+ IA+++++
Sbjct: 248 IKKKQRQISMRRMIQNIKKADVVITNPTHIAVALMYDNEINDAPVVVAKGQDYIAQRIKE 307

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            A +++I I E   LA+SL+K   I  +IPP  YKAVA+++  +Y  +
Sbjct: 308 EAIKYSIAIVENKPLAQSLYKTTDIGDSIPPELYKAVAEVLAYVYSLR 355


>gi|77165624|ref|YP_344149.1| flagellar biosynthetic protein FlhB [Nitrosococcus oceani ATCC
           19707]
 gi|254433995|ref|ZP_05047503.1| flagellar biosynthetic protein FlhB [Nitrosococcus oceani AFC27]
 gi|76883938|gb|ABA58619.1| Flagellar biosynthetic protein FlhB [Nitrosococcus oceani ATCC
           19707]
 gi|207090328|gb|EDZ67599.1| flagellar biosynthetic protein FlhB [Nitrosococcus oceani AFC27]
          Length = 377

 Score =  346 bits (887), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 83/353 (23%), Positives = 178/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++ +   +TE P+ K+ E+A  +G  P SRE S    +L+  + L+    P +  +  
Sbjct: 1   MADS-SAQERTEQPTPKRQEEARKKGQVPRSRELSTTVLLLSSALGLVLIGEPLLQGLAD 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L    + ++ +    +         A +++ P L L ++  + + L+      + 
Sbjct: 60  LMRQGL-QLERAQIFEPKAAILQFQQGVGEAVKIITPFLALTLIAALAAPLLMGGWSFSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +   +++++  +G+KRI+     +  +K+ +K +L+  +  +        ++      
Sbjct: 119 QSLGFKWEKLNPAKGMKRIFGPQGGMELLKALIKFLLLSGVGCLLFWLFSPDLIALGRQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               ++     +   L+ +   +A + V+D  +       +LKM++QE+K+E K++ GNP
Sbjct: 179 FVPAVFQLAHLMGWSLVGLSASLALIAVIDAPFQGWNHTRQLKMTRQEVKEEHKETDGNP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R     +MM A  +A +++ NPTHYA+AL Y Q +  AP +VAKG + +A
Sbjct: 239 ELKGRIRRVQREIASRRMMAAVPQADVVVVNPTHYAVALNYEQDKQGAPRVVAKGVDQVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R +A  +N+P+   P+L+R+++    ++  IP   Y+AVAQ++  +   +
Sbjct: 299 IKIRTVAAGNNVPVLSAPALSRAIYHSTKLDQEIPAGLYRAVAQVLAYVLQLR 351


>gi|190574224|ref|YP_001972069.1| flagellar biosynthesis protein FlhB [Stenotrophomonas maltophilia
           K279a]
 gi|190012146|emb|CAQ45769.1| putative flagellar biosynthetic protein FlhB [Stenotrophomonas
           maltophilia K279a]
          Length = 376

 Score =  346 bits (887), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 91/353 (25%), Positives = 174/353 (49%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSEN++   KTE P+ K++ DA  +GN P SRE    +   A ++ ++          ++
Sbjct: 1   MSENESAGEKTEQPTEKRLRDAREQGNLPRSRELGTAAVFGAGVLAVMAMSGSIGRGASA 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L S  Q   ++   +      L L    ++ P +L+ ++    + L+      + 
Sbjct: 61  WMKHAL-SPEQGLRQNPKELFGHFGDLLLQFMLVIAPLVLVCLLASFVAPLVMGGLRWSQ 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   R++   G+KR+Y    +  F KS +++  VG    + +   + T+   I   
Sbjct: 120 KALLPDINRMNPMSGLKRLYGPEAIAEFTKSLLRVAFVGVAAGLVVWTGFDTLRGLIHHP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             + +        ++L+     +  L  +D  +    W  KLKM+++E++ E+K+S G+P
Sbjct: 180 LETAITDGLGFTLRLLLATAGAMLVLAAIDAPYQRWNWMRKLKMTREELRREMKESEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + +     +MMEA   A +++ NPTHYA+AL+Y     +AP +VA G +  A
Sbjct: 240 EVKGRIRQLQQQMANRRMMEAVPTADVVVVNPTHYAVALKYEGGTMNAPTVVALGVDETA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A  + + I   P LAR+L+++  +   IP   Y AVAQ++  +Y  +
Sbjct: 300 LRIREVADGNKVAIVSAPPLARALYREGQLGKEIPVRLYSAVAQVLSYVYQLR 352


>gi|27885003|gb|AAD56298.2| FlhB [Pseudomonas putida]
          Length = 380

 Score =  346 bits (887), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 103/354 (29%), Positives = 180/354 (50%), Gaps = 2/354 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+++  +KTE P+ K+  DA  +G    S+E +     L     LL F      ++ +
Sbjct: 1   MAESESGQDKTEDPTDKRKRDAREKGEIARSKELNTVVLTLGGAGALLTFGGHLAETLLT 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            + +   S T+  + D   +   L      A   V P L L  +  +   +     + + 
Sbjct: 61  LMRMNF-SLTRDVIVDERAMGAFLLASGKMAIWAVQPVLGLLFVLALIGPVALGGFLFSG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + ++P F R+S   GIKR++S+N++   +K+  K  ++  +  + L+ +   +L   +  
Sbjct: 120 SLLQPKFSRMSPLSGIKRMFSLNSVTELLKAVAKFFVILVVALVVLSHDRQALLAIANEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + HA   V    + +   +  +  +D+ +   Q   KLKM+KQE++DE K S G P
Sbjct: 180 LEQAIIHAVQVVGWSALWMAAGLLLIAAVDVPFQLWQTQQKLKMTKQEVRDEYKDSEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEND-APVLVAKGQNLI 299
            +K R + + R   + +MM A   A +IITNPTHYA+AL+Y   +   AP+L+AKG + I
Sbjct: 240 EVKQRIRQLQREASQRRMMAAVPDADVIITNPTHYAVALQYDPEKGGVAPLLLAKGTDFI 299

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A K+R+I  EH + I E P+LAR+++    I   IP   Y AVAQ++  ++  +
Sbjct: 300 ALKIREIGVEHKVQILESPALARAIYYSTEIEQEIPAGLYLAVAQVLAYVFQIR 353


>gi|213022149|ref|ZP_03336596.1| flagellar biosynthesis protein FlhB [Salmonella enterica subsp.
           enterica serovar Typhi str. 404ty]
          Length = 336

 Score =  346 bits (887), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 97/338 (28%), Positives = 179/338 (52%), Gaps = 2/338 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  + D+KTEAP+  ++E A  EG  P SRE +    +L  +  + F        +  
Sbjct: 1   MAEE-SDDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVCIIWFGGESLARQLAG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L     R + D + I+  +  L  +A   ++P +   ++  + S ++    + + 
Sbjct: 60  MLSAGL-HFDHRMVNDPNLILGQIILLIKAAMMALLPLIAGVVLVALISPVMLGGLIFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   GIKR++S       +K+ +K  LVG +    L  ++  M+  ++ +
Sbjct: 119 KSLQPKFSKLNPLPGIKRMFSAQTGAELLKAVLKSTLVGCVTGFYLWNHWPQMMRLMAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   + +A   V    ++++L +  +   D+ +       KL+MS+Q+I+DE K+S G+P
Sbjct: 179 PIVAMGNALDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + + R+  + +MME   +A +I+TNPTHY++AL+Y + +  AP +VAKG  LIA
Sbjct: 239 HVKGKIRQMQRAAAQRRMMEDVPKADVIVTNPTHYSVALQYDENKMSAPKVVAKGAGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVF 338
            ++R+I  EH +P  E P LAR+L++   I   IP   
Sbjct: 299 LRIREIGAEHRVPTLEAPPLARALYRHAEIGQQIPGQL 336


>gi|329929309|ref|ZP_08283062.1| flagellar biosynthetic protein FlhB [Paenibacillus sp. HGF5]
 gi|328936678|gb|EGG33121.1| flagellar biosynthetic protein FlhB [Paenibacillus sp. HGF5]
          Length = 365

 Score =  345 bits (886), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 94/346 (27%), Positives = 173/346 (50%), Gaps = 1/346 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE  + KK +D   +G    S E S  S +LA    LL F              +  
Sbjct: 17  GEKTEKATPKKRQDTRKKGQVAKSMEVSGASVLLAAFFCLLIFGGYMRDRTVRLFTDIYI 76

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
           +     +    +++ L     +    L+ P  +   +  + +  +Q   +L    +K  F
Sbjct: 77  NRLSMNVTK-DNVMQLFGEYGVQILLLLAPLFISIFVIALVANYLQVGFMLTGETLKMKF 135

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
            ++   +G K I+S+ +LV F+KS +K+ ++G ++  +L      +    +  P +I + 
Sbjct: 136 SKIDPIKGFKNIFSMRSLVEFLKSVIKLTIIGYLVYSTLWAAREDLSSLSTMGPDTIFHF 195

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
                  +   I + +  L VLD  +  + +   ++MSKQ+IKDE K+  G+P+IK + +
Sbjct: 196 VADITMSLGFKIAVGLIILAVLDYMYQKYDYEKNIRMSKQDIKDEYKKMEGDPLIKGKIR 255

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              R     +MM+    A +IITNPTH+A+A++Y  +  +AP ++AKGQ+ +A ++++IA
Sbjct: 256 ERQRRMALQRMMQEVPNADVIITNPTHFAVAIKYDGSTMEAPQIIAKGQDFMALRIKEIA 315

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            EH I   E   LAR+L+++  I  +IP   ++AVA+++  +Y  K
Sbjct: 316 KEHGIITMENKPLARALYQRSEIGDSIPGDLFQAVAEVLAYVYKLK 361


>gi|254478867|ref|ZP_05092231.1| flagellar biosynthetic protein FlhB [Carboxydibrachium pacificum
           DSM 12653]
 gi|214035180|gb|EEB75890.1| flagellar biosynthetic protein FlhB [Carboxydibrachium pacificum
           DSM 12653]
          Length = 360

 Score =  345 bits (886), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 98/348 (28%), Positives = 179/348 (51%), Gaps = 2/348 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE  + K+ ++A  +G    SRE +    I+   + +  F    +  V + L  LL 
Sbjct: 11  GEKTEPATPKRRQEARKKGQVFQSREITSALVIVTGFLMIHLFLQSFLGRVGNLLKFLLI 70

Query: 68  SAT--QRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           + +     + + + I  +  ++      + +P +L      + S   Q   V     +  
Sbjct: 71  TYSGANDDVFNTAGIWKIFYYMVNQVVLISVPIMLAIFAVSLISTYFQVGFVFTAEPLTL 130

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
            F+R++  EG KRI+S   LV  +KS  K++++  I+   L   Y  +   +  +   +L
Sbjct: 131 KFERLNPVEGFKRIFSRRALVELLKSVAKVVVLFYIMYSFLASQYKGIPMLLDMSVQDLL 190

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
            +    +  + I I + +  L V+D  + + ++ + LKMSK++IK+E K++ GNP IK  
Sbjct: 191 RYTSNILFGITIRIGIVLIVLGVIDYFFQWREYENSLKMSKEDIKEEFKETEGNPQIKAE 250

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
            +   R     +MM+   +A ++I NPTH+A+AL Y    NDAPV+VAKG++L+A K+++
Sbjct: 251 IRKKQRQISTRRMMQDLKKADVVIINPTHFAVALMYDSEVNDAPVVVAKGKDLLALKIKE 310

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            A + +IPI E   LA++L+    +   IPP  Y+AVA+++  +Y  +
Sbjct: 311 EAEKLDIPIVENKPLAQALYNSTEVGQMIPPELYQAVAEVLAYVYSLR 358


>gi|167040311|ref|YP_001663296.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter sp. X514]
 gi|166854551|gb|ABY92960.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter sp. X514]
          Length = 360

 Score =  345 bits (886), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 108/348 (31%), Positives = 184/348 (52%), Gaps = 2/348 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE  + K+ +DA  +G    SRE +    I+A  + +     P +  + +    LL 
Sbjct: 11  QEKTEPATPKRRQDARKKGQVFQSREITSALVIVAGFLAVNILTMPSLEKMMALTKYLLY 70

Query: 68  SAT--QRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           + +     + ++  I  L T++   A  + +P +LL  +  + S  +Q   V     +  
Sbjct: 71  TYSGANDDVFNVVGIRNLFTYVLQQAISIAMPIILLIFVVSLASTYLQVGFVFTAEPLAF 130

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
            F+R++  EG KRI+S   LV  +KS  K+ ++  I+   L   Y  +   +  +   IL
Sbjct: 131 KFERLNPVEGFKRIFSKRALVELVKSIAKVAVLFYIMYSFLASQYKGIPMLLDMSVQDIL 190

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
            +A   +  + I I + +  L  LD  + + ++ + LKMSK++IK+E K++ GNP IK  
Sbjct: 191 KYALNILLGITIRIGIVLIVLGALDYFFQWREYETSLKMSKEDIKEEFKETEGNPQIKAE 250

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
            +   R     +MM+   +A ++ITNPTH A+AL Y    NDAPV++AKGQ++IA +M++
Sbjct: 251 IRRKQRQVSMRRMMQDLKKADVVITNPTHLAVALMYDSNVNDAPVVIAKGQDMIALRMKE 310

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            A + NIPI E   LA++L++   I   IPP  Y+AVA+++  +Y  K
Sbjct: 311 EAKKLNIPIVENKPLAQALYRSTEIGDMIPPELYQAVAEVLAYVYSLK 358


>gi|160939623|ref|ZP_02086971.1| hypothetical protein CLOBOL_04515 [Clostridium bolteae ATCC
           BAA-613]
 gi|158437414|gb|EDP15178.1| hypothetical protein CLOBOL_04515 [Clostridium bolteae ATCC
           BAA-613]
          Length = 353

 Score =  345 bits (886), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 91/352 (25%), Positives = 171/352 (48%), Gaps = 4/352 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+     + KTE  + K+ +D   +GN   S + +   S+L     L         S   
Sbjct: 1   MA----AEEKTEKATPKRRQDERKKGNVFQSNDVAAVCSLLVLFHSLKALAPMMYESFGE 56

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +H+  + A+   +        L     L   +  +P L + ++  +     Q     + 
Sbjct: 57  CMHLFFSYASSPDIFWQEGGKGLFMKAVLVFFKASLPLLFIGVLTAVIVTFFQTRMAFSW 116

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + +K  F R+S  +G KR++S+ +++  +KS +KI ++G ++   L      +   +   
Sbjct: 117 DVLKFKFDRISPLKGFKRMFSLRSVIELLKSLIKITVLGWVVWFFLKGRLTELTGLMEGT 176

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             S L +   TV  ++  + +    L  +D  + + ++   L+MSKQEIK+E KQ+ G+P
Sbjct: 177 VASALIYVGNTVVSLVDTVGIAFVFLGAVDYLYQWWEYEKNLRMSKQEIKEEYKQTEGDP 236

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK + +   R     +MM+    A ++I NPTH+A+AL Y   +N APV++AKG + +A
Sbjct: 237 QIKGKIREKQRQMASRRMMQNVPNADVVIRNPTHFAVALGYDSGKNRAPVVLAKGADHLA 296

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
            K+ ++A    + I E+  LAR L+  V ++  IP  +Y+ VA+++  +Y  
Sbjct: 297 LKIVEVAEASGVYIMEDRPLARGLYDTVEVDMEIPEEYYQTVAKILAFVYKL 348


>gi|330964680|gb|EGH64940.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 369

 Score =  345 bits (886), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 101/353 (28%), Positives = 187/353 (52%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+   +KTE P+ KK++D+  EG    S+E +    +L     LL F + GI  + S
Sbjct: 1   MAENENGQDKTEDPTEKKVKDSRAEGQIARSKELTTLVVMLMGAGGLLMFGA-GIAQMMS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           +L     + ++  + D S++   L    L A  +++P L+  +   +   ++    + + 
Sbjct: 60  ELMRDNFTISRETIMDQSYMGKALLSSGLHALVVMLPFLIAMLAAALVGPILLGGWLFST 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++    +KR++S + LV  +KSF K +++  +  + L++    ++      
Sbjct: 120 KSLMPKFSRMNPAARLKRMFSPHALVELLKSFGKFLIILAVALVVLSKERNDLVAIAHEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V      +   +  +   D+ +  ++ + KL M+KQE++DE K S G+P
Sbjct: 180 LEQAMIHSLLVVGWSSFWMACGLMFIAAADVPFVLYEAHKKLLMTKQEVRDEHKNSEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R + + R   + +MM +   A +IITNPTH+A+AL+Y   +  AP+L+AKG +L+A
Sbjct: 240 EIKQRIRQLQREMSQRRMMASIPEADVIITNPTHFAVALKYDPEQGGAPMLLAKGTDLVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+I   + I I E  +LARS++    ++  IP   Y AVAQ++  +Y  +
Sbjct: 300 LKIREIGAHNQILILESAALARSIYYSTELDQEIPAGLYLAVAQVLAYVYQIR 352


>gi|330961236|gb|EGH61496.1| flagellar biosynthesis protein FlhB [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 378

 Score =  345 bits (885), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 101/353 (28%), Positives = 184/353 (52%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+   +KTE P+ KK++D+  +G    S+E +    +L     LL F S     +++
Sbjct: 1   MAENENGQDKTEDPTEKKVKDSRADGQIARSKELTTLVVMLMGSGGLLIFGSDIAEMMSA 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +     + T+  L D S++   L    L A  +V+P L+  ++  +   ++    +   
Sbjct: 61  LMRDNF-TITRETLMDQSYMGKALLSSGLHALVVVLPFLIAMLLAALVGPILLGGWLFTA 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++   G+KR+++ + LV  +KS  K +++  +    L      ++      
Sbjct: 120 KPLMPKFSRMNPAAGLKRMFAPSALVELLKSLGKFLIILAVALAVLNSERKDLIAIAHEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V      +   +A +  +D+ +  +Q + KL M+KQE++DE K S GNP
Sbjct: 180 LEQAMIHSLIVVGWSSFWMACGLAFIAAVDVPFMLYQAHKKLLMTKQEVRDEHKNSDGNP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM +   A +IITNPTH+A+AL+Y   +  AP+L+AKG +L+A
Sbjct: 240 EVKQRIRQLQREMSQRRMMASIPEADVIITNPTHFAVALKYDPEQGGAPMLLAKGSDLVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+I   + I I E  +LARS++    ++  IP   Y AVAQ++  +Y  +
Sbjct: 300 LKIREIGAHNQILILESAALARSIYYSTELDQEIPAGLYLAVAQVLAYVYQIR 352


>gi|254501745|ref|ZP_05113896.1| flagellar biosynthetic protein FlhB [Labrenzia alexandrii DFL-11]
 gi|222437816|gb|EEE44495.1| flagellar biosynthetic protein FlhB [Labrenzia alexandrii DFL-11]
          Length = 359

 Score =  345 bits (885), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 113/353 (32%), Positives = 192/353 (54%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++      KTE P+ K+++DA ++G+ P S+E S + ++    + +         S+ +
Sbjct: 1   MADETDDSEKTEDPTQKRLKDAHDKGDVPKSQEVSTWFTLAGATLMIAIMAPGAAASLGN 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   +  A Q  + D   +  L      S + +V   LL  ++  +   LIQ  P+L  
Sbjct: 61  LLKGYIEHAHQIPV-DGYALKALWRDTGQSVALIVGLPLLALVVMAVFGNLIQHQPLLTA 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +KP   +VS   G KR++S  +LVNF K  VKI++VG ++   L  +       I A+
Sbjct: 120 ETIKPKLSKVSPLSGFKRLFSSESLVNFAKGMVKILVVGAVMVAVLWPHRDEAEIMIFAD 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
              IL  A   + +VL  IL  +  +   D  +  ++W++K KMS +E+K+E KQ+ G+P
Sbjct: 180 EMIILEEARILILQVLAAILAVMTVVAAADFVYQKNKWFNKQKMSLKEVKEEFKQTEGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + +   R R +MM A   AT+++TNPTHYA+AL+Y +    AP+ VAKG + +A
Sbjct: 240 HVKGKIRQLRMERSRKRMMSAVPAATVVVTNPTHYAVALQYEEG-MGAPLCVAKGTDALA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R +A EH +P+ E P LAR+L+  V I   +P   +KAVA++I  ++  +
Sbjct: 299 LRIRDVAKEHEVPVIENPPLARALYASVEIEQEVPEEHFKAVAEVIGFVFRMR 351


>gi|121533743|ref|ZP_01665570.1| flagellar biosynthetic protein FlhB [Thermosinus carboxydivorans
           Nor1]
 gi|121307734|gb|EAX48649.1| flagellar biosynthetic protein FlhB [Thermosinus carboxydivorans
           Nor1]
          Length = 376

 Score =  345 bits (885), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 95/346 (27%), Positives = 174/346 (50%), Gaps = 2/346 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE  + K+ E+A  +G    S E      +LA    +    +     + S +  L +
Sbjct: 29  QEKTEEATPKRREEARKKGQVAKSVELGSALCLLAAFFTIKLTGTYIYEQLASYMQFLFS 88

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
             T+  +  I+        L+L   ++V+P +L+ +   +    +Q     ++  +KP  
Sbjct: 89  RFTKEDM-TIASSYRFFLDLALIFLKIVLPIMLVILAVSLLVNFMQVGFTFSVEPLKPQL 147

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
            R++   G++R++S  +LV  +KS  K+ ++   I   + E    +           L  
Sbjct: 148 SRINPLAGMQRLFSKRSLVELVKSLFKVAIISYFIYQFIIEETLNIALLSRLALRDSLAV 207

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
                  +   I + I  L +LD  + + +    LKM+KQE+K+E KQ+ GNP IK++ K
Sbjct: 208 IAALTFDLAFRIGVVILVLAILDYYYQWWEHNQNLKMTKQEVKEEFKQTEGNPQIKSKIK 267

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              R+    +MM+   +A +++TNPTH+A+AL Y      AP+++AKGQ+ +A++++ +A
Sbjct: 268 ERQRALAMRRMMQEVPKADVVVTNPTHFAIALLYE-KTMTAPMVIAKGQDFMAERIKLVA 326

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            E+ + I E  +LAR+L+  V I   +PP  YKAVA+++  +Y  K
Sbjct: 327 KENGVAIVENKALARALYDTVEIGETVPPELYKAVAEVLAYVYRLK 372


>gi|225375342|ref|ZP_03752563.1| hypothetical protein ROSEINA2194_00967 [Roseburia inulinivorans DSM
           16841]
 gi|225212831|gb|EEG95185.1| hypothetical protein ROSEINA2194_00967 [Roseburia inulinivorans DSM
           16841]
          Length = 367

 Score =  345 bits (885), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 90/357 (25%), Positives = 174/357 (48%), Gaps = 5/357 (1%)

Query: 2   SENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSD 61
           +++     KTE  ++KK+ +A  +G    S+E +    ++   + L  F S     + + 
Sbjct: 9   AKDGPGGEKTEPATAKKLREAREDGKVVKSKELTAAFDLIILFLVLKIFVSFVGNRLMNS 68

Query: 62  LHVLLASATQRKLEDI-----SHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIP 116
              +         E+        +  L++   +    + +P      +      +IQ   
Sbjct: 69  FVDIYGRIPDIVRENAVDVTEKSVAALMSDALIQILIVCVPFFAFGFVVTALISVIQVGW 128

Query: 117 VLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDF 176
            +    ++P F + +   G KRI+S +++   +KS +KI ++  +   S+  +   +   
Sbjct: 129 KVTGKPLQPKFDKFNPINGFKRIFSKDSIFELVKSILKIFVIVYVAYTSIRGHAQDIFIL 188

Query: 177 ISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQS 236
                   +      +    + I L    + + D  +  +++   +KM+KQE+KDE K +
Sbjct: 189 YEIPLMQAIMLCGTVIINAGLKISLVYLVIGLADFIYQKYRFNEDMKMTKQEVKDEFKNT 248

Query: 237 YGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQ 296
            GNP IK RQ+   R   R +MM+   +A ++ITNPTH+A+A++Y    + APV++AKG+
Sbjct: 249 EGNPEIKGRQRQRMREASRRRMMQDVPKADVVITNPTHFAVAIKYDAETSKAPVVLAKGE 308

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           + +A+K+++ A EH+I I E   LAR L+  V I   IPP  Y+AVA+++  +Y+ +
Sbjct: 309 DYLAQKIKEAAREHHIEIVENKPLARMLYANVDIGQEIPPELYQAVAEILAMVYNMR 365


>gi|15642119|ref|NP_231751.1| flagellar biosynthesis protein FlhB [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|147674451|ref|YP_001217641.1| flagellar biosynthesis protein FlhB [Vibrio cholerae O395]
 gi|153818990|ref|ZP_01971657.1| flagellar biosynthetic protein FlhB [Vibrio cholerae NCTC 8457]
 gi|153822901|ref|ZP_01975568.1| flagellar biosynthetic protein FlhB [Vibrio cholerae B33]
 gi|227082245|ref|YP_002810796.1| flagellar biosynthetic protein FlhB [Vibrio cholerae M66-2]
 gi|229507795|ref|ZP_04397300.1| flagellar biosynthesis protein FlhB [Vibrio cholerae BX 330286]
 gi|229511968|ref|ZP_04401447.1| flagellar biosynthesis protein FlhB [Vibrio cholerae B33]
 gi|229519104|ref|ZP_04408547.1| flagellar biosynthesis protein FlhB [Vibrio cholerae RC9]
 gi|229607340|ref|YP_002877988.1| flagellar biosynthesis protein FlhB [Vibrio cholerae MJ-1236]
 gi|254849205|ref|ZP_05238555.1| flagellar biosynthesis protein FlhB [Vibrio cholerae MO10]
 gi|298497858|ref|ZP_07007665.1| flagellar biosynthetic protein FlhB [Vibrio cholerae MAK 757]
 gi|9656670|gb|AAF95265.1| flagellar biosynthetic protein FlhB [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|126510485|gb|EAZ73079.1| flagellar biosynthetic protein FlhB [Vibrio cholerae NCTC 8457]
 gi|126519597|gb|EAZ76820.1| flagellar biosynthetic protein FlhB [Vibrio cholerae B33]
 gi|146316334|gb|ABQ20873.1| flagellar biosynthetic protein FlhB [Vibrio cholerae O395]
 gi|227010133|gb|ACP06345.1| flagellar biosynthetic protein FlhB [Vibrio cholerae M66-2]
 gi|227014016|gb|ACP10226.1| flagellar biosynthetic protein FlhB [Vibrio cholerae O395]
 gi|229343793|gb|EEO08768.1| flagellar biosynthesis protein FlhB [Vibrio cholerae RC9]
 gi|229351933|gb|EEO16874.1| flagellar biosynthesis protein FlhB [Vibrio cholerae B33]
 gi|229355300|gb|EEO20221.1| flagellar biosynthesis protein FlhB [Vibrio cholerae BX 330286]
 gi|229369995|gb|ACQ60418.1| flagellar biosynthesis protein FlhB [Vibrio cholerae MJ-1236]
 gi|254844910|gb|EET23324.1| flagellar biosynthesis protein FlhB [Vibrio cholerae MO10]
 gi|297542191|gb|EFH78241.1| flagellar biosynthetic protein FlhB [Vibrio cholerae MAK 757]
          Length = 376

 Score =  345 bits (885), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 87/353 (24%), Positives = 177/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+D    +TE  + ++++ A  +G    S+E +  S ++   + L++F       +  
Sbjct: 1   MAESD-GQERTEEATPRRLQQAKEKGQVARSKELASVSVLVVGAVSLMWFGEILAKGLMV 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L    ++ ++ D+  +  ++    ++    ++  L    +  +           + 
Sbjct: 60  AMQRLFE-LSREEIFDLGKLFDIIGGSLVNLLLPLLMILSTLFIAALIGAAGVGGISFSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   +++   G+KR++ + + V  +KS +K++LV  +    +  +   +       
Sbjct: 119 EAAMPKLSKMNPLSGLKRMFGMQSWVELLKSILKVLLVSGVAFYLIEASQKDLFQLSLDV 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               ++HA   +   +++I   +  +  +DI +   Q   +LKM+KQE+KDE K + G P
Sbjct: 179 YPQNIFHALDILLNFVLLISCSLLVVVAIDIPFQIWQHAEQLKMTKQEVKDEYKDTEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM A  +A +IITNP H+++ALRY Q  + APV++AKG + +A
Sbjct: 239 EVKGRIRMLQREAAQRRMMAALPQADVIITNPEHFSVALRYKQNTDKAPVVIAKGVDHMA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA E++I I   P LAR+L+    +   IP   + AVAQ++  ++  K
Sbjct: 299 LKIREIAREYDIAIVPAPPLARALYHTTELEQQIPDGLFVAVAQVLAFVFQLK 351


>gi|300914395|ref|ZP_07131711.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter sp. X561]
 gi|307724369|ref|YP_003904120.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter sp. X513]
 gi|300889330|gb|EFK84476.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter sp. X561]
 gi|307581430|gb|ADN54829.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter sp. X513]
          Length = 363

 Score =  345 bits (885), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 108/348 (31%), Positives = 184/348 (52%), Gaps = 2/348 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE  + K+ +DA  +G    SRE +    I+A  + +     P +  + +    LL 
Sbjct: 14  QEKTEPATPKRRQDARKKGQVFQSREITSALVIVAGFLAVNILTMPSLEKMMALTKYLLY 73

Query: 68  SAT--QRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           + +     + ++  I  L T++   A  + +P +LL  +  + S  +Q   V     +  
Sbjct: 74  TYSGANDDVFNVVGIRNLFTYVLQQAISIAMPIILLIFVVSLASTYLQVGFVFTAEPLAF 133

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
            F+R++  EG KRI+S   LV  +KS  K+ ++  I+   L   Y  +   +  +   IL
Sbjct: 134 KFERLNPVEGFKRIFSKRALVELVKSIAKVAVLFYIMYSFLASQYKGIPMLLDMSVQDIL 193

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
            +A   +  + I I + +  L  LD  + + ++ + LKMSK++IK+E K++ GNP IK  
Sbjct: 194 KYALNILLGITIRIGIVLIVLGALDYFFQWREYETSLKMSKEDIKEEFKETEGNPQIKAE 253

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
            +   R     +MM+   +A ++ITNPTH A+AL Y    NDAPV++AKGQ++IA +M++
Sbjct: 254 IRRKQRQVSMRRMMQDLKKADVVITNPTHLAVALMYDSNVNDAPVVIAKGQDMIALRMKE 313

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            A + NIPI E   LA++L++   I   IPP  Y+AVA+++  +Y  K
Sbjct: 314 EAKKLNIPIVENKPLAQALYRSTEIGDMIPPELYQAVAEVLAYVYSLK 361


>gi|117923329|ref|YP_863946.1| flagellar biosynthetic protein FlhB [Magnetococcus sp. MC-1]
 gi|117607085|gb|ABK42540.1| flagellar biosynthetic protein FlhB [Magnetococcus sp. MC-1]
          Length = 355

 Score =  344 bits (884), Expect = 8e-93,   Method: Composition-based stats.
 Identities = 114/353 (32%), Positives = 191/353 (54%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++ D  D+KTE P+SK++ D+ N+G    S+E      +LA L   L   +    ++  
Sbjct: 1   MADED-KDSKTEEPTSKRLSDSRNKGQVVSSKEVPTALLMLAALAVFLVQGNELWQALQR 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +H  L+      +   + +  +   +  +    + P   LF++  I S LIQ   ++  
Sbjct: 60  KMHFFLSGQISDDI-TPTGVSLIFNEIIRAVVMDLAPFFALFLVVAIISGLIQHGWLITF 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F +V+  +G+KR++S+ +LV   KS VKI ++   + +++  N   +L      
Sbjct: 119 EPLMPKFSKVNPLQGLKRLFSVRSLVEAFKSIVKIFVISFAVYLAMRNNIDQILGLADTT 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
                   F    ++L  + L    + VLD  +    +   L+MSKQEIKDE+KQ  G+P
Sbjct: 179 ITEFTTLMFKDSLEILWRVTLAFLLIAVLDFIYQKFDYIKGLRMSKQEIKDEMKQMEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           ++K R + I R   + +MM+   +A +IITNPTHYA AL+Y   +  AP LVAKG+ LIA
Sbjct: 239 LLKGRIRQIQRELAQSRMMQEVPKADVIITNPTHYACALQYTPGQMSAPKLVAKGKGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A E+NIP  E P LAR+L++ V +   IPP  +KAVA+++  ++  K
Sbjct: 299 ARIRELADENNIPRVENPPLARTLYRDVELEQFIPPELFKAVAEVLAYVFSLK 351


>gi|229524122|ref|ZP_04413527.1| flagellar biosynthesis protein FlhB [Vibrio cholerae bv. albensis
           VL426]
 gi|229337703|gb|EEO02720.1| flagellar biosynthesis protein FlhB [Vibrio cholerae bv. albensis
           VL426]
          Length = 376

 Score =  344 bits (884), Expect = 8e-93,   Method: Composition-based stats.
 Identities = 87/353 (24%), Positives = 177/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+D    +TE  + ++++ A  +G    S+E +  S ++   + L++F       +  
Sbjct: 1   MAESD-GQERTEEATPRRLQQAKEKGQVARSKELASVSVLVVGAVSLMWFGEVLAKGLMV 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L    ++ ++ D+  +  ++    ++    ++  L    +  +           + 
Sbjct: 60  AMQRLFE-LSREEIFDLGKLFDIIGGSLVNLLLPLLMILTTLFIAALIGAAGVGGISFSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   +++   G+KR++ + + V  +KS +K++LV  +    +  +   +       
Sbjct: 119 EAAMPKLSKMNPLSGLKRMFGMQSWVELLKSILKVLLVSGVAFYLIEASQKDLFQLSLDV 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               ++HA   +   +++I   +  +  +DI +   Q   +LKM+KQE+KDE K + G P
Sbjct: 179 YPQNIFHALDILLNFVLLISCSLLVVVAIDIPFQIWQHAEQLKMTKQEVKDEYKDTEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM A  +A +IITNP H+++ALRY Q  + APV++AKG + +A
Sbjct: 239 EVKGRIRMLQREAAQRRMMAALPQADVIITNPEHFSVALRYKQNTDKAPVVIAKGVDHMA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA E++I I   P LAR+L+    +   IP   + AVAQ++  ++  K
Sbjct: 299 LKIREIAREYDIAIVPAPPLARALYHTTELEQQIPDGLFVAVAQVLAFVFQLK 351


>gi|291617775|ref|YP_003520517.1| FlhB [Pantoea ananatis LMG 20103]
 gi|291152805|gb|ADD77389.1| FlhB [Pantoea ananatis LMG 20103]
          Length = 397

 Score =  344 bits (884), Expect = 8e-93,   Method: Composition-based stats.
 Identities = 100/350 (28%), Positives = 187/350 (53%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            ++ + KTE+P++ ++E A  EG  P SRE +    +LA ++ L    +   + + + + 
Sbjct: 17  ENSDEEKTESPTAHRLEKAREEGQIPRSRELTSLLMLLAGIMILWVGGAMMAHRLAAMVS 76

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L       + D   I+  + +L + A   ++P L   ++  I S ++    V++   +
Sbjct: 77  TGLR-FDHAMVTDDKIIIAHVGNLIMQAIAALLPLLGGLVLVAIASPMLLGGVVISGKSI 135

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           K  F +++   G+KR+++        K  +K ILVG +    +  ++  ML  I+ +P +
Sbjct: 136 KVDFGKLNPLSGLKRMFAAQAWTELFKGILKTILVGCVAGWYVWSHWPDMLRLIAESPTT 195

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            L H    +     +++L +  +   D+ W  +  + KL+MS+QEI+DE KQ  G+P +K
Sbjct: 196 ALIHGMDMIAICCSLVMLGLIPMVGYDVFWQLYSHFKKLRMSRQEIRDEHKQQEGDPHVK 255

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R +   R+  R +MM    +A +I+TNPTHY++AL+Y + +  AP ++AKG   IA ++
Sbjct: 256 GRIRQQMRAAARRRMMADVPKADVIVTNPTHYSVALQYNEKKMSAPKVIAKGAGDIALRI 315

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R++  EH IP+ E P LAR+L++   I   IP   Y AVA+++  ++  +
Sbjct: 316 RELGAEHRIPVLEAPPLARALYRHTEIGQHIPGALYGAVAEVLAWVWQLR 365


>gi|254505032|ref|ZP_05117183.1| flagellar biosynthetic protein FlhB [Labrenzia alexandrii DFL-11]
 gi|222441103|gb|EEE47782.1| flagellar biosynthetic protein FlhB [Labrenzia alexandrii DFL-11]
          Length = 358

 Score =  344 bits (884), Expect = 8e-93,   Method: Composition-based stats.
 Identities = 126/353 (35%), Positives = 208/353 (58%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE    D+KTE P+ KKI+DA+ +GN P+S+EA + + ++  L+   F  + G+  + S
Sbjct: 1   MSEEADKDSKTEEPTEKKIQDAIEKGNTPVSKEAPVLAMLIGALLIGGFAITSGVRQLVS 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           D+  LL  +    L + +  + L   LS+     + P + +  + G+ S  +Q  P +  
Sbjct: 61  DMAHLLDVSGGLDLGNSADALMLSHSLSIKVGLFLAPIIAILSVSGLASAFLQNKPSIVP 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           N +KP   ++SL++G  RI+     V F+K+  K   V  I+      +   +++ +  +
Sbjct: 121 NRIKPELSKLSLKKGWSRIFGAQGFVEFLKAVFKFSTVSAIVYAQFRAHESDLINAMFTD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P ++         +++  + +    L  +DI WS   W   L+M+KQE+KDE KQ  G+P
Sbjct: 181 PSALPEMILQISLRLISGVCIVTILLVTVDILWSRSHWRKNLRMTKQEVKDEHKQMEGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           I+K RQ+S+AR R R++MM A  +AT+++ NPTH+A+ALRY   +N APV+VAKGQ+LIA
Sbjct: 241 IVKARQRSLARDRARNRMMSAVPQATLVVANPTHFAVALRYDGEKNPAPVVVAKGQDLIA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA  ++IP+ E+  LARSL+    +   IPP FY+AVA++I  +Y +K
Sbjct: 301 LKIREIAETNDIPVIEDRQLARSLYAATEVERMIPPEFYRAVAEIICFVYSRK 353


>gi|256750759|ref|ZP_05491644.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|256750342|gb|EEU63361.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter ethanolicus
           CCSD1]
          Length = 363

 Score =  344 bits (884), Expect = 9e-93,   Method: Composition-based stats.
 Identities = 107/348 (30%), Positives = 183/348 (52%), Gaps = 2/348 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE  + K+ +DA  +G    SRE +    I+A  + +     P +  + +    LL 
Sbjct: 14  QEKTEPATPKRRQDARKKGQVFQSREITSALVIVAGFLAVNILTMPSLEKMMALTKYLLY 73

Query: 68  SAT--QRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           + +     + ++  I  L T++   A  +++P +LL  +  + S  +Q   V     +  
Sbjct: 74  TYSGANDDVFNVVGIRNLFTYVLQQAISIIMPIILLIFVVSLASTYLQVGFVFTTEPLAF 133

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
            F+R++  EG KRI+S   LV   KS  K+ ++  I+   L   Y  +   +  +   IL
Sbjct: 134 KFERLNPVEGFKRIFSKRALVELAKSIAKVAVLFYIMYSFLASQYKGIPMLLDMSVQDIL 193

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
            +A   +  + I I + +  L  LD  + + ++ + LKMSK++IK+E K++ GNP IK  
Sbjct: 194 KYALNILLGITIRIGIVLIVLGALDYFFQWREYETSLKMSKEDIKEEFKETEGNPQIKAE 253

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
            +   R     +MM+   +A ++ITNPTH A+AL Y    NDAPV++AKGQ++IA +M++
Sbjct: 254 IRRKQRQVSMRRMMQDLKKADVVITNPTHLAVALMYDSNVNDAPVVIAKGQDMIALRMKE 313

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            A + NIPI E   LA++L++   I   IP   Y+AVA+++  +Y  K
Sbjct: 314 EAKKLNIPIVENKPLAQALYRSTEIGDMIPSELYQAVAEVLAYVYSLK 361


>gi|194365643|ref|YP_002028253.1| flagellar biosynthesis protein FlhB [Stenotrophomonas maltophilia
           R551-3]
 gi|194348447|gb|ACF51570.1| flagellar biosynthetic protein FlhB [Stenotrophomonas maltophilia
           R551-3]
          Length = 376

 Score =  344 bits (884), Expect = 9e-93,   Method: Composition-based stats.
 Identities = 90/353 (25%), Positives = 174/353 (49%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE+++   KTE P+ K++ DA  +GN P SRE    +   A ++ ++          ++
Sbjct: 1   MSEDESAGEKTEQPTEKRLRDAREQGNLPRSRELGTAAVFGAGVLAVMAMSGSIGRGASA 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L S  Q   ++   +      L L    ++ P +L+ ++    + L+      + 
Sbjct: 61  WMKHAL-SPEQSLRQNPKELFGHFGDLLLQFMLVIAPLVLVCLLASFVAPLLMGGLRWSQ 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   R++   G+KR+Y    +  F KS +++  VG    + +   + T+   I   
Sbjct: 120 KAMLPDINRMNPMSGLKRLYGPEAIAEFTKSLLRVAFVGVAAGLVVWTGFDTLRGLIHHP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             + +        ++L+     +  L  +D  +    W  KLKM+++E++ E+K+S G+P
Sbjct: 180 LETAITDGLSFTLRLLLATAGAMLVLAAIDAPYQRWNWMRKLKMTREELRREMKESEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + +     +MMEA   A +++ NPTHYA+AL+Y     +AP +VA G +  A
Sbjct: 240 EVKGRIRQLQQQMANRRMMEAVPTADVVVVNPTHYAVALKYEGGAMNAPKVVALGVDETA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A  + + I   P LAR+L+++  +   IP   Y AVAQ++  +Y  +
Sbjct: 300 LRIREVADGNKVAIVSAPPLARALYREGQLGKEIPVRLYSAVAQVLSYVYQLR 352


>gi|331006676|ref|ZP_08329954.1| Flagellar biosynthesis protein FlhB [gamma proteobacterium
           IMCC1989]
 gi|330419508|gb|EGG93896.1| Flagellar biosynthesis protein FlhB [gamma proteobacterium
           IMCC1989]
          Length = 377

 Score =  344 bits (884), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 95/353 (26%), Positives = 180/353 (50%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE+D+   KTE  + KK E A  +G  P S+E    S +LA  I L  F      S+  
Sbjct: 1   MSESDSSQEKTEEATPKKAEKAKEDGQVPRSKELITTSVLLAGTIGLYLFGGILANSMV- 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           D+  L  + ++  + D +++   L      A   +IP   + ++  I   +     + + 
Sbjct: 60  DIAKLNFAISREAIFDPAYMFSNLGQSFYDAFLALIPIFAVLLIAAIVGPIGLGGWLFSA 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   R++   G+KR++S+  L+   K+  K++L+  +  + L      ++     +
Sbjct: 120 KSMMPKMSRMNPGAGLKRMFSVTALIELAKALAKVVLIILLSLLLLKSLEGELMSLAYQD 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            ++ + H+        I + L    + ++D+     +   KLKM+ QE+KDE+K + G P
Sbjct: 180 INASIMHSLEISMWSAIALSLVTIFIAIVDVPIQIWESAKKLKMTMQEVKDEMKDTDGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + +     +MM     A ++ITNPTHY++A++Y     + P++VAKG +L+A
Sbjct: 240 EVKGRIRQLQQEIANRQMMGEVPEADVVITNPTHYSIAVKYKPEMMETPIVVAKGVDLVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EH++ I E P LAR+++    I+  IP   Y AVA+++  ++  +
Sbjct: 300 FRIREVAKEHSVDIVESPILARAIYNTTKIDEPIPKGLYIAVAKVLAYVFQLR 352


>gi|167037650|ref|YP_001665228.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|166856484|gb|ABY94892.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
          Length = 360

 Score =  344 bits (884), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 105/348 (30%), Positives = 183/348 (52%), Gaps = 2/348 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
           + KTE  + K+ +DA  +G    SRE +    I+A  + +     P +  + +    LL 
Sbjct: 11  EEKTEPATPKRRQDARKKGQVFQSREITSALVIVAGFLAVNILTMPSLEKMMALTKYLLY 70

Query: 68  SAT--QRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           + +     + ++  I  L T++   A  +++P +LL  +  + S  +Q   V     +  
Sbjct: 71  TYSGANDDVFNVVGIRNLFTYVLQQAISIIMPIILLIFVVSLASTYLQVGFVFTTEPLAF 130

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
             +R++  EG KRI+S   LV   KS  K+ ++  I+   L   Y  +   +  +   IL
Sbjct: 131 KLERLNPVEGFKRIFSKRALVELAKSIAKVAVLFYIMYSFLASQYKGIPMLLDMSVQDIL 190

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
            +A   +  + I I + +  L  LD  + + ++ + LKMSK++IK+E K++ GNP IK  
Sbjct: 191 KYALNILLGITIRIGIVLIVLGALDYFFQWREYETSLKMSKEDIKEEFKETEGNPQIKAE 250

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
            +   R     +MM+   +A ++ITNPTH A+AL Y    NDAPV++AKGQ++IA ++++
Sbjct: 251 IRRKQRQVSMRRMMQDLKKADVVITNPTHLAVALMYDSNVNDAPVVIAKGQDMIALRIKE 310

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            A +  IPI E   LA++L++   I   IPP  Y+AVA+++  +Y  K
Sbjct: 311 EAKKLTIPIVENKPLAQALYRSTEIGDMIPPELYQAVAEVLAYVYSLK 358


>gi|71281473|ref|YP_268257.1| flagellar biosynthesis protein FlhB [Colwellia psychrerythraea 34H]
 gi|71147213|gb|AAZ27686.1| flagellar biosynthetic protein FlhB [Colwellia psychrerythraea 34H]
          Length = 376

 Score =  344 bits (884), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 91/352 (25%), Positives = 173/352 (49%), Gaps = 2/352 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++D+   KTE P++KK+ DA  +G    S++   F  ++     +L        S+ +
Sbjct: 1   MADSDSG-EKTEEPTAKKLTDARKKGQIARSKDLGTFFVLVGSACAMLLMGKALANSMAN 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  +  S ++ +  D++ +  ++          ++    + M+       +      + 
Sbjct: 60  MMSHMF-SLSREEAMDVNALFKVINDGVYQIIPPLLWIFFIVMLAAFIGNTLLGGMSFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + + P   ++S   G KR++ +   V  +KS +K  +V  +  + L+  +  +L      
Sbjct: 119 DAMMPKASKLSPMAGFKRMFGVQAAVELIKSVLKFFVVFIVAFLLLSGLFEEILGLSRET 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             +   HA   ++ + +++ L I  + V+D  +       +LKM+KQEIKDE K + G+P
Sbjct: 179 IPANFEHAITMLQWMFLVLALSIGIIVVIDAPYQVWNHNRQLKMTKQEIKDEHKGTEGSP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R +       + +MM+    + ++ITNPTH+++AL+Y      APVL AKG + +A
Sbjct: 239 EIKGRIRRTQYEMSQRRMMQDVPESDVVITNPTHFSIALKYDAAAGGAPVLSAKGVDEMA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
             +R IA EH I I + P+LARSL+    +   IP   + AVAQ++  I+  
Sbjct: 299 LHIRTIAKEHQIEIIQSPALARSLYYTAEVGDDIPEELFAAVAQVLAFIFQL 350


>gi|121727196|ref|ZP_01680363.1| flagellar biosynthetic protein FlhB [Vibrio cholerae V52]
 gi|153828614|ref|ZP_01981281.1| flagellar biosynthetic protein FlhB [Vibrio cholerae 623-39]
 gi|262191369|ref|ZP_06049559.1| flagellar biosynthesis protein FlhB [Vibrio cholerae CT 5369-93]
 gi|121630441|gb|EAX62834.1| flagellar biosynthetic protein FlhB [Vibrio cholerae V52]
 gi|148875885|gb|EDL74020.1| flagellar biosynthetic protein FlhB [Vibrio cholerae 623-39]
 gi|262032744|gb|EEY51292.1| flagellar biosynthesis protein FlhB [Vibrio cholerae CT 5369-93]
          Length = 376

 Score =  344 bits (884), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 87/353 (24%), Positives = 177/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+D    +TE  + ++++ A  +G    S+E +  S ++   + L++F       +  
Sbjct: 1   MAESD-GQERTEEATPRRLQQAKEKGQVARSKELASVSVLVVGAVSLMWFGEILAKGLMV 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L    ++ ++ D+  +  ++    ++    ++  L    +  +           + 
Sbjct: 60  AMQRLFE-LSREEIFDLGKLFDIIGGSLVNLLLPLLMILTTLFIAALIGAAGVGGISFSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   +++   G+KR++ + + V  +KS +K++LV  +    +  +   +       
Sbjct: 119 EAAMPKLSKMNPLSGLKRMFGMQSWVELLKSILKVLLVSGVAFYLIEASQKDLFQLSLDV 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               ++HA   +   +++I   +  +  +DI +   Q   +LKM+KQE+KDE K + G P
Sbjct: 179 YPQNIFHALDILLNFVLLISCSLLVVVAIDIPFQIWQHAEQLKMTKQEVKDEYKDTEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM A  +A +IITNP H+++ALRY Q  + APV++AKG + +A
Sbjct: 239 EVKGRIRMLQREAAQRRMMAALPQADVIITNPEHFSVALRYKQNTDKAPVVIAKGVDHMA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA E++I I   P LAR+L+    +   IP   + AVAQ++  ++  K
Sbjct: 299 LKIREIAREYDIAIVPAPPLARALYHTTELEQQIPDGLFVAVAQVLAFVFQLK 351


>gi|239826631|ref|YP_002949255.1| flagellar biosynthesis protein FlhB [Geobacillus sp. WCH70]
 gi|239806924|gb|ACS23989.1| flagellar biosynthetic protein FlhB [Geobacillus sp. WCH70]
          Length = 360

 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 90/346 (26%), Positives = 170/346 (49%), Gaps = 1/346 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE  + +K ++   +G    S + +    +L   + L F  +     +   ++    
Sbjct: 13  GEKTEKATPRKRQEVREKGQVAKSADINTAIVMLVVFLVLYFLGTFYKEKLLHFMYQSFE 72

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
              +  L  I  +  L      + + LV P     ++    +  +Q   +     +K  +
Sbjct: 73  QYARVDL-TIDSVHRLSITWLKNMAMLVAPIFFAAVIAACLANFLQVGFLFTTEPLKMKW 131

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
            R+   +G KR+ S+  +V  +KS +KI +VG +    L      +L   + +  + L  
Sbjct: 132 NRLDPVQGFKRMISLRAIVELLKSILKISVVGLVTFALLWFQIDHILSLTTKSISTTLSS 191

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
                 K+ +     +  L + D  +    +   ++MSKQ+IKDE K++ G+P+IK++ K
Sbjct: 192 LASLTAKMGLYASSALLFLAIFDYLYQRFDFEKNIRMSKQDIKDEYKKTEGDPLIKSKIK 251

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              R     +MM+   +A ++ITNPTHYA+AL+Y   + DAP++VAKG + +A K++++A
Sbjct: 252 QKQREMAMRRMMQEVPKADVVITNPTHYAVALKYEDGKMDAPMVVAKGVDYVALKIKQLA 311

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            EH++   E   LA++L++Q  +   IP  F+KAVA+++  +Y  K
Sbjct: 312 KEHDVVTVENRPLAQALYRQTEVGDMIPEEFFKAVAEILAYVYRLK 357


>gi|326204607|ref|ZP_08194463.1| flagellar biosynthetic protein FlhB [Clostridium papyrosolvens DSM
           2782]
 gi|325985174|gb|EGD46014.1| flagellar biosynthetic protein FlhB [Clostridium papyrosolvens DSM
           2782]
          Length = 381

 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 104/346 (30%), Positives = 178/346 (51%), Gaps = 1/346 (0%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
           +KTE  + KK  DA  +G    SRE +    ++  ++ +  F       ++  L      
Sbjct: 30  DKTEKATPKKKSDARKKGQVFQSREVTASLILIVTVVAMRIFGGTIYAQLSQYLKKTFNE 89

Query: 69  ATQR-KLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
                   D + +  L   + +  ++ V+P LL+  +  +     Q   +  +  +K   
Sbjct: 90  YLTIKDAIDFNILANLFIDVLMVLAKTVLPLLLVAFLTALIVNYAQVGILFTMETLKIKG 149

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
            R++   G KRI+S+ ++V  +KS +KII+VG +    L      +L  I  +  S+L  
Sbjct: 150 DRINPLSGFKRIFSLRSVVELLKSIIKIIIVGWVAYSYLKSKTEQVLTLIDTDLMSVLIF 209

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
                  V + I + +  L   D  +  + +   LKM+KQE+K+E KQ  GNP IK++ K
Sbjct: 210 IADAAFTVALRICMAMVLLGFADYLYQRYDYEKNLKMTKQEVKEEYKQMEGNPEIKSKIK 269

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              R     +MM+   +A +IITNPTH+A+AL+Y   ++ AP +VAKGQ+ IA ++++IA
Sbjct: 270 QKQRQMSLKRMMQDIPKADVIITNPTHFAVALKYDSEKSAAPFVVAKGQDYIALRIKQIA 329

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++ + I E   LAR+L+  V I  AIPP  Y+AVA+++  +Y+ K
Sbjct: 330 ADNKVQIVENKPLARTLYSTVDIGQAIPPDLYQAVAEILAFVYNLK 375


>gi|150390466|ref|YP_001320515.1| flagellar biosynthetic protein FlhB [Alkaliphilus metalliredigens
           QYMF]
 gi|149950328|gb|ABR48856.1| flagellar biosynthetic protein FlhB [Alkaliphilus metalliredigens
           QYMF]
          Length = 361

 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 98/346 (28%), Positives = 181/346 (52%), Gaps = 1/346 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
           + KTE P+ KK +D+  +G    S+E +    ++   + L  F S    ++ S    +  
Sbjct: 12  EEKTERPTPKKRKDSREKGQVLQSKELNSAFLLIGAFVILGLFSSYIGMTMKSFTRSIYV 71

Query: 68  SATQRK-LEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
                  L  I ++  LL +   +  +++ P  +  ++ G+    +Q   +     +   
Sbjct: 72  EYLNTDYLFSIQNLYRLLVYSLYNLLKIIAPISIASLLIGLAVSYLQVGYLFTTKTLAFK 131

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
             +++  EG K+I+S+  +V   KSF+KI LVG I+         T+ + ++ +   I+ 
Sbjct: 132 LSKLNPIEGFKKIFSLKAIVELAKSFIKIGLVGYIVFQYAQGQLETIFNTMAMDMDGIIQ 191

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
              + +  + I   + +  L   D  +  +++   LKM+KQE K+E KQS GNP IK++ 
Sbjct: 192 VLIYILVNIGIRAGVVLLVLAGFDYLYQKYEYDKNLKMTKQETKEEYKQSEGNPQIKSKI 251

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           K   R     +MM+   +A +IITNPTH+A+A++Y   +  AP ++AKGQ+++A+ ++K+
Sbjct: 252 KEKQRQMSTKRMMQEVPKADVIITNPTHFAIAIQYNPDDFQAPRVIAKGQDILAQSIKKV 311

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
             E+++PI E   LARSL+  V I + IP   Y+AVA+++  +Y  
Sbjct: 312 GLENDVPIVENKPLARSLYDTVEIGAFIPTELYQAVAEILAYVYRI 357


>gi|313672722|ref|YP_004050833.1| flagellar biosynthetic protein flhb [Calditerrivibrio nitroreducens
           DSM 19672]
 gi|312939478|gb|ADR18670.1| flagellar biosynthetic protein FlhB [Calditerrivibrio nitroreducens
           DSM 19672]
          Length = 353

 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 112/353 (31%), Positives = 194/353 (54%), Gaps = 4/353 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M +ND+   +TE  + ++ + A+ EGN P SRE S   + L  ++ L F+    +    +
Sbjct: 1   MPDNDSD--RTEEATPRRKQKAIEEGNVPRSRELSTGITFLIAVLILYFYIPSMVEEFKT 58

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           D     +    R   +      LL  +  S +++ +P L + +   I + ++Q   V + 
Sbjct: 59  DFIRYFSMYNYRI--NKESAYLLLIEVIKSMAKVTLPLLFVLVFVAILANIVQFGVVFSS 116

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++  + R++   G  R++S  +L   +KS +KI L+G    + +     T+L    A+
Sbjct: 117 KVLELKWDRLNPISGFGRLFSKKSLFELLKSILKISLIGFAAFLIIKSKIPTILTLADAD 176

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             S ++     + +V   + + I  + ++D  +   Q+Y  LKM+KQE+K+E KQ  G+P
Sbjct: 177 AVSSIHFLGKLIYEVSFKLAIIIMVIALIDFLYQRWQYYEDLKMTKQEVKEEFKQMEGDP 236

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           +IK R +S+ R   R +MME   +A ++ITNPTHYA+A++Y   ++ AP +VAKGQ LIA
Sbjct: 237 LIKQRIRSMQREMARKRMMEEVPKADVVITNPTHYAVAIKYDMAKDRAPKVVAKGQRLIA 296

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA ++N+ I E+P LAR+L+  V I   IP   YKAVA+++  +Y  K
Sbjct: 297 LKIREIASKNNVLIHEDPPLARTLYSSVEIGEEIPENLYKAVAEILAMVYRLK 349


>gi|308068671|ref|YP_003870276.1| flagellar biosynthetic protein flhB [Paenibacillus polymyxa E681]
 gi|305857950|gb|ADM69738.1| Flagellar biosynthetic protein flhB [Paenibacillus polymyxa E681]
          Length = 370

 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 93/347 (26%), Positives = 175/347 (50%), Gaps = 1/347 (0%)

Query: 7   PDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLL 66
              KTE  + KK +DA  +G    S E      +L     L+ F              + 
Sbjct: 21  SGEKTEKATPKKKQDARQKGQVAKSMELPAAGVLLVTFFCLMIFGGYFKDHAVRLFRDIF 80

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
            +    ++   +  + ++    +    ++ P  +  ++ GI +  +Q   +L    + P 
Sbjct: 81  VNRLSMEV-TPNTTMLMMGEYGVQILIMLAPIFIGAIVIGIVANYMQIGFLLTGEGITPK 139

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
           F ++   +G K I+S+ +LV F+KS +K+ ++G ++   L +    +      +   +L 
Sbjct: 140 FSKIDPIKGFKNIFSMRSLVEFLKSVLKMTVIGYLVYSVLWKTKTDLPKLAEMSGDQMLS 199

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
                  ++ + I + +  L VLD  +  ++    LKMSKQ+IKDE K+  G+P+IK + 
Sbjct: 200 FTASLTMELGLKIGVVLFVLAVLDYMYQRYEHEKNLKMSKQDIKDEYKKMEGDPLIKGKI 259

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           +   R     +MM+    A +IITNPTH+A+AL+Y  +E +AP ++AKGQ+ +A ++++I
Sbjct: 260 RERQRRMAMQRMMQEVPNADVIITNPTHFAVALKYDGSEMEAPQIIAKGQDYVALRIKEI 319

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A ++ +   E   LAR+LF++  I  AIP   ++AVA+++  +Y  K
Sbjct: 320 AKQNGVITMENKPLARALFQRAEIGDAIPADLFQAVAEVLAYVYKLK 366


>gi|121586826|ref|ZP_01676608.1| flagellar biosynthetic protein FlhB [Vibrio cholerae 2740-80]
 gi|153803039|ref|ZP_01957625.1| flagellar biosynthetic protein FlhB [Vibrio cholerae MZO-3]
 gi|153825586|ref|ZP_01978253.1| flagellar biosynthetic protein FlhB [Vibrio cholerae MZO-2]
 gi|229522073|ref|ZP_04411490.1| flagellar biosynthesis protein FlhB [Vibrio cholerae TM 11079-80]
 gi|254226357|ref|ZP_04919946.1| flagellar biosynthetic protein FlhB [Vibrio cholerae V51]
 gi|121548993|gb|EAX59032.1| flagellar biosynthetic protein FlhB [Vibrio cholerae 2740-80]
 gi|124121437|gb|EAY40180.1| flagellar biosynthetic protein FlhB [Vibrio cholerae MZO-3]
 gi|125621107|gb|EAZ49452.1| flagellar biosynthetic protein FlhB [Vibrio cholerae V51]
 gi|149740737|gb|EDM54836.1| flagellar biosynthetic protein FlhB [Vibrio cholerae MZO-2]
 gi|229340998|gb|EEO06003.1| flagellar biosynthesis protein FlhB [Vibrio cholerae TM 11079-80]
          Length = 376

 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 87/353 (24%), Positives = 177/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+D    +TE  + ++++ A  +G    S+E +  S ++   + L++F       +  
Sbjct: 1   MAESD-GQERTEEATPRRLQQAKEKGQVARSKELASVSVLVVGAVSLMWFGEILAKGLMV 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L    ++ ++ D+  +  ++    ++    ++  L    +  +           + 
Sbjct: 60  AMQRLFE-LSREEIFDLGKLFDIIGGSLVNLLLPLLMILTTLFIAALIGAAGVGGISFSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   +++   G+KR++ + + V  +KS +K++LV  +    +  +   +       
Sbjct: 119 EAAMPKLSKMNPLSGLKRMFGMQSWVELLKSILKVLLVSGVAFYLIEASQKDLFQLSLDV 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               ++HA   +   +++I   +  +  +DI +   Q   +LKM+KQE+KDE K + G P
Sbjct: 179 YPQNIFHALDILLNFVLLISCSLLVVVAIDIPFQIWQHAEQLKMTKQEVKDEYKDTEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM A  +A +IITNP H+++ALRY Q  + APV++AKG + +A
Sbjct: 239 EVKGRIRMLQREAAQRRMMAALPQADVIITNPEHFSVALRYKQNTDKAPVVIAKGVDHMA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA E++I I   P LAR+L+    +   IP   + AVAQ++  ++  K
Sbjct: 299 LKIREIAREYDIAIVPAPPLARALYHTTELEQQIPDGLFVAVAQVLAFVFQLK 351


>gi|308173601|ref|YP_003920306.1| flagellar export protein [Bacillus amyloliquefaciens DSM 7]
 gi|307606465|emb|CBI42836.1| component of the flagellar export machinery [Bacillus
           amyloliquefaciens DSM 7]
 gi|328553467|gb|AEB23959.1| flagellar biosynthesis protein FlhB [Bacillus amyloliquefaciens
           TA208]
          Length = 359

 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 107/346 (30%), Positives = 181/346 (52%), Gaps = 1/346 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE  + KK +D   +G    S + +   S+L   + L+         + S +     
Sbjct: 12  GEKTEKATPKKRKDTRKKGQVAKSTDVNTAVSLLIIFLSLIALGPYMRDRLLSFIKTFYT 71

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
            +   +L + S++  L        S ++ P +L+ ++ GI S  +Q   + +   +KP  
Sbjct: 72  KSIALELSE-SNVHELFVDTVKDISLILAPIMLVALLAGIVSNYMQVGFLFSAEVLKPDL 130

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
            ++S  +G KRIYS+  +V  +KS +KI +VG    + L  +Y  +L      P  +L  
Sbjct: 131 NKLSPLKGFKRIYSMRAIVELVKSILKITVVGFAAFMVLWLHYGDILRLPLLTPAEVLTF 190

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
                  + +     +  L  LD  +    +   ++MSKQ+IKDE K+S G+PIIK++ K
Sbjct: 191 VSKLTLWMGLAGSGALMLLAGLDYLYQRFDYEKNIRMSKQDIKDEYKKSEGDPIIKSKIK 250

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              R     +MM+   +A +IITNPTHYA+AL+Y + + DAP +VAKG + +A K+R+IA
Sbjct: 251 QKQREMAMRRMMQEVPKADVIITNPTHYAIALKYDEKKMDAPYIVAKGVDHLALKIRQIA 310

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            EH++   E   LAR+L+ QV I+ A+P  F+K +A+++  +Y  K
Sbjct: 311 KEHDVMTIENRPLARALYDQVDIDQAVPEEFFKVIAEILAYVYKTK 356


>gi|320116065|ref|YP_004186224.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
 gi|319929156|gb|ADV79841.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
          Length = 363

 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 105/348 (30%), Positives = 183/348 (52%), Gaps = 2/348 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
           + KTE  + K+ +DA  +G    SRE +    I+A  + +     P +  + +    LL 
Sbjct: 14  EEKTEPATPKRRQDARKKGQVFQSREITSALVIVAGFLAVNILTMPSLEKMMALTKYLLY 73

Query: 68  SAT--QRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           + +     + ++  I  L T++   A  +++P +LL  +  + S  +Q   V     +  
Sbjct: 74  TYSGANDDVFNVVGIRNLFTYVLQQAISIIMPIILLIFVVSLASTYLQVGFVFTTEPLAF 133

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
             +R++  EG KRI+S   LV   KS  K+ ++  I+   L   Y  +   +  +   IL
Sbjct: 134 KLERLNPVEGFKRIFSKRALVELAKSIAKVAVLFYIMYSFLASQYKGIPMLLDMSVQDIL 193

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
            +A   +  + I I + +  L  LD  + + ++ + LKMSK++IK+E K++ GNP IK  
Sbjct: 194 KYALNILLGITIRIGIVLIVLGALDYFFQWREYETSLKMSKEDIKEEFKETEGNPQIKAE 253

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
            +   R     +MM+   +A ++ITNPTH A+AL Y    NDAPV++AKGQ++IA ++++
Sbjct: 254 IRRKQRQVSMRRMMQDLKKADVVITNPTHLAVALMYDSNVNDAPVVIAKGQDMIALRIKE 313

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            A +  IPI E   LA++L++   I   IPP  Y+AVA+++  +Y  K
Sbjct: 314 EAKKLTIPIVENKPLAQALYRSTEIGDMIPPELYQAVAEVLAYVYSLK 361


>gi|222084854|ref|YP_002543383.1| flagellar biosynthesis transmembrane protein [Agrobacterium
           radiobacter K84]
 gi|221722302|gb|ACM25458.1| flagellar biosynthesis transmembrane protein [Agrobacterium
           radiobacter K84]
          Length = 358

 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 159/350 (45%), Positives = 237/350 (67%), Gaps = 1/350 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++ D  D+KTE P+ KK+ D + +GN P SREA++F+S+LA +IY+ FF    +  +  
Sbjct: 1   MADED-KDSKTEKPTEKKLRDTMEKGNVPHSREATIFASMLATVIYVTFFLPERMGRMGE 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  L     Q KLE     + L T +      LV+P ++LF +FGIGS + Q +P   L
Sbjct: 60  VLRDLFEKPDQWKLETGPDALSLFTRIGWEVGNLVLPAIVLFFIFGIGSSMFQNLPTPVL 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + ++P F R+S   G  RI+S + LV F KS  KI++V  I+   L   +F  +D ++++
Sbjct: 120 DRIQPKFSRISPVSGWNRIFSTSGLVEFGKSLAKIVVVSIIMFFVLRGQFFHAIDSLASD 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P +I       V+++L+++LL  A + + D+ WS H W+ +LKM+KQEIKDE KQS G+P
Sbjct: 180 PQTIFVRLSTIVQRILMIVLLATAVVGIADVLWSRHHWFDQLKMTKQEIKDEFKQSQGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           I+K+RQ+S+AR R R +M++   RAT++I NPTH+A+ALRY++ E DAPV+VAKGQ+LIA
Sbjct: 240 IVKSRQRSVARDRARRRMIKQVPRATLVIANPTHFAVALRYVREEGDAPVVVAKGQDLIA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
            K+R+IA  + IP+FE+P LARS+F QV ++S IP VFYKAVA+LI++IY
Sbjct: 300 LKIREIAEANGIPVFEDPPLARSMFAQVSVDSVIPSVFYKAVAELIHRIY 349


>gi|154686055|ref|YP_001421216.1| flagellar biosynthesis protein FlhB [Bacillus amyloliquefaciens
           FZB42]
 gi|154351906|gb|ABS73985.1| FlhB [Bacillus amyloliquefaciens FZB42]
          Length = 359

 Score =  344 bits (882), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 106/346 (30%), Positives = 178/346 (51%), Gaps = 1/346 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE  + KK +D   +G    S + +   S+L   + L+         + S +     
Sbjct: 12  GEKTEKATPKKRKDTRKKGQVAKSTDVNTAVSLLIIFLSLIALGPYMRDRLLSFIKTFYT 71

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
            +    L   S +  L        S ++ P +L+ ++ G+ S  +Q   + +   +KP  
Sbjct: 72  KSISLHL-SASAVHELFVDTVKDISLILAPIMLVALVAGVVSNYMQVGFLFSAEVLKPDL 130

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
            ++S  +G KRIYS+  +V  +KS +KI +VG    + L  +Y  +L      P  +L  
Sbjct: 131 NKLSPLKGFKRIYSMRAIVELVKSILKITVVGFAAFMVLWLHYGDILRLPLLTPAEVLTF 190

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
                  + +     +  L  LD  +    +   ++MSKQ+IKDE K+S G+PIIK++ K
Sbjct: 191 VSKLTLWMGLAGSGALMLLAGLDYLYQRFDYEKNIRMSKQDIKDEYKKSEGDPIIKSKIK 250

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              R     +MM+   +A +IITNPTHYA+AL+Y + + DAP +VAKG + +A K+R+IA
Sbjct: 251 QKQREMAMRRMMQEVPKADVIITNPTHYAIALKYDEKKMDAPYIVAKGVDHLALKIRQIA 310

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            EH++   E   LAR+L+ QV I+ A+P  F+K +A+++  +Y  K
Sbjct: 311 KEHDVMTIENRPLARALYDQVDIDQAVPEEFFKVIAEILAYVYKTK 356


>gi|284007183|emb|CBA72471.1| flagellar biosynthesis protein FlhB [Arsenophonus nasoniae]
          Length = 383

 Score =  344 bits (882), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 101/353 (28%), Positives = 169/353 (47%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  +   K E P+++K E A  EG    SRE S F  ++A  + L +      Y    
Sbjct: 1   MAEE-SDLEKNEEPTARKKEKAKEEGQVVRSRELSSFFMLIAG-VSLFWICGHSCYQKLH 58

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L        +  L +   +  L+          ++P +   ++    +        +N 
Sbjct: 59  ALFSQTFYFDKYILYNSQLLPNLVFESVKIGLNALLPIIAGLVLIAFAAPSFFGGIHINF 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K  +K+++   G+KR++SIN L    K+ +K++LV   IT+ L  N       ++  
Sbjct: 119 KSIKFDWKKLNPITGLKRLFSINALAELFKALLKVMLVSIGITLFLWVNLPHFFHLVTEP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            H  L  A   +     + +  +  L   D+ +       KL+M++QEIKDE KQ  G+P
Sbjct: 179 RHLALSQATQLMIFAAYIAIFMLIPLVGFDLIYQLRSHLKKLRMTRQEIKDEFKQQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R +   R   R +MM    +A +IITNPTHYA+AL+Y      AP ++ KG  LIA
Sbjct: 239 HIKARIRQQQREISRRRMMADVPKADVIITNPTHYAVALQYDNQAMQAPKVLVKGAGLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
             ++++  E+ IP+ E P LAR+L++   +   IP   Y AVA+++  +Y  +
Sbjct: 299 LNIKQLGEENRIPVLEAPPLARALYRHSKVGGHIPATLYAAVAEVLAWVYQLR 351


>gi|167571643|ref|ZP_02364517.1| flagellar biosynthesis protein FlhB [Burkholderia oklahomensis
           C6786]
          Length = 400

 Score =  344 bits (882), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 103/353 (29%), Positives = 178/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   +TEA + K+ E A  EG    SRE + F+ + A          P    + +
Sbjct: 1   MAE-DSDLERTEAATPKRREKAREEGQVARSRELASFALLSAGFYGAWLLSGPISEHLRT 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            LH    S  +    D   ++     LSL     + P L L  +  + + +     +++ 
Sbjct: 60  MLHAAF-SFDRATAFDTHRMLSHAGSLSLEGLYALAPLLALTGVAALAAPMALGGWLVST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
              +  F+R++   G+ RI+SI   +    S  K ++VG I   ++  +   +L   +  
Sbjct: 119 KTFELKFERLNPITGLGRIFSIQGPIQLGMSIAKTLVVGGIGGAAIWRSKDELLGLATQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            H+ L  A   V     M +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P
Sbjct: 179 LHAALADALHLVAVCCGMTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEVKREHRENEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM     A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A
Sbjct: 239 HVKGRIRQQQRAMARRRMMANVPTADVVVTNPTHFAVALKYTDGEMRAPKVVAKGVNLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R +A EH++P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 299 GRIRALAAEHHVPLLEAPPLARALYHNVDLEREIPGTLYSAVAEVLAWVYQLK 351


>gi|27380920|ref|NP_772449.1| flagellar biosynthesis protein FlhB [Bradyrhizobium japonicum USDA
           110]
 gi|27354086|dbj|BAC51074.1| flagellar biosynthetic protein [Bradyrhizobium japonicum USDA 110]
          Length = 359

 Score =  344 bits (882), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 109/353 (30%), Positives = 193/353 (54%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E++ P+++TE P+ K++++AL  G+   S+E + +  I    + +  F       + +
Sbjct: 1   MAEDNDPESQTEDPTQKRLDEALERGDVAKSQEINTWFMIAGGTLVVSTFSGSVGSGLVT 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  LLA++   K  D   ++ LL  +  +    +   LL+ ++  +   ++Q   V + 
Sbjct: 61  PMRNLLANSWMIK-TDGRALLALLQQIEFAVLAAIGVPLLMLVLAAVAGNMLQHRLVWSA 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +KP F ++S   G KRI+      NF+K   K+I++G ++   L      M   +  +
Sbjct: 120 ESLKPKFSKLSPAAGFKRIFGKQAAANFLKGLGKLIVLGVVMGTILWPERHRMEAMVRLD 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P ++L         +L  ++  +A + + D  + Y  W+ + KMS QEIK+E KQS G+P
Sbjct: 180 PAAMLGATTSLTIHLLGAVVAALAIIAIGDYFFQYRSWFQRQKMSLQEIKEEFKQSEGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK + + + + R + +MM A  +A++IITNPTH+++AL Y +    AP+ VAKG + +A
Sbjct: 240 HIKGKIRQLRQQRAKKRMMAAVPKASVIITNPTHFSVALSYERG-MQAPICVAKGVDNLA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA EH+IPI E   LAR+L+  V I+  IP   Y AVA++I  +   K
Sbjct: 299 FKIREIAREHDIPIVENVPLARALYATVEIDQEIPTEHYHAVAEVIGYVMRLK 351


>gi|331269330|ref|YP_004395822.1| flagellar biosynthetic protein FlhB [Clostridium botulinum
           BKT015925]
 gi|329125880|gb|AEB75825.1| flagellar biosynthetic protein FlhB [Clostridium botulinum
           BKT015925]
          Length = 594

 Score =  343 bits (881), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 101/347 (29%), Positives = 183/347 (52%), Gaps = 1/347 (0%)

Query: 7   PDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLL 66
            D+KTE  +  K+ +A  +G  P S+E S    +L   I LL        S   D+    
Sbjct: 246 SDDKTEEATPHKLSEARKKGQVPKSKEVSSAIILLTSTIILLTLGEYVANSFKKDIIEFF 305

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
            +    +L ++S ++ ++  +      + +P ++  M+ GIG+ L+Q   + +   +KP 
Sbjct: 306 TNYLNIEL-NVSSLISIIVTILWRFMIVFLPVVVPLMVMGIGANLLQTGYINSKEPLKPQ 364

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
             +++   G K+++S+  ++  +K    I ++G +    L  N+  +L   +     I+ 
Sbjct: 365 LSKINPISGFKKMFSMRTVMELLKDIAVITIIGFVGYGFLKSNFRKVLSMTTLRFPVIIT 424

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
                   +   + L +  + + D  +   Q+   +KMSKQE+K+E KQ  G+P +K + 
Sbjct: 425 SFLKLTTNIFFRVSLVMIAIALTDFIYQKFQFKRDMKMSKQEVKEEFKQMEGDPQVKGKI 484

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           K   R     +MM+    A+++ITNPTH A+AL+Y   E++AP+LVAKG + IA K+++I
Sbjct: 485 KQKQREMAMGRMMQNVPDASVVITNPTHIAVALKYEDGEDNAPMLVAKGSDYIAIKIKQI 544

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A E+++PI E   LAR +FK+V I + IP   Y+AVA+++  +Y  K
Sbjct: 545 AKENDVPIIENKPLARLIFKEVEIENEIPSDMYQAVAEILALVYKLK 591


>gi|253681513|ref|ZP_04862310.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           botulinum D str. 1873]
 gi|253561225|gb|EES90677.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           botulinum D str. 1873]
          Length = 610

 Score =  343 bits (881), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 99/347 (28%), Positives = 180/347 (51%), Gaps = 1/347 (0%)

Query: 7   PDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLL 66
            D+KTE  +  K+ +A  +G  P S+E +    +L   I LL        S   D+    
Sbjct: 262 SDDKTEEATPHKLSEARKKGQVPKSKEVNSAIILLTSTIILLTLGEYVANSFKKDIIEFF 321

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
            +    +L   S ++ ++  +      + +P ++  M+ GIG+ L+Q   + +   +KP 
Sbjct: 322 TNYLNIELNS-SSLISIIVTVLWRFMIVFLPVVVPLMIMGIGANLLQTGYINSKEPLKPQ 380

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
             +++   G K+++S+  ++  +K    I ++G      L  N+  +L   +     I+ 
Sbjct: 381 LSKINPISGFKKMFSMRTVMELLKDIAVITIIGFAGYGFLKSNFKKVLSMTNLRFPVIIT 440

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
                   +   + L +  + + D  +   Q+   ++MSKQE+K+E KQ  G+P IK + 
Sbjct: 441 SFLKLTTNIFFRVSLIMFAIALTDFIYQKFQFKKDMRMSKQEVKEEFKQMEGDPQIKGKI 500

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           K   R     +MM+    A+++ITNPTH A+AL+Y   +++AP+LVAKG + IA K+++I
Sbjct: 501 KQKQREMAMGRMMQNVPDASVVITNPTHIAVALKYEDGQDNAPMLVAKGSDYIAIKIKQI 560

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A E+++PI E   LAR +FK+V I + IP   Y+AVA+++  +Y  K
Sbjct: 561 AKENDVPIIENKPLARLIFKEVEIENEIPSDMYQAVAEILALVYKLK 607


>gi|119503678|ref|ZP_01625761.1| flagellar biosynthetic protein FlhB [marine gamma proteobacterium
           HTCC2080]
 gi|119460740|gb|EAW41832.1| flagellar biosynthetic protein FlhB [marine gamma proteobacterium
           HTCC2080]
          Length = 384

 Score =  343 bits (881), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 96/353 (27%), Positives = 176/353 (49%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E      +TE P++K+++ A  +G    SRE +    +L C + L       + +VT 
Sbjct: 1   MAEEQTGQERTEEPTAKRLQQAREKGQVARSRELNTLLMLLPCAVALWLTGEFAMDAVTR 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
                L +     ++  S +   L    +S   +++P L L +   +    +    + +L
Sbjct: 61  LFTGAL-TPPSEAMKVTSEVAPFLGATLMSGLEMIVPFLALTVFVALLGPSVMGGLIFSL 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   ++   +G  RI+S  +L+  +KS +K  LV  +  + L      ++  IS  
Sbjct: 120 KSMSPGLDKIDPIKGFGRIFSRKSLLELVKSLLKFFLVSGVAVLVLLSFEREVMGLISLP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               +  A   +   LI +   +  +  +D+ +       KL+M+KQE+KDE+K++ GNP
Sbjct: 180 VGEGIAQAGRMIMLTLIFLSASLILVVAIDVPFQLWDHTRKLRMTKQEVKDEMKETDGNP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + +   R     +M+     A ++ITNPTH+++AL+Y Q  N AP ++AKG + +A
Sbjct: 240 EMKGKIRQKQREIADRRMLADVPTADVVITNPTHFSVALKYDQEGNTAPRVLAKGADHMA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R IA  H+I I+EEP LAR+LF        IP   + AVA+++  ++H +
Sbjct: 300 MQIRHIARAHDIVIYEEPPLARALFASTEAGDEIPGNLFLAVARVLAYVFHLR 352


>gi|328911742|gb|AEB63338.1| component of the flagellar export machinery [Bacillus
           amyloliquefaciens LL3]
          Length = 360

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 107/346 (30%), Positives = 181/346 (52%), Gaps = 1/346 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE  + KK +D   +G    S + +   S+L   + L+         + S +     
Sbjct: 13  GEKTEKATPKKRKDTRKKGQVAKSTDVNTAVSLLIIFLSLIALGPYMRDRLLSFIKTFYT 72

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
            +   +L + S++  L        S ++ P +L+ ++ GI S  +Q   + +   +KP  
Sbjct: 73  KSIALELSE-SNVHELFVDTVKDISLILAPIMLVALLAGIVSNYMQVGFLFSAEVLKPDL 131

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
            ++S  +G KRIYS+  +V  +KS +KI +VG    + L  +Y  +L      P  +L  
Sbjct: 132 NKLSPLKGFKRIYSMRAIVELVKSILKITVVGFAAFMVLWLHYGDILRLPLLTPAEVLTF 191

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
                  + +     +  L  LD  +    +   ++MSKQ+IKDE K+S G+PIIK++ K
Sbjct: 192 VSKLTLWMGLAGSGALMLLAGLDYLYQRFDYEKNIRMSKQDIKDEYKKSEGDPIIKSKIK 251

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              R     +MM+   +A +IITNPTHYA+AL+Y + + DAP +VAKG + +A K+R+IA
Sbjct: 252 QKQREMAMRRMMQEVPKADVIITNPTHYAIALKYDEKKMDAPYIVAKGVDHLALKIRQIA 311

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            EH++   E   LAR+L+ QV I+ A+P  F+K +A+++  +Y  K
Sbjct: 312 KEHDVMTIENRPLARALYDQVDIDQAVPEEFFKVIAEILAYVYKTK 357


>gi|152980271|ref|YP_001353777.1| FlhB flagellar biosynthetic protein [Janthinobacterium sp.
           Marseille]
 gi|151280348|gb|ABR88758.1| FlhB flagellar biosynthetic protein [Janthinobacterium sp.
           Marseille]
          Length = 402

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 91/350 (26%), Positives = 166/350 (47%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
            ++   KTE  S +K+E A  +G+ P SRE +  + +L             +  +   L 
Sbjct: 15  EESDLEKTEPASPRKLEQAREQGDVPRSRELATCTLLLGAGAAFWILGGRMVGELNKMLA 74

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
             L S  +    D+  ++       +       P  L+ ++  + S  +    + +   +
Sbjct: 75  AGL-SFDREMAFDMELLLAHAAASIIDLLIAFAPAALILIVVALISPALIGGWLFSGKAL 133

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P+F R++  +G+  + S    V   K+  K IL+G I  + +   +  ++        S
Sbjct: 134 QPNFGRMNPIKGLGNMVSSRAAVELGKAIAKTILIGWIAWMVMRHEFDAVMALSVEPLKS 193

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
              H    +    I I   +  +  +D  +   Q   KL MS+Q+++ E K+S GNP IK
Sbjct: 194 GTEHLGHLLVFSFIFIAAGLVIVAAIDAPYQMWQHAKKLMMSRQDVRQESKESEGNPEIK 253

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            + +   R   R +MM     A +++TNPTHYA+AL+Y +    AP +VAKG + +A K+
Sbjct: 254 AKIRQQQREMARRRMMAEVPTADVVVTNPTHYAVALKYSENGMRAPRVVAKGADEVAAKI 313

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           R++A E+N+ + E P LAR+LF+   +   IP   Y AVA+++  ++  +
Sbjct: 314 RELAMENNVVLLEAPPLARALFRHAELGDEIPEALYIAVAEVLAYVFQLR 363


>gi|297582018|ref|ZP_06943937.1| flagellar biosynthetic protein FlhB [Vibrio cholerae RC385]
 gi|297533713|gb|EFH72555.1| flagellar biosynthetic protein FlhB [Vibrio cholerae RC385]
          Length = 376

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 87/353 (24%), Positives = 177/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+D    +TE  + ++++ A  +G    S+E +  S ++   + L++F       +  
Sbjct: 1   MAESD-GQERTEEATPRRLQQAKEKGQVARSKELASVSVLVVGAVSLMWFGEILAKGLMV 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L    ++ ++ D+  +  ++    ++    ++  L    +  +           + 
Sbjct: 60  AMQRLFE-LSREEIFDLGKLFDIIGGSLVNLLLPLLMILTTLFIAALIGAAGVGGISFSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   +++   G+KR++ + + V  +KS +K++LV  +    +  +   +       
Sbjct: 119 EAAMPKLSKMNPLSGLKRMFGMQSWVELLKSILKVLLVSGVAFYLIEASQKDLFQLSLDV 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               ++HA   +   +++I   +  +  +DI +   Q   +LKM+KQE+KDE K + G P
Sbjct: 179 YPQNIFHALDILLNFVLLISCSLLVVVAIDIPFQIWQHAEQLKMTKQEVKDEYKDTEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM A  +A +IITNP H+++ALRY Q  + APV++AKG + +A
Sbjct: 239 EVKGRIRMLQREAAQRRMMAALPQADVIITNPEHFSVALRYKQNTDKAPVVIAKGVDHMA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA E++I I   P LAR+L+    +   IP   + AVAQ++  ++  K
Sbjct: 299 LKIREIAREYDIAIVPAPPLARALYNTTELEQQIPDGLFVAVAQVLAFVFQLK 351


>gi|304438443|ref|ZP_07398383.1| flagellar biosynthetic protein FlhB [Selenomonas sp. oral taxon 149
           str. 67H29BP]
 gi|304368526|gb|EFM22211.1| flagellar biosynthetic protein FlhB [Selenomonas sp. oral taxon 149
           str. 67H29BP]
          Length = 374

 Score =  343 bits (880), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 104/347 (29%), Positives = 179/347 (51%), Gaps = 3/347 (0%)

Query: 7   PDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLL 66
              KTE P++KK  DA  +G    S+E +    +L     L   +     S+ S    + 
Sbjct: 25  GGEKTEEPTAKKRADARKKGQVGRSQELNTAFVLLVGFFTLKLLWDSIYLSIASYTTYVF 84

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
            +  Q    D  +I+ +   + +  ++   P +   M+ G+     Q     N   ++  
Sbjct: 85  TNLNQSV--DTENIIHIFIGIIVVLAKTAFPVMFAIMLIGLAINFFQVGLTFNTESIEFK 142

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
             +++   G  RI+S  +LV   KSF KI+++G  +   + E    M  F+  +  + L 
Sbjct: 143 LDKLNPINGFGRIFSKRSLVELAKSFFKILVIGFFLYRFIHEQILAMPQFMFFDLTTSLA 202

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
                + ++  +++  I  + ++D G+   Q    LKM+KQE+KDE+KQS G+P IK + 
Sbjct: 203 LVAEIIFQMAFIVIGVIMIMALMDYGYQKWQTTQDLKMTKQEVKDEMKQSEGDPQIKGKI 262

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           +   R     +MM+   +A +I+TNPTHYA+AL Y Q    AP++VAKGQ+L+A+++++I
Sbjct: 263 RQKQRQMAMARMMKEVPKADVIVTNPTHYAIALSYQQG-MSAPLVVAKGQDLVAQRIKEI 321

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A E  +PI E   LAR+++  V I  AIP   Y+AVA+++  +Y  K
Sbjct: 322 AREARVPIIENKPLARAIYAAVQIGDAIPQELYQAVAEVLAYVYRLK 368


>gi|300113616|ref|YP_003760191.1| flagellar biosynthetic protein FlhB [Nitrosococcus watsonii C-113]
 gi|299539553|gb|ADJ27870.1| flagellar biosynthetic protein FlhB [Nitrosococcus watsonii C-113]
          Length = 377

 Score =  343 bits (880), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 83/353 (23%), Positives = 180/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++ +   +TE P++K+ EDA  +G  P SRE S    +L+  + L+      +  +  
Sbjct: 1   MADS-SAQERTEQPTAKRQEDARKKGQVPRSRELSTTVLLLSSALGLVLVGESLLQGLAD 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L    + ++ +   ++         A +++ P L L ++  + + L+     ++ 
Sbjct: 60  LMRQGL-QLERAQIFEPKAVILQFQWGVGEAVKIITPFLALTLIAALAAPLLMGGWSVSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +   +++++  +G+KRI+     +  +K+ +K +L+  +  +        ++      
Sbjct: 119 QSLGFKWEKLNPAKGMKRIFGPQGGMELLKALIKFLLLSGVACLLFWLFSSDLMALGRQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               ++     +   L+ +   +A + V+D  +       +LKM++QE+K+E K++ GNP
Sbjct: 179 FVPAVFQLAHLMGWSLVGLSASLALIAVIDAPFQSWNHIRQLKMTRQEVKEEHKETDGNP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R     +MM A  +A +++ NPTHYA+AL Y Q +  AP +VAKG + +A
Sbjct: 239 ELKGRIRRVQREIASRRMMAAVPQADVVVVNPTHYAVALNYEQDKQGAPRVVAKGVDQVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R +A  +N+P+   P+L+R+++    ++  IP   Y+AVAQ++  +   +
Sbjct: 299 LKIRTVAAGNNVPVLSAPALSRAIYHSTELDQEIPAGLYRAVAQVLAYVLQLR 351


>gi|325981881|ref|YP_004294283.1| flagellar biosynthetic protein FlhB [Nitrosomonas sp. AL212]
 gi|325531400|gb|ADZ26121.1| flagellar biosynthetic protein FlhB [Nitrosomonas sp. AL212]
          Length = 379

 Score =  343 bits (880), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 93/353 (26%), Positives = 188/353 (53%), Gaps = 3/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE  +   +TE  + +++E A  EG    S+E + F+ ++A  + +L   S  +  +  
Sbjct: 1   MSEE-SDLERTEEATPRRLEKAREEGQVVRSQELTSFTLLMAAAVGILMLGSALMEKLVK 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   +    +        ++      ++     + P L L ++    + ++    +++ 
Sbjct: 60  IMQSGM-QLDRELAFQSELMINRFYEFAIEGLISMAPLLFLLLVVAFFAPMLLSGWLVSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             V P FKR+   +G  RI+S+ +L+  +K+ +K IL+G +  + +  N  +++  ++ +
Sbjct: 119 KAVIPDFKRIDPIKGFGRIFSMRSLIELVKAILKTILIGGVAALVIWHNKDSVMALLTVS 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               +      +    ++I+  +  +  +D+ +   +   +L+M+K++++ E K+S G+P
Sbjct: 179 IDLGISRTGDFLAMSFLLIISAMIIIVAVDVPFQIWEHAKQLRMTKEDVRKEYKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +++ R   R +MM    +A +I+TNPTHYA+ALRY Q+   AP +VAKG +L+A
Sbjct: 239 YVKARIRNLQREAARRRMMSEIPKADVIVTNPTHYAVALRY-QSNMRAPKVVAKGVHLLA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+IA EH IPI E P LAR+L+    + S IP   Y AVA+++  ++  +
Sbjct: 298 ARIREIATEHRIPILEAPPLARALYHHTELESEIPEKLYTAVAEVLAYVFQLR 350


>gi|332994108|gb|AEF04163.1| flagellar biosynthesis protein [Alteromonas sp. SN2]
          Length = 376

 Score =  343 bits (879), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 95/353 (26%), Positives = 179/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++D+   KTE P+ KK+ED   +G    SRE S    ++      LF       SV  
Sbjct: 1   MADSDSS-EKTEDPTGKKLEDTRKKGQIARSRELSTTLVLVVSAFMFLFVGGWIAESVFK 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
               +    ++ +  D +H+         + S  V+  + + M+ GI   +         
Sbjct: 60  LTQRMFV-LSRDETYDTTHMFGAWGEAISTVSVPVLLYMTVAMLAGIYGSIALGGYNFTW 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
              K    ++S   G KR++ +N LV  +KS  K++++  +   +L       L      
Sbjct: 119 EGAKFKGSKMSPLSGFKRMFGMNGLVELIKSIAKVVVIVGMALGALLFFEDEALHLDLEL 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               ++HA   ++   IM++  +  + ++D+ +  ++   ++KM+KQE+KDE K S G+P
Sbjct: 179 YPGNIFHALDMLKWAFIMLVCGMIPIALIDVPYQIYKHNKEIKMTKQEVKDERKNSEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           ++K R + +       +MM+   +A +++TNPTHY++A++Y  + N APV+VAKG + +A
Sbjct: 239 LVKGRIRRLQYQAATKRMMQEVPQADVVVTNPTHYSVAIKYDDSGNRAPVVVAKGTDELA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
             +RKIA  +++P+   P LAR+++    I+  +P   + AVAQ++  +Y  K
Sbjct: 299 MHIRKIATANDVPLIPSPMLARAVYYSTEIDGEVPNALFMAVAQVLAHVYQLK 351


>gi|310764894|gb|ADP09844.1| Flagellar biosynthetic protein FlhB [Erwinia sp. Ejp617]
          Length = 381

 Score =  343 bits (879), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 97/353 (27%), Positives = 179/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS  ++ + KTEAP+  +I  A  EG  P S+E +    +L     +L      + S+ S
Sbjct: 1   MS-QESDNEKTEAPTPSRIAKAREEGQIPRSKELTTLLMLLVGWGLMLCSGGNLVRSLQS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            LH  L    +  + D + ++   + L   A   ++P +   ++  + +  +    +L+ 
Sbjct: 60  LLHNALI-FDRLLVLDPAQMLQRSSSLLGQAFMAIMPFVFGLLLTAVSAPPLIGGLILSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P  K+++   GIKR++S       +K+ +K++L      + L  N    +  I   
Sbjct: 119 KSLAPKLKKLNPLSGIKRMFSAQMASEMVKAILKVLLATIGGGLYLLLNKEKFIRLIFEP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               L      +   L+ +++ +  +   D+ +  +  + KL+MS+QEIKDE K+  G+P
Sbjct: 179 LGMALTDISGLLLGCLLAVIMSLIPMVAFDVIYQLYSHWKKLRMSRQEIKDEFKKQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R + + R+  + +MM     A +I+ NPTHY++AL+Y      AP +VAKG  L+A
Sbjct: 239 QIKGRVRQMQRAMAQRRMMTDVPDADVIVNNPTHYSVALKYQDGSLGAPKVVAKGSGLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A  H +P+ E P LAR+L++   I + IP   Y AVA+++  +Y  +
Sbjct: 299 LRIRELAENHKVPMLEAPPLARALYRHCEIGAPIPADLYHAVAEVLAWVYSLR 351


>gi|209964223|ref|YP_002297138.1| flagellar biosynthesis protein FlhB [Rhodospirillum centenum SW]
 gi|209957689|gb|ACI98325.1| flagellar biosynthetic protein FlhB [Rhodospirillum centenum SW]
          Length = 359

 Score =  343 bits (879), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 106/354 (29%), Positives = 196/354 (55%), Gaps = 2/354 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+   D+KTE P+ KK+ DA  +G    S E      + + L+ +L         +  
Sbjct: 1   MAEDQDQDSKTEEPTDKKLSDAREKGQVAKSMEVGNLFILASGLVMVLLLLPWSGRILWD 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   +       L   + +  +LT L+L  +  + P L+L ++  + + +IQ   + + 
Sbjct: 61  AMMPFVERP-HAILMAPAALGDVLTDLTLDIAFALAPTLVLLLLAALAAPIIQVGLMFSA 119

Query: 121 NH-VKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISA 179
            +  K    +V+   G+K   S+ NLV F+KS  K++LVG ++++ L   + ++  F++ 
Sbjct: 120 ENVFKFDLNKVNPLTGLKNKVSLKNLVEFLKSLGKLVLVGIVVSVLLLPLWTSIEHFLAL 179

Query: 180 NPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
              S++        K++  +++ +  +   D  +  +Q+  +++M+KQE+KDE KQ+ G+
Sbjct: 180 PLPSVIVETRHEAAKLIAAVVIVLGAIAGADYAFQRYQFMQQMRMTKQEVKDEYKQTEGD 239

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLI 299
           P+IK++ + +   R R++MM A   A +++TNPTH+A+AL+Y  +   AP +VAKG +LI
Sbjct: 240 PLIKSKIRQLRMQRSRNRMMAAVPSADVVVTNPTHFAVALKYDASAMSAPRVVAKGADLI 299

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           AK++R++A E  +P+   P LAR+LF    I+  IP   YKAVAQ+I  ++  K
Sbjct: 300 AKRIRELAEEAGVPVISNPPLARALFATAEIDEEIPAEHYKAVAQVISYVFKLK 353


>gi|311068160|ref|YP_003973083.1| flagellar biosynthesis protein FlhB [Bacillus atrophaeus 1942]
 gi|310868677|gb|ADP32152.1| flagellar biosynthesis protein FlhB [Bacillus atrophaeus 1942]
          Length = 360

 Score =  343 bits (879), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 106/346 (30%), Positives = 181/346 (52%), Gaps = 1/346 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE  + KK +D   +G    S + +   S+L   +  +         + S L     
Sbjct: 12  GEKTEKATPKKRQDTRKKGQVAKSADVNTAVSLLVVFLSFIAIGPYMRDRLLSFLETFYT 71

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
            +   KL  +S++  L   L      ++ P +L+ ++ G+ S  +Q   + +   +KP  
Sbjct: 72  ESLTMKL-SMSNVHTLFIDLLKDTGIILAPIMLVALIAGVISNYMQVGILFSAEVIKPDL 130

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
           K++S  +G KRIYS+  +V  +KS +KI +VG    + L  +Y  +L      P  +L  
Sbjct: 131 KKLSPLKGFKRIYSMRAIVELLKSILKIAVVGFAAFLVLWTHYGEILRLPLLTPEEVLSF 190

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
                  + +     +  L  LD  +    +   ++MSKQ+IKDE K+S G+PIIK++ K
Sbjct: 191 VSKLTLWMGLSGAGALMVLAGLDYLYQKFDYEKNIRMSKQDIKDEYKKSEGDPIIKSKIK 250

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              R     +MM+   +A +IITNPTHYA+AL+Y + + DAP ++AKG + +A K+++IA
Sbjct: 251 QRQREMAMRRMMQEVPKADVIITNPTHYAIALKYDEHKMDAPYIIAKGVDHLALKIKQIA 310

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            EH++   E   LAR+L+ QV I+ A+P  F+K +A+++  +Y  K
Sbjct: 311 KEHDVMTVENRPLARALYDQVEIDQAVPEEFFKVIAEILAYVYKTK 356


>gi|119775419|ref|YP_928159.1| flagellar biosynthesis protein FlhB [Shewanella amazonensis SB2B]
 gi|119767919|gb|ABM00490.1| flagellar biosynthetic protein FlhB [Shewanella amazonensis SB2B]
          Length = 377

 Score =  343 bits (879), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 84/353 (23%), Positives = 177/353 (50%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+END    +TE P+ +++E A  +G    S+E    + +LA  +  L        ++ +
Sbjct: 1   MAENDTSQERTEEPTGRRLEQAREKGQVARSKELGTAAVLLAAAVGFLMLGPSLGKAMHN 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            + + +   ++ ++ D + ++ +   ++      V+  +L+         ++    + + 
Sbjct: 61  VMTMTMVQ-SREQVFDTNSMLNIWIPIAKELGLPVLGLVLVLAALAFAGNIVLGGIIFSS 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           N V P   ++S   G KR++ +  L+   K   K  +V       L+  +  ++   + +
Sbjct: 120 NGVLPKASKMSPLAGFKRMFGLQALMELGKGLAKFSVVAVAAYFLLSFYFPEIIQISAEH 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             S ++HA   +  + +++   +  + V+D+ +       +LKM+KQE+KDE K + G P
Sbjct: 180 LPSNVFHALDLLTWMFLLLCSSMLIIAVIDVPFQIWNHKKQLKMTKQEVKDEYKDTEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R     +MM    +A +I+ NP H+A+AL+Y    + AP ++AKG + +A
Sbjct: 240 EVKGRIRQMQREIAMRRMMAEVPKADVIVVNPEHFAVALKYDAKRSPAPFVLAKGVDAVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA E++I I   P LAR+++    +N  +P   + AVAQ++  ++  +
Sbjct: 300 FKIREIAREYDIAIVSAPPLARAIYHTTKLNQQVPEGLFTAVAQVLAYVFQLR 352


>gi|240145485|ref|ZP_04744086.1| flagellar biosynthetic protein FlhB [Roseburia intestinalis L1-82]
 gi|257202300|gb|EEV00585.1| flagellar biosynthetic protein FlhB [Roseburia intestinalis L1-82]
          Length = 379

 Score =  343 bits (879), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 90/357 (25%), Positives = 169/357 (47%), Gaps = 5/357 (1%)

Query: 2   SENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSD 61
           +++     KTE  + KK+ +A  +G    S+E +    ++   + L  F S         
Sbjct: 17  AKDGPGGEKTEPATEKKLREAREDGKVAKSKELTAAFDLIVLFLVLKVFISLIGNGFLEV 76

Query: 62  LHVLLASATQR-----KLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIP 116
            + +                   I   L ++ +   ++  P  +  +       ++Q   
Sbjct: 77  FYYVYKLMPDFVSVNAMESSTKEITSFLHNVYIEMFKMAAPFFVFGVAVTALVSILQVGW 136

Query: 117 VLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDF 176
            +    +KP   + +   G KRI+S ++L   +KS +KI L+  +   S+      +   
Sbjct: 137 KVTAKPLKPKGDKFNPINGFKRIFSKDSLFELLKSILKIGLIIYVAYTSIKGEANDIFIL 196

Query: 177 ISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQS 236
                +  +      +      I L    + + D  +  H++   +KM+KQE+KDE K +
Sbjct: 197 YDIPLNQAVVLCGNVIINAGFKISLVYLVVGIADFVYQKHRFNEDMKMTKQELKDEYKNT 256

Query: 237 YGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQ 296
            GNP IK RQ+   R   + +MM+   +A ++ITNPTH A+A++Y    + AP+++AKG+
Sbjct: 257 EGNPEIKGRQRQRMREASQRRMMQDVPKADVVITNPTHLAVAIKYDAEVSRAPIVIAKGE 316

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           + +A+K+R+ A E++I I E   LAR L+  V I + IPP  Y+AVA+++  +Y+ +
Sbjct: 317 DYLAQKIREKAKENHIEIVENKPLARMLYANVDIGAEIPPELYQAVAEILAMVYNLR 373


>gi|85716547|ref|ZP_01047517.1| flagellar biosynthesis protein [Nitrobacter sp. Nb-311A]
 gi|85696548|gb|EAQ34436.1| flagellar biosynthesis protein [Nitrobacter sp. Nb-311A]
          Length = 359

 Score =  343 bits (879), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 112/353 (31%), Positives = 190/353 (53%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++      KTE P+ K+++DAL  G+   S+E + + +I    + L  F          
Sbjct: 1   MADESDDTEKTEDPTQKRLDDALERGDVAKSQEVNAWFAIAGATLVLSTFAGSIGDGFRM 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  L+A++ Q + +    +          A+ L +P LLL M   +   ++Q   V + 
Sbjct: 61  PLRNLIANSWQIRTDGPGLLALAEQIGYCLAAALGVPLLLLTMAA-VAGNVVQHRFVWSG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +KP   ++S+  G KRI+    + NF K   K++ +G ++T  L      +   +  +
Sbjct: 120 ETLKPKLSKISVVSGAKRIFGKQAVANFAKGLFKVLALGAVMTAVLWPERSRLDAMVRLD 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P+++L        ++L  +++ +A + + D  + Y QW+ + KMS +E+K+E KQS G+P
Sbjct: 180 PNALLGITKSLTLQLLGAVMVMLALVAIADYLFQYRQWFERQKMSLREMKEEFKQSEGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R + +   R++ +MM A  +A++IITNPTHY++AL Y +    APV VAKG + IA
Sbjct: 240 HIKARIRQLRHVRMKKRMMAAVPQASVIITNPTHYSVALSYERG-MSAPVCVAKGVDNIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA EH+IP+ E   LAR+L+  V I+  IP   Y AVA++I  +   K
Sbjct: 299 LKIREIAREHDIPVVENVPLARALYAAVEIDDEIPVEHYHAVAEIIGYVMGLK 351


>gi|291484192|dbj|BAI85267.1| flagellar biosynthesis protein FlhB [Bacillus subtilis subsp. natto
           BEST195]
          Length = 360

 Score =  343 bits (879), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 108/346 (31%), Positives = 181/346 (52%), Gaps = 1/346 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE  + KK +D   +G    S + +   S+L   + L+         + S +     
Sbjct: 12  GEKTEKATPKKRKDTRKKGQVAKSSDVNTAVSLLVIFLSLIAIGPYMRDRLLSFIETFYT 71

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
            +   KL + S++  L   L      ++ P LL+ ++ G+ S  +Q   + +   ++P  
Sbjct: 72  ESLTMKLSE-SNVHTLFVSLLKDMGIILAPILLVALVAGVVSNYMQVGFLFSAEVIQPKL 130

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
           +++   +G KRIYS+  +V  +KS +KI++VG      L  +Y  +L      P   L  
Sbjct: 131 EKLDPIKGFKRIYSMRAIVELIKSILKIVVVGFAAFAVLWLHYGEILRLPLLTPEEALSF 190

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
                  + +     +  L  LD  +    +   +KMSKQ+IKDE K+S G+PIIK++ K
Sbjct: 191 VSKLTLWMGLSGAGALLILAGLDYLYQRFDYEKNIKMSKQDIKDEYKKSEGDPIIKSKIK 250

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              R     +MM+   +A +IITNPTHYA+AL+Y + + DAP +VAKG + +A K+RKIA
Sbjct: 251 QRQREMAMRRMMQEVPKADVIITNPTHYAIALKYDEEKMDAPYIVAKGVDHLALKIRKIA 310

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            EH++ + E   LAR+L+ QV I+ A+P  F+K +A+++  +Y  K
Sbjct: 311 KEHDVMMVENRPLARALYDQVEIDQAVPEEFFKVLAEILAYVYKTK 356


>gi|317133470|ref|YP_004092784.1| flagellar biosynthetic protein FlhB [Ethanoligenens harbinense
           YUAN-3]
 gi|315471449|gb|ADU28053.1| flagellar biosynthetic protein FlhB [Ethanoligenens harbinense
           YUAN-3]
          Length = 356

 Score =  343 bits (879), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 100/350 (28%), Positives = 187/350 (53%), Gaps = 1/350 (0%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
             +  +KTE  + K+ ED   +G+   S + +   ++L     L       I S++  + 
Sbjct: 3   EASAGDKTEKATPKRREDERKKGHVVQSPDVTSAVAMLGTFAVLRVMGPSMIKSLSDGMR 62

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
            +LA+ T   +     +   +T        + +P +L+     + + L Q   +++L+ +
Sbjct: 63  GMLANLTS-AVSGYEDMRARMTAALSVLIGVAVPVMLVAFAATVATTLAQTRLLVSLDQL 121

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           KP   R++  EGIKR++S+ +LV   KS +K++LVG ++   +     T+L   + +   
Sbjct: 122 KPDLSRLNPLEGIKRLFSVRSLVELGKSILKVVLVGAVVYFEIQPQMHTILLLYNMSLAQ 181

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
                   +  + I +   +  L  +D  + + Q+   ++M+K+EIK+E KQ  GNP IK
Sbjct: 182 SFSWVAGILADIGIKVAGVMLLLGAIDYFYQWFQYEKDIRMTKEEIKEEYKQMEGNPEIK 241

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            + K++ R   R +MM+   +A +++ NPTH+A+AL+Y   +  APV VAKG+N +A ++
Sbjct: 242 GKIKNLQRQMARRRMMQDVPKADVVLRNPTHFAVALKYEHGKQRAPVCVAKGRNAVALRI 301

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            +IA E+++ I E+P L R+L++ V +   IP  FYKAVA+++  IY  +
Sbjct: 302 VEIAEENHVYIREDPPLTRALYQAVEVGGQIPAEFYKAVAEVLAYIYKLR 351


>gi|148256775|ref|YP_001241360.1| flagellar biosynthesis protein FlhB [Bradyrhizobium sp. BTAi1]
 gi|146408948|gb|ABQ37454.1| Flagellar biosynthetic protein FlhB [Bradyrhizobium sp. BTAi1]
          Length = 359

 Score =  343 bits (879), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 111/353 (31%), Positives = 194/353 (54%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++ D  ++KTE P+ K+++ AL  G+   S+E + +  I A  + +  F      +V  
Sbjct: 1   MADEDDSEDKTEDPTQKRLDQALERGDVVKSQELNTWFVIAAATLVMSTFSGSIGTAVLV 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L+A++      D + ++ L   LS +    +   +L+ M+  I   ++Q   V + 
Sbjct: 61  PMRNLIANSWMIH-TDGAGLLALARSLSFAVIAAIGVPILMVMLAAIAGNMMQHRLVWSG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +KP+F ++S   G KR++      NF K   K++L+GT++ + L      +   +  +
Sbjct: 120 EPLKPNFGKISPLAGAKRLFGKQAAANFAKGIFKLVLLGTVMVMILWPERLRLESLLHMD 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
              +L       + ++  ++  +A + + D  + Y QWY + KMS QE+K+E KQS G+P
Sbjct: 180 VSELLGVTISLTKHLMGSVVALLALVAIGDYLFQYRQWYERQKMSVQEMKEEFKQSEGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + I + R++ +MM A  +A++IITNPTHY++AL Y +    APV VAKG + IA
Sbjct: 240 HVKGRIRQIRQQRMKKRMMAAVPKASVIITNPTHYSVALAYERG-MSAPVCVAKGVDNIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA  H+IPI E   LAR+L+  V I++ IP   Y AVA++I  +   +
Sbjct: 299 FKIREIAKAHDIPIVENVPLARALYATVEIDAEIPVEHYHAVAEIISYVMGLR 351


>gi|302343745|ref|YP_003808274.1| flagellar biosynthetic protein FlhB [Desulfarculus baarsii DSM
           2075]
 gi|301640358|gb|ADK85680.1| flagellar biosynthetic protein FlhB [Desulfarculus baarsii DSM
           2075]
          Length = 364

 Score =  342 bits (878), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 104/354 (29%), Positives = 187/354 (52%), Gaps = 3/354 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++N     KTE P+ ++   A  +G    S+E      + A L+ L  F         +
Sbjct: 1   MADN-TAQEKTEKPTPRRRSKAREKGQVAKSQELGSIGVLFAGLMCLYAFGGFVYDQSAT 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  +L+ A +  +  ++ +  L   L     R + P +L  ++ G+   + Q   +L  
Sbjct: 60  MMTHILSRAAETPV-SLAQVHNLSIDLMGHFLRTLAPFMLAVVLAGVAVNVAQTGFMLAT 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + ++P  K+++  EG+K+  S+  LV  +K+  KI +VG +  + L +      +     
Sbjct: 119 SRLRPDLKKINPLEGLKKFVSMRMLVEAIKNTGKICVVGLVAYLVLADELPNFPNIGKLG 178

Query: 181 PHSIL-YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
             + +  +      ++ +  L  +  L +LD  +  +Q+   LKMSKQEIKDE KQ+ G+
Sbjct: 179 GLTAMLIYIADVCLRIFLWSLAAMFILAILDYAYQKYQFEKGLKMSKQEIKDEFKQTEGD 238

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLI 299
           P +K+R + + R R   +MM A  +A ++ITNPTH A+A+ Y   + DAP +VAKGQN I
Sbjct: 239 PHVKSRIRQLQRERAMKRMMAAVPQADVVITNPTHLAVAIFYQAGQMDAPEVVAKGQNKI 298

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A++++ +A E+N+PI E+  LA++L+K V +   IP   + AVA ++  +Y +K
Sbjct: 299 AERIKALAQENNVPIIEDKPLAQALYKSVEVGQRIPFELFGAVAAILAHVYREK 352


>gi|149194192|ref|ZP_01871290.1| flagellar biosynthetic protein FlhB [Caminibacter mediatlanticus
           TB-2]
 gi|149136145|gb|EDM24623.1| flagellar biosynthetic protein FlhB [Caminibacter mediatlanticus
           TB-2]
          Length = 351

 Score =  342 bits (878), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 100/353 (28%), Positives = 177/353 (50%), Gaps = 5/353 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+       KTE P+ KK+E+A  EGN   S E S F  +L   I +LF+     + +  
Sbjct: 1   MA---DDLEKTEEPTPKKLEEAKKEGNIAKSMEVSGFVVLLVGSIIILFYLKYVTFYLEE 57

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
                 +       ++I     L+   +     L+ P  +  ++ GI   ++Q   +  +
Sbjct: 58  YFRYFYSYIGVELTKNI--FFNLIIKSTYYFFILIAPIFIALILAGIIGNVMQFGFLFTI 115

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P  ++++  +G+KR++S+  LV  +K+ +K  +   +           +      N
Sbjct: 116 KPILPKLEKINPIKGLKRLFSVKTLVEGLKTTLKTFIAFLVGFTLFYNFLQEIPRLELMN 175

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               L         ++  +L       ++D  +  + +   L+MSKQEIKDE KQ+ GNP
Sbjct: 176 FFEQLKWFEDKAVILIFSLLGVFFIFAIIDFTYQKYTYKKSLRMSKQEIKDEYKQTEGNP 235

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + + R   + +MM    +A ++ITNPTHYA+A+RY +T+++AP +VAKG + +A
Sbjct: 236 EVKAKIRQLQREMAKKRMMAEVPKADVVITNPTHYAVAIRYDKTKDEAPRVVAKGVDNLA 295

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+++IA E  + I E P LAR L+K V +   IP   +KAVA+++  +Y  K
Sbjct: 296 IKIKEIAREAGVMIVENPPLARELYKSVEVGEIIPQKLFKAVAEVLAYVYRAK 348


>gi|167564493|ref|ZP_02357409.1| flagellar biosynthesis protein FlhB [Burkholderia oklahomensis
           EO147]
          Length = 400

 Score =  342 bits (878), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 103/353 (29%), Positives = 178/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   +TEA + K+ E A  EG    SRE + F+ + A          P    + +
Sbjct: 1   MAE-DSDLERTEAATPKRREKAREEGQVARSRELASFALLSAGFYGAWLLSGPISEHLRT 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            LH    S  +    D   ++     LSL     + P L L  +  + + +     +++ 
Sbjct: 60  MLHAAF-SFDRATAFDTHRMLSHAGSLSLEGLYALAPLLALTGVAALAAPMALGGWLVST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
              +  F+R++   G+ RI+SI   +    S  K ++VG I   ++  +   +L   +  
Sbjct: 119 KTFELKFERLNPITGLGRIFSIQGPIQLGMSIAKTLVVGGIGGAAIWRSKDELLGLATQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            H+ L  A   V     M +  +  +  LD+ +   Q+  KL+M+K+E+K E +++ G+P
Sbjct: 179 LHAALADALHLVAVCCGMTVAGMLVVAGLDVPYQLWQYNKKLRMTKEEVKREHRENEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM     A +++TNPTH+A+AL+Y   E  AP +VAKG NL+A
Sbjct: 239 HVKGRIRQQQRAMARRRMMANVPTADVVVTNPTHFAVALKYTDGEMRAPKVVAKGVNLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R +A EH++P+ E P LAR+L+  V +   IP   Y AVA+++  +Y  K
Sbjct: 299 GRIRALAAEHHVPLLEAPPLARALYHNVDLEREIPGTLYSAVAEVLAWVYQMK 351


>gi|254470232|ref|ZP_05083636.1| flagellar biosynthetic protein FlhB [Pseudovibrio sp. JE062]
 gi|211960543|gb|EEA95739.1| flagellar biosynthetic protein FlhB [Pseudovibrio sp. JE062]
          Length = 358

 Score =  342 bits (878), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 111/353 (31%), Positives = 187/353 (52%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+     KTE P+ K+++DA  +G+ P S+E S + S++   + + F     + SV++
Sbjct: 1   MAEDTDDSEKTEDPTQKRLDDAFEKGDIPKSQEVSSWFSLVGTALVISFLAPTMVSSVST 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L    A A    + D   +VFLL         +V   LL  M   +   ++Q  P+   
Sbjct: 61  ILKGFFAHADTIAV-DPGALVFLLEITGPEILGVVALPLLTLMALAVVGNVVQHKPLWTA 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +KP   ++S   G+KR++S ++L NF+K  VKII V   + + L      +   +   
Sbjct: 120 ERLKPKLNKISPLSGMKRLFSKDSLANFLKGLVKIIAVAAAVFLVLWPERDRLDTVVFRE 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
              +L         V+  IL  +  +   D+ W   +W+ K KM++QE+K+E KQS G+P
Sbjct: 180 TGLVLEEVRELAIMVIGAILALMTVVAGADLVWQRKKWFEKQKMTQQEVKEEYKQSEGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK + + +   R R++MM +   AT++ITNPTHYA+AL Y +    AP  VA G + +A
Sbjct: 240 KIKAKIRELRLQRSRNRMMASVPDATVVITNPTHYAVALSYEEG-MGAPQCVALGVDDLA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A E ++PI E P LAR+L+  + +N  +P   Y AVA++I  +   +
Sbjct: 299 LRIREVAKESDVPIVENPPLARALYASIELNDYVPEEHYAAVAKVIGYVMQLR 351


>gi|75675330|ref|YP_317751.1| flagellar biosynthesis protein FlhB [Nitrobacter winogradskyi
           Nb-255]
 gi|74420200|gb|ABA04399.1| Flagellar biosynthetic protein FlhB [Nitrobacter winogradskyi
           Nb-255]
          Length = 359

 Score =  342 bits (878), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 113/353 (32%), Positives = 189/353 (53%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++      KTE P+ K+++DAL  G+   S+E + +  I    + L  F          
Sbjct: 1   MADESDDTEKTEDPTQKRLDDALERGDVAKSQEVNTWFVIAGATLVLSTFSGSIGSGFEL 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  L+A++ Q + +    +          A+ L +P LLL MM  +   +IQ   V + 
Sbjct: 61  PLRNLIANSWQIRTDGPGLLALAEQIGYRLAAALGVPLLLL-MMAAVAGNVIQHRFVWSG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +KP   ++S+  G KRI+      NF K   K++ +G ++T  L      +   +  +
Sbjct: 120 ETLKPKLSKISMVSGAKRIFGKQAAANFAKGLFKVLALGAVMTAVLWPERSRLDAMVRLD 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P+++L        ++L  +++ +A + + D  + Y QW+ + KMS +E+K+E KQS G+P
Sbjct: 180 PNALLGITKSLTLQLLGAVIVMLALVAIADYLFQYRQWFERQKMSLREMKEEFKQSEGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R + +   R++ +MM A  +A++IITNPTHY++AL Y +    APV VAKG + IA
Sbjct: 240 HIKARIRQLRHVRMKKRMMAAVPQASVIITNPTHYSVALSYERG-MSAPVCVAKGVDNIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA EH+IP+ E   LAR+L+  V I+  +P   Y AVA++I  +   K
Sbjct: 299 LKIREIAREHDIPVVENVPLARALYAAVEIDDEVPVEHYHAVAEIIGYVMGLK 351


>gi|56460295|ref|YP_155576.1| flagellar biosynthesis protein FlhB [Idiomarina loihiensis L2TR]
 gi|56179305|gb|AAV82027.1| Flagellar biosynthesis proten FlhB [Idiomarina loihiensis L2TR]
          Length = 375

 Score =  342 bits (878), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 90/354 (25%), Positives = 172/354 (48%), Gaps = 3/354 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D    +TE P+ ++ + A ++G    S+E      +++  +   F+F   +Y    
Sbjct: 1   MAETD--QERTEDPTERRKQQARDKGQIARSKEMGTGFVLVSAAVSF-FWFGGALYQGVR 57

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           ++  ++ +  ++   D S +              ++      ++F             + 
Sbjct: 58  NVFEIMFTLDRQHAFDTSKMYEAFAIAFGEILWPILTIFAFIVVFTFLGNSWLGGINFSA 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++   G KR++ +  LV  +K+  K ++V       L   +  +L      
Sbjct: 118 QAMAPKFNRMNPLNGFKRMFGVQALVELIKAIAKFMVVAVSAYFLLKWKFVDILQMSMGQ 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             +++ +A  T+  + +++ L I  + V+D  +   +    LKMSKQE+KDE K + G+P
Sbjct: 178 MPTMIENALDTLLWMFLLLCLSIFLIVVIDAPFQVWKHNKDLKMSKQEVKDEHKDTEGSP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + +       +MM+   +A +++TNPTHYA+AL+Y      APVL+AKG +  A
Sbjct: 238 EVKGRIRRLQMEMANRRMMQEVPKADVVVTNPTHYAVALKYDDGGVQAPVLLAKGTDETA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKKI 354
            K+R+IA E+ IP+   P LARS++    +   IP   + AVAQ++  +Y  ++
Sbjct: 298 AKIREIALEYEIPLVASPGLARSIYHTTELEKEIPKGLFVAVAQILAYVYQLRM 351


>gi|226313051|ref|YP_002772945.1| flagellar biosynthetic protein FlhB [Brevibacillus brevis NBRC
           100599]
 gi|226095999|dbj|BAH44441.1| flagellar biosynthetic protein FlhB [Brevibacillus brevis NBRC
           100599]
          Length = 365

 Score =  342 bits (878), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 101/345 (29%), Positives = 179/345 (51%), Gaps = 1/345 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE  + KK +DA  +G    S++ S   S+ A    L+   S  + +    +   L 
Sbjct: 17  GEKTEKATPKKKQDARKKGQVAKSQDLSPALSLTAFFFLLMMLGSTMLGTFQDLMRESLI 76

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
           + T  +L +  ++  ++  L   A ++V P L L  +       +Q     +   ++   
Sbjct: 77  TYTTWQLNE-ENLKVMVMQLVFEAIKIVGPILGLSFLVAFAVNYMQVGWHFSTEPLQMKL 135

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
           +++   +G KRI+S+ +LV  +KS +KI     +  + L      ++     +  ++L  
Sbjct: 136 EKIDPIKGAKRIFSLRSLVELLKSLLKISAGIYVAYVILWNAKEQVVQLSLLSLGAVLSF 195

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
               V K+ I + L +  L VLD  +  ++    L+MSKQ++KDE KQ+ G+P+IK + +
Sbjct: 196 TAEEVTKLGIYLGLLLFILAVLDYAYQRYEHEKNLRMSKQDLKDEHKQAEGDPLIKGKIR 255

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              RS    +MM+   +A +IITNPTH+A+A+RY  +   AP ++AKGQ+ +A K+R++A
Sbjct: 256 ERQRSMAIRRMMQELPKADVIITNPTHFAVAVRYDASAMSAPTVIAKGQDYLALKIREVA 315

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
            +H I   E   LAR+L+ QV +   IP   +KAVA+++  +Y  
Sbjct: 316 KKHRIVTMENKPLARALYSQVEVGQQIPEEMFKAVAEVLAYVYKL 360


>gi|269792925|ref|YP_003317829.1| flagellar biosynthetic protein FlhB [Thermanaerovibrio
           acidaminovorans DSM 6589]
 gi|269100560|gb|ACZ19547.1| flagellar biosynthetic protein FlhB [Thermanaerovibrio
           acidaminovorans DSM 6589]
          Length = 366

 Score =  342 bits (877), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 91/346 (26%), Positives = 175/346 (50%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
           + KTE  + +K   A  EG    S++ +    I + L+ +L F       +      ++ 
Sbjct: 15  EEKTEPATPRKRRKAREEGQVTKSQDLTAAVVIASGLLGVLVFGGFFFRRLQLLFAQVMG 74

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
                 +     ++   +    S   +  P  L   +  +G    Q   ++    + P+ 
Sbjct: 75  YLKDPSMGGEEWLLLPFSRALGSYLLIWFPLGLACALAALGLMAYQVGLMITPKPLVPNL 134

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
            R++   G+K+++S  + V  +K  +K +++  ++  +L ++  T+L  I       L  
Sbjct: 135 NRMNPVSGMKKMFSGRSFVEMLKGVLKALILLLMLYGALRKDLLTLLGAIGQPFGEGLGL 194

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
             + V  + + + L +  L + D  +   ++   ++MSKQEIK+E KQ  G+P++K R +
Sbjct: 195 VMWRVWVLCMKMTLMLMVLGLFDYAYQRWEFERSIRMSKQEIKEEYKQMEGDPLVKRRIR 254

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              R   R +MM    +A ++ITNPTH A+AL Y +   +APV++AKG+ LIA+++R+IA
Sbjct: 255 QRQRELARRRMMSDVPKADVVITNPTHVAVALSYDRKVAEAPVVLAKGKGLIAQRIREIA 314

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            E+ +P+ + P LAR+++ QV +   IP   YKAVA+++  +Y  +
Sbjct: 315 RENRVPVVQNPPLARAIYAQVEVGEEIPESLYKAVAEVLAFVYRLR 360


>gi|289578415|ref|YP_003477042.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter italicus
           Ab9]
 gi|297544691|ref|YP_003676993.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
 gi|289528128|gb|ADD02480.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter italicus
           Ab9]
 gi|296842466|gb|ADH60982.1| flagellar biosynthetic protein FlhB [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
          Length = 363

 Score =  342 bits (877), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 108/348 (31%), Positives = 184/348 (52%), Gaps = 2/348 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
           + KTE  + K+ +DA  +G    SRE +    I+A  + L     P +  + +    LL 
Sbjct: 14  EEKTEPATPKRRQDARKKGQVFQSREITSALVIVAGFLALNILAIPSLEKMMALTKYLLY 73

Query: 68  SAT--QRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           + +     + ++  I  L T++   A  ++IP +LL  +  + S  +Q   V     +  
Sbjct: 74  TYSGANDDVFNVVGIRNLFTYVLQQAISIIIPIILLIFVVSLVSTYLQVGFVFTTEPLAF 133

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
             +R++  EG KRI+S   LV   KS  K++++  I+   L   Y  +   +  +   IL
Sbjct: 134 KLERLNPVEGFKRIFSKRALVELAKSIAKVVVLFYIMYSFLASQYKGIPMLLDMSVQDIL 193

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
            +A   +  + I I + +  L  LD  + + ++   LKMSK++IK+E K++ GNP IK  
Sbjct: 194 KYALNILLGITIRIGIVLIVLGALDYFFQWREYEVSLKMSKEDIKEEFKETEGNPQIKAE 253

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
            +   R     +MM+   +A ++ITNPTH A+AL Y    NDAPV++AKGQ++IA ++++
Sbjct: 254 IRRKQRQVSMRRMMQDLKKADVVITNPTHLAVALMYDSNVNDAPVVIAKGQDMIALRIKE 313

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            A + NIPI E   LA++L++   I   IPP  Y+AVA+++  +Y  K
Sbjct: 314 EAKKLNIPIVENKPLAQALYRSTEIGDMIPPELYQAVAEVLAYVYSLK 361


>gi|310767884|gb|ADP12834.1| Flagellar biosynthesis protein FlhB [Erwinia sp. Ejp617]
          Length = 383

 Score =  342 bits (877), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 97/353 (27%), Positives = 188/353 (53%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS  D+ + KTE+P++ ++E A  EG  P SRE +    ++  L  L          + +
Sbjct: 1   MS-QDSDEEKTESPTAHRLEKAREEGQIPRSRELTSLLMLMTGLSILWVGGEWMGRKMGA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L       + D S ++ L+ ++ L A   V+P +   ++  I + ++    VL+ 
Sbjct: 60  LLADGLV-FNHSVVSDTSQMLRLIANMLLQAVMAVLPMMFGLVVVAIAAPMLLGGLVLSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K    +++  +G+ +++S  +    +K+ +K  LVG +  + +  ++  ML  ++ +
Sbjct: 119 KAIKFDPGKMNPIKGLGKLFSAQSAAELLKAVLKATLVGVVCGLYIWHHWAGMLHLMAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + L  A   +    I+++L ++ +   D+ +    ++  L+MS Q+I+DE KQ  G+P
Sbjct: 179 PLTALAGAMNMIAMCCILVVLGLSPIVGFDVFYQLFSYFKNLRMSHQDIRDEHKQQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A +I+TNPTHY++AL+Y + +  AP +VAKG   IA
Sbjct: 239 HVKGRIRQQMRAAARRRMMADVPKADVIVTNPTHYSVALQYDEKKMSAPKVVAKGAGDIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++   + IP+ E P LAR+L++   I   IP   Y AVA+++  ++  +
Sbjct: 299 LRIRELGAANRIPVLEAPPLARALYRHSEIGQHIPGALYAAVAEVLAWVWQLR 351


>gi|39936944|ref|NP_949220.1| flagellar biosynthesis protein FlhB [Rhodopseudomonas palustris
           CGA009]
 gi|192292772|ref|YP_001993377.1| flagellar biosynthesis protein FlhB [Rhodopseudomonas palustris
           TIE-1]
 gi|39650801|emb|CAE29324.1| putative flagellar biosynthetic protein flhB [Rhodopseudomonas
           palustris CGA009]
 gi|192286521|gb|ACF02902.1| flagellar biosynthetic protein FlhB [Rhodopseudomonas palustris
           TIE-1]
          Length = 357

 Score =  342 bits (877), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 112/353 (31%), Positives = 192/353 (54%), Gaps = 4/353 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE    D KTE P+ K+++DAL  G+   S+E + +  I    + L  F       + +
Sbjct: 1   MSE--DSDEKTEEPTQKRLDDALKRGDVVKSQEVNTWFLIAGATLVLSSFHESIGTGILA 58

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L+  +   ++ D   ++ L   LS +    +   LL+ ++  I S +IQ   V + 
Sbjct: 59  PMRNLIEKSWMLRV-DGDGLIALAKSLSYATLAAIGIPLLMLVIVAIASNMIQHRLVFSA 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F ++S  EG KR++    + NF+K   KI+ +G ++   L   +  +   +  +
Sbjct: 118 EALTPKFSKLSPLEGAKRLFGKQAMANFLKGLFKIVALGIVMVAVLYPEHDRLDALLKMD 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             ++L        K+L  ++  +A + V D  + Y QW+ K KMS QEIK+E KQS G+P
Sbjct: 178 VSALLGVTVALTLKLLGAVVAMLAFVAVGDYFFQYRQWHEKQKMSLQEIKEEFKQSEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R + +   R++ +MM     A+++ITNPTH+++AL+Y +    AP+ VAKG + +A
Sbjct: 238 HIKGRLRQLRYQRMKKRMMAEVPNASVVITNPTHFSVALKYERG-MSAPICVAKGVDAVA 296

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++A EH++PI E   LAR+L+  V I+  IP   Y+AVA++I  + + K
Sbjct: 297 FKIREVAKEHDVPIVENVPLARALYATVEIDEEIPVEHYQAVAEVIGYVMNLK 349


>gi|254291356|ref|ZP_04962149.1| flagellar biosynthetic protein FlhB [Vibrio cholerae AM-19226]
 gi|150422686|gb|EDN14640.1| flagellar biosynthetic protein FlhB [Vibrio cholerae AM-19226]
          Length = 376

 Score =  342 bits (877), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 88/353 (24%), Positives = 178/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+D    +TE  +S++++ A  +G    S+E +  S ++   + L++F       +  
Sbjct: 1   MAESD-GQERTEEATSRRLQQAKEKGQVARSKELASVSVLVVGAVSLMWFGEILAKGLMV 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L    ++ ++ D+  +  ++    ++    ++  L    +  +           + 
Sbjct: 60  AMQRLFE-LSREEIFDLGKLFDIIGGSLVNLLLPLLMILTTLFIAALIGAAGVGGISFSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   +++   G+KR++ + + V  +KS +K++LV  +    +  +   +       
Sbjct: 119 EAAMPKLSKMNPLSGLKRMFGMQSWVELLKSILKVLLVSGVAFYLIEASQKDLFQLSLDV 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               ++HA   +   +++I   +  +  +DI +   Q   +LKM+KQE+KDE K + G P
Sbjct: 179 YPQNIFHALDILLNFVLLISCSLLVVVAIDIPFQIWQHAEQLKMTKQEVKDEYKDTEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM A  +A +IITNP H+++ALRY Q  + APV++AKG + +A
Sbjct: 239 EVKGRIRMLQREAAQRRMMAALPQADVIITNPEHFSVALRYKQNTDKAPVVIAKGVDHMA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA E++I I   P LAR+L+    +   IP   + AVAQ++  ++  K
Sbjct: 299 LKIREIAREYDIAIVPAPPLARALYHTTELEQQIPDGLFVAVAQVLAFVFQLK 351


>gi|327399034|ref|YP_004339903.1| flagellar biosynthetic protein FlhB [Hippea maritima DSM 10411]
 gi|327181663|gb|AEA33844.1| flagellar biosynthetic protein FlhB [Hippea maritima DSM 10411]
          Length = 353

 Score =  342 bits (877), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 100/347 (28%), Positives = 187/347 (53%), Gaps = 1/347 (0%)

Query: 7   PDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLL 66
            ++KTE  + K+ ++A  EG    S E +    +LA +++  F  S     +   L    
Sbjct: 3   DEDKTEQATPKRRQEAREEGRVAKSVELNTAFLMLAAVVFFYFTASNFGEKIKDVLIYFF 62

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
             A+  ++  +     L+  +S     +++P  ++         ++Q    +    ++  
Sbjct: 63  TLASNFEI-TLDSFDILVKRISGFMFSILLPFFIVMATIAFLINVVQVGFYITPKAMEIK 121

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
           F +++   G K ++S+ +    +KS +K  ++G I+ I + +N  +       N  ++  
Sbjct: 122 FDKINPVNGFKNMFSLRSFGELVKSLLKASVMGYILWIFIQKNINSWSSLSKTNQTAVFL 181

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
               ++  V++ IL+FI  + +LD  +  + +   + M+KQE+KDE KQ  G+P IK + 
Sbjct: 182 VMIKSMFLVVVYILIFIIFMAILDYLFQKYTFEKSIMMTKQEVKDEYKQMEGDPKIKQKI 241

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           +S+     R +MME   +A ++ITNPTHYA+AL+Y      AP +VAKG NLIAKK+++I
Sbjct: 242 RSMQMEMTRKRMMEEVKKADVVITNPTHYAVALKYDSATMAAPKVVAKGINLIAKKIKEI 301

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A E+++PI E+P LARSL+++V ++  IP   Y+AVA+++  ++  K
Sbjct: 302 AKENDVPIVEKPELARSLYEKVKLDREIPEELYQAVAEILAYVFKLK 348


>gi|313896030|ref|ZP_07829584.1| flagellar biosynthetic protein FlhB [Selenomonas sp. oral taxon 137
           str. F0430]
 gi|312975455|gb|EFR40916.1| flagellar biosynthetic protein FlhB [Selenomonas sp. oral taxon 137
           str. F0430]
          Length = 374

 Score =  342 bits (877), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 103/347 (29%), Positives = 178/347 (51%), Gaps = 3/347 (0%)

Query: 7   PDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLL 66
              KTE P++KK  DA  +G    S+E +    +L     L   +     ++ S    + 
Sbjct: 25  GGEKTEEPTAKKRADARKKGQVGRSQELNTAFVLLIGFFSLKLLWDSIYLAIASYTTYVF 84

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
           A+  Q    D  +IV L   +    ++  +P +L  M+ G+     Q     N   ++  
Sbjct: 85  ANLNQPV--DTENIVRLFIGIMEILAKTALPIMLFIMLIGLAVNFFQVGLNFNTEAIEFK 142

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
             +++   G  RI+S  +LV   KSF KI+++G  +   + E    M  F+  +  + L 
Sbjct: 143 LDKLNPINGFGRIFSKRSLVELAKSFFKILVIGFFLYRFIHEQIIAMPQFMFFDLTTSLA 202

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
                + ++  +++  I  + V D G+   Q    LKM+KQE+KDE+KQ+ G+P IK + 
Sbjct: 203 LVAEIIFRMAFIVIGVIMIMAVADYGYQNWQTTQDLKMTKQEVKDEMKQTEGDPQIKGKI 262

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           +   R     +MM+   +A +IITNPTHYA+AL Y +    AP ++AKGQ+L+A++++++
Sbjct: 263 RQKQRQMAMARMMKEVPKADVIITNPTHYAVALAYEKG-MVAPTVLAKGQDLVAQRIKEL 321

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
             E  +PI E   LAR+L+  V +  A+P   Y+AVA+++  +Y  K
Sbjct: 322 GREARVPIVENKPLARTLYAAVQVGDAVPQELYQAVAEVLAYVYRLK 368


>gi|310641562|ref|YP_003946320.1| flagellar biosynthetic protein flhb [Paenibacillus polymyxa SC2]
 gi|309246512|gb|ADO56079.1| Flagellar biosynthetic protein FlhB [Paenibacillus polymyxa SC2]
          Length = 370

 Score =  342 bits (877), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 92/347 (26%), Positives = 174/347 (50%), Gaps = 1/347 (0%)

Query: 7   PDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLL 66
              KTE  + KK +DA  +G    S E      +L     L+ F              + 
Sbjct: 21  SGEKTEKATPKKKQDARQKGQVAKSMELPAAGVLLVTFFCLMIFGGYFKDHAVRLFRDIF 80

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
            +    ++   +  + ++    +    ++ P  +  ++ GI +  +Q   +L    + P 
Sbjct: 81  VNRLSMEV-TPNTTLLMMGEYGVQILIMLAPIFVGAIVIGIAANYMQIGFLLTGEGITPK 139

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
           F ++   +G K I+S+ +LV F+KS +K+ ++G ++   L +    +      +   +L 
Sbjct: 140 FSKIDPIKGFKNIFSMRSLVEFLKSVLKMTVIGYLVYSVLWKTKADLPKLAEMSGDQMLS 199

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
                  ++ + I + +  L +LD  +  ++    LKMSKQ+IKDE K+  G+P+IK + 
Sbjct: 200 FTASLTMELGLKIGVVLFILAILDYMYQRYEHEKNLKMSKQDIKDEYKKMEGDPLIKGKI 259

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           +   R     +MM+    A +IITNPTH+A+AL+Y  +E +AP ++AKGQ+ +A ++++I
Sbjct: 260 RERQRRMAMQRMMQEVPNADVIITNPTHFAVALKYDGSEMEAPQIIAKGQDYVALRIKEI 319

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A +  +   E   LAR+LF++  I  AIP   ++AVA+++  +Y  K
Sbjct: 320 AKQSGVITMENKPLARALFQRAEIGDAIPADLFQAVAEVLAYVYKLK 366


>gi|320529415|ref|ZP_08030503.1| flagellar biosynthetic protein FlhB [Selenomonas artemidis F0399]
 gi|320138381|gb|EFW30275.1| flagellar biosynthetic protein FlhB [Selenomonas artemidis F0399]
          Length = 374

 Score =  342 bits (877), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 103/347 (29%), Positives = 178/347 (51%), Gaps = 3/347 (0%)

Query: 7   PDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLL 66
              KTE P++KK  DA  +G    S+E +    +L     L   +     ++ S    + 
Sbjct: 25  GGEKTEEPTAKKRADARKKGQVGRSQELNTAFVLLIGFFSLKLLWDSIYLAIASYTTYVF 84

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
           A+  Q    D  +IV L   +    ++  +P +L  M+ G+     Q     N   ++  
Sbjct: 85  ANLNQPV--DTENIVRLFIGIMEILAKTALPIMLFIMLIGLAVNFFQVGLNFNTEAIEFK 142

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
             +++   G  RI+S  +LV   KSF KI+++G  +   + E    M  F+  +  + L 
Sbjct: 143 LDKLNPINGFGRIFSKRSLVELAKSFFKILVIGFFLYRFIHEQIIAMPQFMFFDLTTSLA 202

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
                + ++  +++  I  + V D G+   Q    LKM+KQE+KDE+KQ+ G+P IK + 
Sbjct: 203 LVAEIIFQMAFIVIGVIMIMAVADYGYQNWQTTQDLKMTKQEVKDEMKQTEGDPQIKGKI 262

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           +   R     +MM+   +A +IITNPTHYA+AL Y +    AP ++AKGQ+L+A++++++
Sbjct: 263 RQKQRQMAMARMMKEVPKADVIITNPTHYAVALAYEKG-MVAPTVLAKGQDLVAQRIKEL 321

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
             E  +PI E   LAR+L+  V +  A+P   Y+AVA+++  +Y  K
Sbjct: 322 GREARVPIVENKPLARTLYAAVQVGDAVPQELYQAVAEVLAYVYRLK 368


>gi|188586038|ref|YP_001917583.1| flagellar biosynthetic protein FlhB [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179350725|gb|ACB84995.1| flagellar biosynthetic protein FlhB [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 363

 Score =  342 bits (877), Expect = 7e-92,   Method: Composition-based stats.
 Identities = 92/346 (26%), Positives = 171/346 (49%), Gaps = 2/346 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE P+ K   ++  +G    S E +    ++A    L   F        +      +
Sbjct: 14  QEKTETPTPKHRRESRKKGQVAKSTELTSALLLMATFSTLYIVFPYSFDRFMNFAKQFWS 73

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
           +        +  I  LL  + +  +    P +++ ++ G+ S L+Q   +L  + +KP  
Sbjct: 74  NINTIN-YTMDEIHSLLITMMMEGAVFAAPVIIVAVLIGLISNLMQVGILLTGDPLKPKL 132

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
           +R+   +G ++I+S   +V   KS  K++++G I  I    +      F       I   
Sbjct: 133 ERLDPIKGFQKIFSKRAVVELTKSLFKMVVIGIIAYILFNNHMEHFPYFYDMTVMQIAVE 192

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
                  ++  + + +  L++LD  +   +    LKM+KQ++KDE KQ+ G+P ++++ K
Sbjct: 193 VGQLTWALIFRVGMALLFLSILDYVYQVWEHEQNLKMTKQQVKDEHKQTEGDPQVRSKMK 252

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              R   + +MM     A ++ITNP H A+AL+Y +  + AP+++AKGQ  +A+K+++IA
Sbjct: 253 EKQREISKKRMMSEVPEADVVITNPVHIAVALKYDEG-DTAPMVLAKGQGHVARKIKEIA 311

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            +HN+ + E   LARSL+  V I   IP   Y+AVA+++  +Y  K
Sbjct: 312 EDHNVVVMENRQLARSLYFSVEIGDFIPEELYQAVAEVLAFVYRLK 357


>gi|297617157|ref|YP_003702316.1| flagellar biosynthetic protein FlhB [Syntrophothermus lipocalidus
           DSM 12680]
 gi|297144994|gb|ADI01751.1| flagellar biosynthetic protein FlhB [Syntrophothermus lipocalidus
           DSM 12680]
          Length = 366

 Score =  342 bits (877), Expect = 7e-92,   Method: Composition-based stats.
 Identities = 94/348 (27%), Positives = 179/348 (51%), Gaps = 1/348 (0%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
               KTE  + ++ +++  +G    S + +    +L     L F     +  +       
Sbjct: 16  EGGEKTEKATPRRRQESRRKGQVFRSVDLNSAVILLVGFAVLHFTTPYMLTGIQGFFSRY 75

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           L+     +L   +  V LL  + L  +++  P +   ++ G+   L+Q   V     +  
Sbjct: 76  LSDRALTQLTPATFHVMLLDAI-LLMAKISFPVIGAVLVAGLLVNLLQVGFVFAGEPLSI 134

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
             +RV+  EG KRI+S+  L+  +KS  K++L G ++   L +N +    F+   P S++
Sbjct: 135 KPERVNPVEGFKRIFSLRALIELVKSVAKVVLTGWVVYSVLKKNLYLFPRFVDMEPVSMV 194

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
                 + ++ + I + +  + +LD  + + +    L+MSK+E+K E KQ+ G+P I+++
Sbjct: 195 MSLGNIIFEMAMKIGVVLLVVGLLDYLYQWWEHEKSLRMSKEELKQEYKQTEGDPQIRSK 254

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
           Q+   R     +MM    +A ++ITNPTH+A+AL+Y      APV+ AKGQ+ +A ++R+
Sbjct: 255 QRQKQREMAMRRMMAEVPKADVVITNPTHFAVALKYEAEAMTAPVVTAKGQDFLALRIRE 314

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +A EH + + E P LAR+++    I   IP   Y+AVA+++  +Y +K
Sbjct: 315 VAMEHQVALVENPFLARTIYYSTEIGDPIPETLYQAVAEVLAFVYRQK 362


>gi|16078701|ref|NP_389520.1| flagellar biosynthesis protein FlhB [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221309516|ref|ZP_03591363.1| flagellar biosynthesis protein FlhB [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221313840|ref|ZP_03595645.1| flagellar biosynthesis protein FlhB [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221318763|ref|ZP_03600057.1| flagellar biosynthesis protein FlhB [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221323035|ref|ZP_03604329.1| flagellar biosynthesis protein FlhB [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|321315405|ref|YP_004207692.1| flagellar biosynthesis protein FlhB [Bacillus subtilis BSn5]
 gi|7404374|sp|P35538|FLHB_BACSU RecName: Full=Flagellar biosynthetic protein flhB
 gi|2634010|emb|CAB13511.1| component of the flagellar export machinery [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|320021679|gb|ADV96665.1| flagellar biosynthesis protein FlhB [Bacillus subtilis BSn5]
          Length = 360

 Score =  341 bits (876), Expect = 7e-92,   Method: Composition-based stats.
 Identities = 108/346 (31%), Positives = 181/346 (52%), Gaps = 1/346 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE  + KK +D   +G    S + +   S+L   + L+         + S +     
Sbjct: 12  GEKTEKATPKKRKDTRKKGQVAKSSDVNTAVSLLVIFLSLIAIGPYMRDRLLSFIETFYT 71

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
            +   KL + S++  L   L      ++ P LL+ ++ G+ S  +Q   + +   ++P  
Sbjct: 72  ESLTMKLSE-SNVHTLFVSLLKDMGMILAPILLVALVAGVVSNYMQVGFLFSAEVIQPKL 130

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
           +++   +G KRIYS+  +V  +KS +KI++VG      L  +Y  +L      P   L  
Sbjct: 131 EKLDPIKGFKRIYSMRAIVELIKSILKIVVVGFAAFAVLWLHYGEILRLPLLTPEEALSF 190

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
                  + +     +  L  LD  +    +   +KMSKQ+IKDE K+S G+PIIK++ K
Sbjct: 191 VSKLTLWMGLSGAGALLILAGLDYLYQRFDYEKNIKMSKQDIKDEYKKSEGDPIIKSKIK 250

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              R     +MM+   +A +IITNPTHYA+AL+Y + + DAP +VAKG + +A K+RKIA
Sbjct: 251 QRQREMAMRRMMQEVPKADVIITNPTHYAIALKYDEEKMDAPYIVAKGVDHLALKIRKIA 310

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            EH++ + E   LAR+L+ QV I+ A+P  F+K +A+++  +Y  K
Sbjct: 311 KEHDVMMVENRPLARALYDQVEIDQAVPEEFFKVLAEILAYVYKTK 356


>gi|329904716|ref|ZP_08273917.1| Flagellar biosynthesis protein FlhB [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327547860|gb|EGF32618.1| Flagellar biosynthesis protein FlhB [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 379

 Score =  341 bits (876), Expect = 9e-92,   Method: Composition-based stats.
 Identities = 98/353 (27%), Positives = 181/353 (51%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS+  +   KTE  S ++I+ A   G+ P SRE +    +LA    L    +  +  + +
Sbjct: 1   MSDE-SDMEKTEPASQQRIDKARENGDVPRSRELATCLVLLAAGGGLYISGANMLRQLKA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L +  + +  D S ++  L            P   + ++  + S L+    + + 
Sbjct: 60  ALASGL-TFDRGQAFDFSLLLSRLGSHLGDLLLAFAPLAGILILVALASPLLIGGWLFSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P+F R++L  G+ +I S+N LV   K+  K ++VG+I  + +      +L  +   
Sbjct: 119 QALAPNFGRMNLFSGLLKIVSLNALVELGKAVAKAVIVGSIAYLVMRSEIDEVLGLMVEP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             +   H    +    ++I++ +  +  +D  +    +  K+ M++QE++ E K+S GNP
Sbjct: 179 AEAGSMHMAKLLFSTYMLIVMGLVLIAAVDAPYQMWSYAKKMMMTRQEVRQEAKESEGNP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK + ++  R   R +MM     A +++TNPTHYA+AL+Y   +  AP +VAKG + +A
Sbjct: 239 EIKAKIRAQQREMARRRMMSEVPTADVVVTNPTHYAVALKYTDGKMGAPQVVAKGADAVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A  +N+P+ E P LAR+LFK V +  AIP   Y AVA+++  ++  K
Sbjct: 299 ARIRELAAANNVPLLEAPPLARALFKHVELGDAIPETLYTAVAEVLAYVFQLK 351


>gi|292669764|ref|ZP_06603190.1| flagellar biosynthetic protein FlhB [Selenomonas noxia ATCC 43541]
 gi|292648561|gb|EFF66533.1| flagellar biosynthetic protein FlhB [Selenomonas noxia ATCC 43541]
          Length = 374

 Score =  341 bits (876), Expect = 9e-92,   Method: Composition-based stats.
 Identities = 101/347 (29%), Positives = 176/347 (50%), Gaps = 3/347 (0%)

Query: 7   PDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLL 66
              KTE P++KK  DA  +G    S+E +    +L     L   +     S+ +    + 
Sbjct: 25  GGEKTEEPTAKKRADARKKGQVGRSQELNTAFVLLVGFFSLKLLWDSIYLSIATYTTYVF 84

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
           ++  Q    D  +I+ +   + +  ++   P +L  M+ G+     Q     +   ++  
Sbjct: 85  SNLNQ--TVDTENIIRIFIGIIIVLAKTAFPIMLFIMVIGLAINFFQVGLNFSAESIEFK 142

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
             +++   G  RI+S   LV   KSF KII++G  +   + E    M  F+  +  + L 
Sbjct: 143 LDKLNPINGFGRIFSKRALVELAKSFFKIIVIGFFLYRFIHEQILAMPQFMFFDLTTSLA 202

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
                + ++  +++  I  +   D G+   Q    LKM+KQE+KDE+KQ+ G+P IK + 
Sbjct: 203 LVAEIIFQMAFIVIGVIMIMAFCDYGYQRWQTTQDLKMTKQEVKDEMKQTEGDPQIKGKI 262

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           +   R     +MM+   +A +IITNPTHYA+AL Y Q    AP +VAKGQ+L+A+++++I
Sbjct: 263 RQKQRQMAMARMMKEVPKADVIITNPTHYAVALSYEQG-MVAPTVVAKGQDLVAQRIKEI 321

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
             +  +PI E   LAR+L+  V +  A+P   Y+AVA+++  +Y  K
Sbjct: 322 GRDARVPIIENKPLARTLYAAVQVGDAVPHELYQAVAEVLAYVYRLK 368


>gi|302670739|ref|YP_003830699.1| flagellar biosynthetic protein FlhB [Butyrivibrio proteoclasticus
           B316]
 gi|302395212|gb|ADL34117.1| flagellar biosynthetic protein FlhB [Butyrivibrio proteoclasticus
           B316]
          Length = 383

 Score =  341 bits (875), Expect = 9e-92,   Method: Composition-based stats.
 Identities = 97/357 (27%), Positives = 179/357 (50%), Gaps = 5/357 (1%)

Query: 2   SENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSD 61
           +E+     K+E P+SKK++DA  EG    S+E +   S+LA  + L F +     +  + 
Sbjct: 24  AEDANGAEKSEEPTSKKLDDARKEGQVAKSQEVATAFSLLAFFLILRFGYGFMGENFEAI 83

Query: 62  LHVLLASA-----TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIP 116
              +  +             +++I   +    L+   +  P  +   +      L+Q   
Sbjct: 84  FGSVYNTIPFVARMYDGFLPVNYIYSTINKALLTVLLICAPFFIFGFLIAFLCDLVQVGF 143

Query: 117 VLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDF 176
                 ++P   +++   G+K+I+S   + + +KS +K++++G +I    +    ++   
Sbjct: 144 KPTSKPLQPKLSKLNPISGMKKIFSTRKIFDLLKSILKLVIMGVVIISYFSNRQESIFLL 203

Query: 177 ISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQS 236
                   +      +  + I I      +   D+ +   +++  + M+KQE+KDE K +
Sbjct: 204 YDIPLKQAIGLMGSFIIDLGIRIAAAYMIIAFADLIYQRRKFHKDMMMTKQEVKDEFKNT 263

Query: 237 YGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQ 296
            GNP +K+ QK       R +MM+   +A ++ITNPTHYA+A+RY   E DAP++VAKG 
Sbjct: 264 EGNPEVKSAQKRRMMQASRRRMMQELPKADVVITNPTHYAVAIRYDAEEADAPIVVAKGA 323

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           + IA+K++++A E+N+ I E   LAR L+  V I   +PP  YKAVA+++  +YH K
Sbjct: 324 DYIAQKIKEVAKENNVEIVENKPLARMLYANVEIGEMVPPELYKAVAEVLAYVYHLK 380


>gi|92116950|ref|YP_576679.1| flagellar biosynthesis protein FlhB [Nitrobacter hamburgensis X14]
 gi|91799844|gb|ABE62219.1| flagellar biosynthetic protein FlhB [Nitrobacter hamburgensis X14]
          Length = 359

 Score =  341 bits (875), Expect = 9e-92,   Method: Composition-based stats.
 Identities = 114/353 (32%), Positives = 190/353 (53%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++      KTE P+ K+++DAL  G+   S+E + +  I    + L  F       V  
Sbjct: 1   MADESDDTEKTEDPTQKRLDDALERGDVAKSQEVNTWFVIAGATLVLATFGGSVGGGVEM 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  L+A++ Q + +    ++ L   L    +  +   LL+ M+  I   ++Q   V + 
Sbjct: 61  PLRNLIANSWQIRTDGPG-LLALAQQLEYILAAALGLPLLMLMLAAIAGNVVQHRFVWSG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +KP   ++S+  G KRI+      NF K   K++ +G ++T  L      +   +  +
Sbjct: 120 ETLKPKLSKISVVSGAKRIFGKQAAANFAKGLFKVLALGAVMTAVLWPERSRLDALVRLD 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P++IL        ++L  ++  +A + + D  + Y QW+ + KMS +E+K+E KQS G+P
Sbjct: 180 PNAILPTTTTLTLQLLGAVVAMLALVAIADYLFQYRQWFERQKMSLREMKEEFKQSEGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R + +  +R++ +MM A  +A++IITNPTHY++AL Y +    APV VAKG + IA
Sbjct: 240 HIKARIRQLRHARMKKRMMAAVPKASVIITNPTHYSVALSYERG-MSAPVCVAKGMDNIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA EH+IPI E   LAR+L+  V I+  IP   Y AVA++I  +   K
Sbjct: 299 LKIREIAREHDIPIVENVPLARALYATVKIDDEIPVEHYHAVAEIIGYVMGLK 351


>gi|259908202|ref|YP_002648558.1| Flagellar biosynthesis protein FlhB [Erwinia pyrifoliae Ep1/96]
 gi|224963824|emb|CAX55326.1| Flagellar biosynthesis protein FlhB [Erwinia pyrifoliae Ep1/96]
 gi|283478130|emb|CAY74046.1| Flagellar biosynthetic protein FlhB [Erwinia pyrifoliae DSM 12163]
          Length = 383

 Score =  341 bits (875), Expect = 9e-92,   Method: Composition-based stats.
 Identities = 96/353 (27%), Positives = 189/353 (53%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS  D+ + KTE+P++ ++E A  EG  P SRE +    ++  L  L          + +
Sbjct: 1   MS-QDSDEEKTESPTAHRLEKAREEGQIPRSRELTSLLMLMTGLSILWVGGEWMGRKMGA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L       + D S ++ L+ ++ L A   V+P +   ++  I + ++    V++ 
Sbjct: 60  LLADGLV-FNHSVVSDTSQMLRLIANMLLQAVMAVLPMMFGLVVVAIAAPMLLGGLVISG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K    +++  +G+ +++S+ +    +K+ +K  LVG +  + +  ++  ML  ++ +
Sbjct: 119 KAIKFDPGKMNPIKGLGKLFSVQSAAELLKAVLKATLVGVVCGLYIWHHWAGMLHLMAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + L  A   +    I+++L ++ +   D+ +    ++  L+MS Q+I+DE KQ  G+P
Sbjct: 179 PLTALAGAMNMIAMCCILVVLGLSPMVGFDVFYQLFSYFKNLRMSHQDIRDEHKQQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A +I+TNPTHY++AL+Y + +  AP +VAKG   IA
Sbjct: 239 HVKGRIRQQMRAAARRRMMADVPKADVIVTNPTHYSVALQYDEKKMSAPKVVAKGAGDIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++   + IP+ E P LAR+L++   I   IP   Y AVA+++  ++  +
Sbjct: 299 LRIRELGAANRIPVLEAPPLARALYRHSEIGQHIPGALYAAVAEVLAWVWQLR 351


>gi|162139705|ref|YP_877991.2| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           novyi NT]
          Length = 610

 Score =  341 bits (875), Expect = 9e-92,   Method: Composition-based stats.
 Identities = 100/347 (28%), Positives = 179/347 (51%), Gaps = 1/347 (0%)

Query: 7   PDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLL 66
            D+KTE  +  K+ +A  +G    S+E +    +L   I LL        S+  D+    
Sbjct: 262 SDDKTEEATPHKLSEARKKGQVAKSKEVNSAIILLTSTIILLTLGEYVANSLKKDIIEFF 321

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
            +     L     +  ++  ++   + + +P +L  M+ G+G+ L+Q   + +   +KP 
Sbjct: 322 TNYLNMNLNS-GSLQSIIVTIAWRFAVVFLPVVLPLMIMGVGANLLQTGYINSKETLKPQ 380

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
             +++   G K+I+S+  ++  +K    I ++G +    L  N+  +L   S     I+ 
Sbjct: 381 LSKINPINGFKKIFSMRTVMELLKDIAVIFVIGYVGYGFLKSNFNKVLSMTSLRFPVIIT 440

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
                   +   + L +  + ++D  +   Q+   ++MSKQEIK+E KQ  G+P IK + 
Sbjct: 441 SFLKLTTTIFFRVSLVMIAIALIDFMYQKFQFKKDMRMSKQEIKEEFKQMEGDPQIKGKI 500

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           K   R     +MM++   A+++ITNPTH A+AL+Y   ++ AP LVAKG + IA K+++I
Sbjct: 501 KQKQREMAMGRMMQSVPDASVVITNPTHIAVALKYEDGKDSAPTLVAKGSDYIAIKIKEI 560

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A E+ +PI E   LAR +FK+V + S IP   Y+AVA+++  +Y  K
Sbjct: 561 AKENEVPIIENKPLARLIFKEVELESEIPSEMYQAVAEILALVYKLK 607


>gi|307824492|ref|ZP_07654717.1| flagellar biosynthetic protein FlhB [Methylobacter tundripaludum
           SV96]
 gi|307734476|gb|EFO05328.1| flagellar biosynthetic protein FlhB [Methylobacter tundripaludum
           SV96]
          Length = 374

 Score =  341 bits (875), Expect = 9e-92,   Method: Composition-based stats.
 Identities = 103/353 (29%), Positives = 176/353 (49%), Gaps = 4/353 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS+ND    KTE P+ K++ DA  +G  P SRE + F  ++A    LL         +  
Sbjct: 1   MSDNDD---KTEDPTGKRLADARKKGQIPRSRELNTFVILMASATMLLTQGGTIGNGLLK 57

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +       ++  + D   I   L    +    L+ P + + ++  I + +     V + 
Sbjct: 58  IMRTTFR-LSRAAIFDPDSITLYLKQAMIDTVMLLAPFMAVMVVVAIVTPISMGGWVFSW 116

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +  +  +++   GI RI++I  LV   K+ +KI+LV  +           +L     +
Sbjct: 117 EAIAFNPSKMNPIAGIARIFAIRGLVELFKALLKILLVFAVAVALYRSFIGELLSLGGES 176

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   + HA   +   ++++   +  + ++D+ +        +KMSKQEIKDE K + G+P
Sbjct: 177 PIHSIGHALDIIGTCILLLSSSLILVVMIDVPYQLWDHSKNMKMSKQEIKDENKDAEGSP 236

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K RQ+ +     + +MME   +A +I+TNP+HYA+AL+Y Q  N AP LVAKG +LIA
Sbjct: 237 EVKGRQRRMQMETAQRRMMEEVPKADVIVTNPSHYAVALKYDQNSNSAPKLVAKGVDLIA 296

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R  A    +P+   P LAR+L+    ++  IP   Y AVAQ++  +Y  K
Sbjct: 297 AQIRNAAIGSGVPLVASPPLARALYYSTELDREIPQGLYLAVAQILAYVYQLK 349


>gi|395390|emb|CAA52218.1| flagellar biosynthetic protein [Bacillus subtilis]
          Length = 360

 Score =  341 bits (875), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 108/346 (31%), Positives = 181/346 (52%), Gaps = 1/346 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE  + KK +D   +G    S + +   S+L   + L+         + S +     
Sbjct: 12  GEKTEKATPKKRKDTRKKGQVAKSSDVNSAVSLLVIFLSLIAIGPYMRDRLLSFIETFYT 71

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
            +   KL + S++  L   L      ++ P LL+ ++ G+ S  +Q   + +   ++P  
Sbjct: 72  ESLTMKLSE-SNVHTLFVSLLKDMGMILAPILLVALVAGVVSNYMQVGFLFSAEVIQPKL 130

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
           +++   +G KRIYS+  +V  +KS +KI++VG      L  +Y  +L      P   L  
Sbjct: 131 EKLDPIKGFKRIYSMRAIVELIKSILKIVVVGFAAFAVLWLHYGEILRLPLLTPEEALSF 190

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
                  + +     +  L  LD  +    +   +KMSKQ+IKDE K+S G+PIIK++ K
Sbjct: 191 VSKLTLWMGLSGAGALLILAGLDYLYQRFDYEKNIKMSKQDIKDEYKKSEGDPIIKSKIK 250

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              R     +MM+   +A +IITNPTHYA+AL+Y + + DAP +VAKG + +A K+RKIA
Sbjct: 251 QRQREMAMRRMMQEVPKADVIITNPTHYAIALKYDEEKMDAPYIVAKGVDHLALKIRKIA 310

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            EH++ + E   LAR+L+ QV I+ A+P  F+K +A+++  +Y  K
Sbjct: 311 KEHDVMMVENRPLARALYDQVEIDQAVPEEFFKVLAEILAYVYKTK 356


>gi|330808231|ref|YP_004352693.1| flagellar biosynthetic protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327376339|gb|AEA67689.1| flagellar biosynthetic protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 378

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 97/353 (27%), Positives = 178/353 (50%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+++  +KTE P+ K++ ++  +G    S+E +  + +LA    LL +       +  
Sbjct: 1   MAESESGQDKTEDPTEKRLRESREKGETARSKELNTLAVMLAGAGGLLIYGGGLALDLLE 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            + +   S  +  L     +   L H    A   + P L+  ++  +   +     +   
Sbjct: 61  IMRLNF-SLPREVLLTPGSMAQYLLHSGKIAILAIQPVLIFLLLAAVIGPISLGGWLFAA 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++   G+KR++S + L+  +K+F K +LV  +    L  +   +L      
Sbjct: 120 GSLAPKFSRMNPAAGLKRMFSTSALMELLKAFGKFLLVLFVALTVLQSDIDDLLRIAHEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V    + I   +  +  +D+    +Q   KL M+KQE++DE K S G P
Sbjct: 180 LEQAIIHSVQLVGWSTLWIACGLILIAAIDVPIQLYQSKQKLMMTKQEVRDEHKDSEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM A   A ++ITNPTHYA+AL+Y   + +APVL+AKG + +A
Sbjct: 240 EVKQRIRQLQREVSQRRMMAAIPDADVVITNPTHYAVALKYDPEKGNAPVLLAKGSDFLA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA  + + + E P+LARS++    ++  IP   Y AVAQ++  +Y  +
Sbjct: 300 LKIREIAVANEVMLLESPALARSIYYSTELDQEIPGGLYLAVAQVLAYVYQIR 352


>gi|118133499|gb|ABK60543.1| flagellar biosynthetic protein FlhB [Clostridium novyi NT]
          Length = 575

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 100/347 (28%), Positives = 179/347 (51%), Gaps = 1/347 (0%)

Query: 7   PDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLL 66
            D+KTE  +  K+ +A  +G    S+E +    +L   I LL        S+  D+    
Sbjct: 227 SDDKTEEATPHKLSEARKKGQVAKSKEVNSAIILLTSTIILLTLGEYVANSLKKDIIEFF 286

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
            +     L     +  ++  ++   + + +P +L  M+ G+G+ L+Q   + +   +KP 
Sbjct: 287 TNYLNMNLNS-GSLQSIIVTIAWRFAVVFLPVVLPLMIMGVGANLLQTGYINSKETLKPQ 345

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
             +++   G K+I+S+  ++  +K    I ++G +    L  N+  +L   S     I+ 
Sbjct: 346 LSKINPINGFKKIFSMRTVMELLKDIAVIFVIGYVGYGFLKSNFNKVLSMTSLRFPVIIT 405

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
                   +   + L +  + ++D  +   Q+   ++MSKQEIK+E KQ  G+P IK + 
Sbjct: 406 SFLKLTTTIFFRVSLVMIAIALIDFMYQKFQFKKDMRMSKQEIKEEFKQMEGDPQIKGKI 465

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           K   R     +MM++   A+++ITNPTH A+AL+Y   ++ AP LVAKG + IA K+++I
Sbjct: 466 KQKQREMAMGRMMQSVPDASVVITNPTHIAVALKYEDGKDSAPTLVAKGSDYIAIKIKEI 525

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A E+ +PI E   LAR +FK+V + S IP   Y+AVA+++  +Y  K
Sbjct: 526 AKENEVPIIENKPLARLIFKEVELESEIPSEMYQAVAEILALVYKLK 572


>gi|325291951|ref|YP_004277815.1| flagellar biosynthesis protein FlhB [Agrobacterium sp. H13-3]
 gi|325059804|gb|ADY63495.1| flagellar biosynthesis protein FlhB [Agrobacterium sp. H13-3]
          Length = 360

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 152/353 (43%), Positives = 233/353 (66%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++   D+KTE P+ KK+ DA  +GN P SRE  +F+S LA   YL+FF   G   +  
Sbjct: 1   MADDQDKDSKTEDPTEKKLRDAAEKGNLPFSREVPIFASSLAFYCYLVFFLPDGAGRLGV 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  L     Q  L      + LL  L  S + L++P +++F++FG+ S   Q +P   L
Sbjct: 61  TLKDLFGQPEQWNLSTRPDALSLLYFLGTSMAYLLMPAMIMFIVFGLASSFFQNLPSPVL 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             V+P + R+S  +G  RIYS    V F KS  KI++V  I+ +SL  ++++++D + ++
Sbjct: 121 ERVRPQWSRISPAKGFGRIYSKQGFVEFGKSLFKILIVSIIMFLSLRGDFYSLIDLMFSD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P  I        +K++++IL   A L  +D+ W+ H W+S+LKM+K E+K+E KQS G+P
Sbjct: 181 PQVIFVRVVELTKKMMVVILFSTALLAAVDLLWTRHHWFSQLKMTKHEVKEEYKQSQGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           ++K RQ+S+AR R R +M++   RAT++I NPTH+A+ALRY++ E DAPV+VAKGQ+LIA
Sbjct: 241 VVKARQRSVARDRARRRMIDNVPRATLVIANPTHFAVALRYVREEGDAPVVVAKGQDLIA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA ++NIP+FE+P LARS+F QV I+S IPP FYKAVA+L++++Y  K
Sbjct: 301 LKIREIAEKNNIPVFEDPPLARSMFAQVSIDSVIPPAFYKAVAELVHRVYAMK 353


>gi|238924151|ref|YP_002937667.1| flagellar biosynthesis/type III secretory pathway protein
           [Eubacterium rectale ATCC 33656]
 gi|238875826|gb|ACR75533.1| flagellar biosynthesis/type III secretory pathway protein
           [Eubacterium rectale ATCC 33656]
 gi|291524884|emb|CBK90471.1| flagellar biosynthetic protein FlhB [Eubacterium rectale DSM 17629]
          Length = 382

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 94/355 (26%), Positives = 177/355 (49%), Gaps = 5/355 (1%)

Query: 2   SENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSD 61
           +++     KTE  + KK++DA  EG    S+E +    ++   + L  F S    ++   
Sbjct: 25  AQDGEGGEKTEPATEKKLKDAREEGKVAKSKELTAAFDLIVLFLVLKIFISFVGGNLIGL 84

Query: 62  LHVLLASATQRKLEDISHI-----VFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIP 116
              +         E    I        L ++ L     V+P     ++  I   +IQ   
Sbjct: 85  FSTVYKKMPDFLKESQEQISSVSVTHYLNNVILQFLLTVLPFFAFGVVITILVSIIQVGF 144

Query: 117 VLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDF 176
            ++   + P   + +   G KRI S +++   +KS +K+ ++  +   S+  +   +   
Sbjct: 145 KISTKPMAPKLSKFNPINGFKRILSKDSIFELLKSVLKVGIIMYVAYSSVKSHQNDIFIL 204

Query: 177 ISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQS 236
                   +      +    + I +    + + D  ++ H++ + +KM+KQE+KDE K +
Sbjct: 205 YELPLKQAIVLIGDIIINTGLKISIVYMIVGIADFAYNKHKFNNDMKMTKQEVKDEFKNT 264

Query: 237 YGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQ 296
            G+P IK +Q+   +   + +MM+   +A ++ITNPTH+A+A++Y   +NDAPV+VAKGQ
Sbjct: 265 EGDPAIKGQQRKRMQEASQRRMMQDVPKADVVITNPTHFAVAVKYDAQKNDAPVVVAKGQ 324

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           + +A+K+++IA ++NI I E   LAR LF  V + + IPP  Y++VA+++  IY 
Sbjct: 325 DYVAQKIKEIARDNNIHIVENKPLARMLFHNVDLGAEIPPELYRSVAEILAMIYK 379


>gi|328543170|ref|YP_004303279.1| flagellar biosynthesis protein B [polymorphum gilvum SL003B-26A1]
 gi|326412916|gb|ADZ69979.1| Flagellar biosynthesis protein B [Polymorphum gilvum SL003B-26A1]
          Length = 359

 Score =  340 bits (873), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 111/353 (31%), Positives = 190/353 (53%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++     KTE P+ K++++A  +G+ P S+E S + ++    + +  F       + +
Sbjct: 1   MADDTDDSEKTEDPTQKRLKEAHEKGDLPKSQEVSTWFTLAGAAMMIALFAPAVTTELGT 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L  A +    D   +  L      S + +V   LL  +   +   L+Q   V   
Sbjct: 61  QLKWYLEHAHEIPA-DGYALKALWRDTGQSVALIVGLPLLALVAMAVAGNLVQHEAVFTA 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +KP   +VS   G KR++S  +L+NF K  +KI++VG ++   L          I  +
Sbjct: 120 EPIKPKLSKVSPLSGFKRLFSGQSLMNFAKGMLKIVIVGAVMVAVLWPQRDRAEAVIFVD 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             S+L  A   V ++L  +L  +  +   D  W  H+W+ K KMS +E+K+E KQ+ G+P
Sbjct: 180 VSSLLEEARGLVLQLLAAVLAIMTVVAGADYVWQRHKWFEKQKMSMRELKEEYKQTEGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           ++K + + +   R R +MM A  +AT+++TNPTHYA+ALRY +    AP+ VAKG + IA
Sbjct: 240 LVKGKIRQLRMERSRKRMMAAVPQATVVVTNPTHYAVALRYEEG-MGAPLCVAKGTDAIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++A +H +P+ E P LAR+L+  V ++  IP   YKAVA++I  ++  +
Sbjct: 299 LKIREVARQHEVPVVENPPLARALYASVDVDREIPEDHYKAVAEVIGFVFRMR 351


>gi|229513771|ref|ZP_04403233.1| flagellar biosynthesis protein FlhB [Vibrio cholerae TMA 21]
 gi|229348952|gb|EEO13909.1| flagellar biosynthesis protein FlhB [Vibrio cholerae TMA 21]
          Length = 376

 Score =  340 bits (873), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 87/353 (24%), Positives = 178/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+D    +TE  ++++++ A  +G    S+E +  S ++   + L++F       +  
Sbjct: 1   MAESD-GQERTEEATTRRLQQAKEKGQVARSKELASVSVLVVGAVSLMWFGEILAKGLMV 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L    ++ ++ D+  +  ++    ++    ++  L    +  +           + 
Sbjct: 60  AMQRLFE-LSREEIFDLGKLFDIIGGSLVNLLLPLLMILTTLFIAALIGAAGVGGISFSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   +++   G+KR++ + + V  +KS +K++LV  +    +  +   +       
Sbjct: 119 EAAMPKLSKMNPLSGLKRMFGMQSWVELLKSILKVLLVSGVAFYLIEASQKDLFQLSLDV 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               ++HA   +   +++I   +  +  +DI +   Q   +LKM+KQE+KDE K + G P
Sbjct: 179 YPQNIFHALDILLNFVLLISCSLLVVVAIDIPFQIWQHAEQLKMTKQEVKDEYKDTEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM A  +A +IITNP H+++ALRY Q  + APV++AKG + +A
Sbjct: 239 EVKGRIRMLQREAAQRRMMAALPQADVIITNPEHFSVALRYKQNTDKAPVVIAKGVDHMA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA E++I I   P LAR+L+    +   IP   + AVAQ++  ++  K
Sbjct: 299 LKIREIAREYDIAIVPAPPLARALYHTTELEQQIPDGLFVAVAQVLAFVFQLK 351


>gi|292488559|ref|YP_003531443.1| flagellar biosynthetic protein FlhB [Erwinia amylovora CFBP1430]
 gi|292899731|ref|YP_003539100.1| flagellar biosynthetic protein FlhB [Erwinia amylovora ATCC 49946]
 gi|291199579|emb|CBJ46696.1| flagellar biosynthetic protein FlhB [Erwinia amylovora ATCC 49946]
 gi|291553990|emb|CBA21035.1| Flagellar biosynthetic protein FlhB [Erwinia amylovora CFBP1430]
 gi|312172704|emb|CBX80960.1| Flagellar biosynthetic protein FlhB [Erwinia amylovora ATCC
           BAA-2158]
          Length = 383

 Score =  340 bits (873), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 99/353 (28%), Positives = 189/353 (53%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS  D+ + KTE+P++ ++E A  EG  P SRE +    ++  L  L          + +
Sbjct: 1   MS-QDSDEEKTESPTAHRLEKAREEGQIPRSRELTSILMLITGLSILWVGGEWMGRKMGA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L       + D S ++ L+ ++ L A   V+P +   ++  I + ++    VL+ 
Sbjct: 60  LLADGLV-FNHSVVSDSSQMLRLVANMLLQAVMAVLPMMFGLVVVAIAAPMLLGGLVLSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K    +++  +G+ +++S  +    +K+ +K  LVG +  + +  ++  ML  ++ +
Sbjct: 119 KAIKFDPGKMNPVKGLAKLFSAQSASELLKAVLKATLVGIVCGLYIWHHWAGMLHLMAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   L  A   +    I+++L ++ +   D+ +    ++  L+MS Q+I+DE KQ  G+P
Sbjct: 179 PLIALAGAMNMIAMCCILVVLGLSPMVGFDVFFQLFSYFKNLRMSHQDIRDEHKQQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A +I+TNPTHY++AL+Y + +  AP ++AKG   IA
Sbjct: 239 HVKGRIRQQMRAAARRRMMADVPKADVIVTNPTHYSVALQYDEKKMSAPKVLAKGAGDIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A E+ IPI E P LAR+L++   I   IP   Y AVA+++  ++  +
Sbjct: 299 LRIRELAAENRIPILEAPPLARALYRHSEIGQHIPGTLYAAVAEVLAWVWQLR 351


>gi|254420201|ref|ZP_05033925.1| flagellar biosynthetic protein FlhB [Brevundimonas sp. BAL3]
 gi|196186378|gb|EDX81354.1| flagellar biosynthetic protein FlhB [Brevundimonas sp. BAL3]
          Length = 358

 Score =  340 bits (873), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 100/353 (28%), Positives = 187/353 (52%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++  P++KTE  + +K+EDA  +G+   S++     S+      +L        S+  
Sbjct: 1   MADDTDPESKTEDATPRKLEDARKKGDVAKSQDVGQVLSLAGAAAVILGAGGWFAGSMAQ 60

Query: 61  DLHVLLASATQRK-LEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLN 119
            L   +A+  Q   + D      +L     + +  +   +L  ++ G G +L Q   +  
Sbjct: 61  QLLPFIAAPHQMLGMLDSGAGAQILAQALWAMTPFLGAVMLATIIGGAGGHLAQSGLIFT 120

Query: 120 LNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISA 179
              +KP +  V+   G KRI+  + L+ F+K+F+K+I V  +  + L  +     + ++ 
Sbjct: 121 AEKLKPKWSSVNPMSGFKRIFGPDGLMQFVKTFLKLIAVCVVCWMVLKPHVREFENMVTL 180

Query: 180 NPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
           +P ++L  A      + +  ++ +      D  W   ++  +++M+K+E+K++ KQS G+
Sbjct: 181 SPAALLPLARDMALALFVAAIILLGATAGADFIWQKMRFAKRMRMTKEELKEDYKQSEGD 240

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQ-TENDAPVLVAKGQNL 298
           P IK + K I   R R +MM    +AT+I+TNPTHY++ALRY     + APV VAKG + 
Sbjct: 241 PHIKAKLKQIRMQRSRQRMMANVPKATVIVTNPTHYSVALRYEPSEGDGAPVCVAKGVDA 300

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           +A ++R++A EH +PI E   LAR+L+  V I++ IP   ++A A++I  ++ 
Sbjct: 301 LAMRIREVAKEHGVPIVENVPLARALYASVEIDAVIPKEHFEAAAKIIGFVFQ 353


>gi|239997097|ref|ZP_04717621.1| flagellar biosynthesis protein [Alteromonas macleodii ATCC 27126]
          Length = 374

 Score =  340 bits (873), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 92/353 (26%), Positives = 178/353 (50%), Gaps = 4/353 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+       KTE P+ KK+EDA  +G    SRE S    ++      LF       SV  
Sbjct: 1   MA---DSSEKTEDPTGKKLEDARKKGQLARSRELSTTLVLIVSAFMFLFVGGWIAESVFK 57

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
               +    ++ +  DI+H+         +    V+  +++ M+ GI   +         
Sbjct: 58  LTQRMFI-LSRDETYDITHMFGAWGEAFSAVGPTVLLYMVVAMIAGIYGSIALGGFNFTW 116

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
              KP   ++S  +G KR++ +N LV  +KS  K++++  +   +L       L      
Sbjct: 117 EGAKPKGSKMSPIQGFKRMFGMNGLVELLKSIAKVVVIIGMAIGALLFFEDEALHLDMEL 176

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               ++HA   ++   ++++  +  + ++D+ +  ++   ++KM+KQE+KDE K + G+P
Sbjct: 177 YPGNIFHALDMLKWAFLILVCGMIPIALIDVPYQMYKHNKEMKMTKQEVKDERKNAEGDP 236

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           ++K R + +       +MM+   +A +++TNPTH+++A++Y +    APV+VAKG + +A
Sbjct: 237 MVKGRIRRLQYQAATKRMMQEVPQADVVVTNPTHFSVAIKYDEKGVRAPVVVAKGADELA 296

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
             +RKIA  +++P+   P LAR++F    ++  IP   + AVAQ++  +Y  K
Sbjct: 297 MHIRKIATANDVPLIPSPMLARAIFYSTEVDDEIPNALFMAVAQVLAHVYQLK 349


>gi|153213288|ref|ZP_01948700.1| flagellar biosynthetic protein FlhB [Vibrio cholerae 1587]
 gi|229528868|ref|ZP_04418258.1| flagellar biosynthesis protein FlhB [Vibrio cholerae 12129(1)]
 gi|124116088|gb|EAY34908.1| flagellar biosynthetic protein FlhB [Vibrio cholerae 1587]
 gi|229332642|gb|EEN98128.1| flagellar biosynthesis protein FlhB [Vibrio cholerae 12129(1)]
          Length = 376

 Score =  340 bits (873), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 87/353 (24%), Positives = 178/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+D    +TE  ++++++ A  +G    S+E +  S ++   + L++F       +  
Sbjct: 1   MAESD-GQERTEEATTRRLQQAKEKGQVARSKELASVSVLVVGAVSLMWFGEILAKGLMV 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L    ++ ++ D+  +  ++    ++    ++  L    +  +           + 
Sbjct: 60  AMQRLFE-LSREEIFDLGKLFDIIGGSLVNLLLPLLMILTTLFIAALIGAAGVGGISFSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
               P   +++   G+KR++ + + V  +KS +K++LV  +    +  +   +       
Sbjct: 119 EAAMPKLSKMNPLSGLKRMFGMQSWVELLKSILKVLLVSGVAFYLIEASQKDLFQLSLDV 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               ++HA   +   +++I   +  +  +DI +   Q   +LKM+KQE+KDE K + G P
Sbjct: 179 YPQNIFHALDILLNFVLLISCSLLVVVAIDIPFQIWQHAEQLKMTKQEVKDEYKDTEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM A  +A +IITNP H+++ALRY Q  + APV++AKG + +A
Sbjct: 239 EVKGRIRMLQREAAQRRMMAALPQADVIITNPEHFSVALRYKQNTDKAPVVIAKGVDHMA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA E++I I   P LAR+L+    +   IP   + AVAQ++  ++  K
Sbjct: 299 LKIREIAREYDIAIVPAPPLARALYHTTELEQQIPDGLFVAVAQVLAFVFQLK 351


>gi|288958052|ref|YP_003448393.1| flagellar biosynthetic protein [Azospirillum sp. B510]
 gi|288910360|dbj|BAI71849.1| flagellar biosynthetic protein [Azospirillum sp. B510]
          Length = 358

 Score =  340 bits (873), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 103/353 (29%), Positives = 196/353 (55%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE+    +KTE P+ KK+++A  +G   ++REA+ +  + A L+ L+      +  +  
Sbjct: 1   MSEDADESSKTEDPTGKKLDEAHRQGQFAMTREAANWLMVAAMLVVLVSVLPGTMKGLVF 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L+    +  Q    D + +  LL  +       +   +LLF++ G+ + + Q    ++ 
Sbjct: 61  RLNYYFENLDQF-TFDRAGVGALLFRVMRDVMWALWLPILLFVVAGVMATIGQTGFHVSW 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F +++   G+  ++  N  V  +KS VK+ +VG +  ++L   +  +  +I  +
Sbjct: 120 QLIEPKFSKLNPLPGLMNMFKANQAVELLKSIVKLAVVGGVAYMALRPMFGGIETYIGID 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             ++L        ++LI +L+ +  +   D  W   Q+  ++KM+KQE+KDE KQ  G+P
Sbjct: 180 LITMLSQMDGLAHRLLIWVLVVLTFIAAGDFLWQKKQFDKQMKMTKQEVKDEHKQQEGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           ++K R + I   R R +MM A   A +++TNPTH+A+AL+Y  ++  AP+++AKG + +A
Sbjct: 240 VVKGRIRQIRFERARKRMMAAVPDADVVVTNPTHFAVALKYDPSQMGAPLVLAKGVDQVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA  +N+P+ E P LAR+L+    I+  +P   Y+AVA++I  ++  K
Sbjct: 300 FKIREIAESNNVPVIENPPLARALYAACDIDEEVPSEHYRAVAEVITYVFKLK 352


>gi|188991600|ref|YP_001903610.1| flagellar biosynthesis protein FlhB [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167733360|emb|CAP51561.1| unnamed protein product [Xanthomonas campestris pv. campestris]
          Length = 376

 Score =  339 bits (871), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 92/353 (26%), Positives = 176/353 (49%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE++    +TE P+ K++ +A  +GN P SRE S  +     +  L+   + GI    S
Sbjct: 1   MSESEDGGERTELPTEKRLREAREQGNIPQSRELSTAAVFGTGVFALMLM-ARGIGDGAS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
                  S   +  E+   +      L L    +++P + + +  G+   L+      + 
Sbjct: 60  VWMKTALSPDPKMRENPMALFGHFGDLLLQLLWVMVPLIGICLAAGLVGPLLMSGLHFSG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   +++   GIKR++  N+L   +KS ++++ VG   ++ +++    +   ++  
Sbjct: 120 KAIMPDLNKLNPMNGIKRMWGSNSLAELVKSILRLLFVGLAASLCISKGLHGLRSLVNQP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + +     + +L      +  L   D  +    W  KLKM+++EIK E+K+S G+P
Sbjct: 180 LEQAVGNGLDFTKSLLFYTAGALVLLAAFDAPYQKWNWLRKLKMTREEIKREMKESEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + +     + +MMEA   A +++ NPTHYA+AL+Y   +  APV+VAKG + +A
Sbjct: 240 EVKGRIRQMQMQMSQRRMMEALPTADVVLMNPTHYAVALKYEGGKMRAPVVVAKGVDEMA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+   +H + I   P LAR+L+++  +   IP   Y  VAQ++  +Y  +
Sbjct: 300 FRIREACEQHRVAIVTAPPLARALYREAQLGKEIPVRLYSVVAQVLSYVYQLR 352


>gi|332140595|ref|YP_004426333.1| flagellar biosynthesis protein [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327550617|gb|AEA97335.1| flagellar biosynthesis protein [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 374

 Score =  339 bits (871), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 92/353 (26%), Positives = 178/353 (50%), Gaps = 4/353 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+       KTE P+ KK++DA  +G    SRE S    ++   +  LF       SV  
Sbjct: 1   MA---DSSEKTEDPTGKKLDDARKKGQLARSRELSTTLVLIVSAVMFLFVGGWIAESVFK 57

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
               +    ++ +  DI+H+         +    V+  +++ M+ GI   +         
Sbjct: 58  LTRRMFI-LSRDETYDITHMFGAWGEAFSAVGPAVLLYMVVAMIAGIYGSIALGGFNFTW 116

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
              KP   ++S  +G KR++  N LV  +KS  K++++  +   +L       L      
Sbjct: 117 EGAKPKGSKMSPIQGFKRMFGTNGLVELLKSIAKVVVIIGMAIGALLFFEDEALHLDMEL 176

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               L+HA   ++   ++++  +  + ++D+ +  ++   ++KM+KQE+KDE K + G+P
Sbjct: 177 YPGNLFHAMDILKWAFLILVCGMIPIALIDVPYQMYKHNKEMKMTKQEVKDERKNAEGDP 236

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           ++K R + +       +MM+   +A +++TNPTH+++A++Y +    APV+VAKG + +A
Sbjct: 237 MVKGRIRRLQYQAATKRMMQEVPQADVVVTNPTHFSVAIKYDEKGIRAPVVVAKGADELA 296

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
             +RKIA  +++P+   P LAR++F    ++  IP   + AVAQ++  +Y  K
Sbjct: 297 MHIRKIATANDVPLIPSPMLARAIFYSTEVDDEIPNALFMAVAQVLAHVYQLK 349


>gi|259907600|ref|YP_002647956.1| Flagellar biosynthetic protein FlhB [Erwinia pyrifoliae Ep1/96]
 gi|224963222|emb|CAX54706.1| Flagellar biosynthetic protein FlhB [Erwinia pyrifoliae Ep1/96]
 gi|283477442|emb|CAY73358.1| Flagellar biosynthetic protein FlhB [Erwinia pyrifoliae DSM 12163]
          Length = 381

 Score =  339 bits (870), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 96/353 (27%), Positives = 180/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS  ++ + KTEAP+  +I  A  EG  P S+E +    +L     +L      + S+ S
Sbjct: 1   MS-QESDNEKTEAPTPSRIAKAREEGQIPRSKELTTLLMLLVGWGLMLCSGGNLVRSLQS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            LH  +    +  + D + ++   + L   A + ++P +   ++  + +  +    +L+ 
Sbjct: 60  LLHNAMI-FDRLLILDPAQMLQRSSSLLGQAFKAIMPFVFGLLLTAVSAPPLIGGLILSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P  K+++   GIKR++S       +K+ +K++L      + L  N    +  I   
Sbjct: 119 KSLAPKLKKLNPLSGIKRMFSAQMASEMVKAILKVLLATLGGGLYLLLNKEKFIRLIFEP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               L      +   L+ +++ +  +   D+ +  +  + KL+MS+QEIKDE K+  G+P
Sbjct: 179 LGMALTDISGLLLGCLLAVIMSLIPMVAFDVIYQLYSHWKKLRMSRQEIKDEFKKQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R + + R+  + +MM     A +I+ NPTHY++AL+Y      AP +VAKG  L+A
Sbjct: 239 QIKGRVRQMQRAMAQRRMMTDVPDADVIVNNPTHYSVALKYQDGSLGAPKVVAKGSGLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A  H +P+ E P LAR+L++   I + IP   Y AVA+++  +Y  +
Sbjct: 299 LRIRELAENHKVPMLEAPPLARALYRHCEIGAPIPADLYHAVAEVLAWVYSLR 351


>gi|148269163|ref|YP_001243623.1| flagellar biosynthetic protein FlhB [Thermotoga petrophila RKU-1]
 gi|281411461|ref|YP_003345540.1| flagellar biosynthetic protein FlhB [Thermotoga naphthophila
           RKU-10]
 gi|147734707|gb|ABQ46047.1| flagellar biosynthetic protein FlhB [Thermotoga petrophila RKU-1]
 gi|281372564|gb|ADA66126.1| flagellar biosynthetic protein FlhB [Thermotoga naphthophila
           RKU-10]
          Length = 374

 Score =  339 bits (870), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 101/345 (29%), Positives = 185/345 (53%), Gaps = 6/345 (1%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            +TE  + +K      EG AP+SRE ++  + L   + L  F   G+  +T D+   L+ 
Sbjct: 32  ERTERATPRKRRRVREEGRAPVSRELNMAVTFLVFALALKIFGYQGVERITEDVQAFLS- 90

Query: 69  ATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFK 128
                 E+   ++    +       ++   ++  M+ G+    +Q   +     +KP   
Sbjct: 91  -----FEETEDLLVNAVNTFKDVLLIIGAFVVFSMVAGVMIGALQTRFLFAPKALKPDLN 145

Query: 129 RVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHA 188
           R++  EG KR++S+ +LV  +KS +K+ +VG ++   L   +  M+     N +    + 
Sbjct: 146 RINPIEGFKRLFSLRSLVELLKSVLKVAIVGIVVYQVLKNRWDEMILLTEMNVNDAFANF 205

Query: 189 FFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKS 248
           +    ++ +   + +  L V D  +   ++   ++M+KQE+KDE+K+  GNP IK RQ+ 
Sbjct: 206 WDIASEITLKSGMVLLALAVFDYFYQRWEFEKSIRMTKQEVKDELKEVEGNPEIKRRQRQ 265

Query: 249 IARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAY 308
           +    +R +MME   +A ++ITNPTH+A+AL+Y     +APV+VAKG + +A K+ +IA 
Sbjct: 266 MMYDILRRRMMEEVPKADVVITNPTHFAVALKYDPDTMNAPVVVAKGVDHLALKIIEIAK 325

Query: 309 EHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           E+++P+   PSLAR+L+ +  I   IP  FY+ VA+++  +Y KK
Sbjct: 326 ENDVPVLRNPSLARALYYKTEIGEEIPVEFYRIVAEVLVYVYTKK 370


>gi|163852023|ref|YP_001640066.1| flagellar biosynthetic protein FlhB [Methylobacterium extorquens
           PA1]
 gi|163663628|gb|ABY30995.1| flagellar biosynthetic protein FlhB [Methylobacterium extorquens
           PA1]
          Length = 354

 Score =  339 bits (870), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 112/353 (31%), Positives = 191/353 (54%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS+    ++KTE P+ ++IE A+  G+ P S E + F  + A  + L+    P    +T 
Sbjct: 1   MSDETDDEDKTEDPTPRRIEQAIERGDVPNSPEINTFFILAAFTLALMLSARPVAEGLTR 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           D+   L  A     +  +++   L    + A  L +P L + M+  I + LIQ  P+   
Sbjct: 61  DMRGFLEHAGGLPSDSGTYLGVALRAAWVCAKALAVP-LGIAMLAAIAAGLIQHRPIFTA 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R+S   G KR+  ++  VNF K   KII+VGTI    L   +     F   +
Sbjct: 120 ESLMPKFARISPMAGAKRLLGMDAWVNFGKGLAKIIVVGTIAGTILWSEHDRAESFAQLD 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   L        K++  +L   A + + D  +  ++W+ +L+M+K+E+K E K+S G+P
Sbjct: 180 PGVALQGTLTLALKMMGGMLAVYAVIALGDALYQRNRWHKRLRMTKEEMKQEHKESEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + ++R++ +MM A   AT+++TNPTH+A+ALRY      AP+ VAKG + +A
Sbjct: 240 EVKARIRQLRQARVKKRMMAAVPTATVVVTNPTHFAVALRYEAG-MAAPICVAKGVDSLA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R +A +H++P+ E P LAR+L   V ++  IP   Y+AVA++I  +   +
Sbjct: 299 LRIRAVATDHDVPVMENPPLARALHATVEVDEEIPAEHYRAVAEVIGFVLRLR 351


>gi|146282913|ref|YP_001173066.1| flagellar biosynthesis protein FlhB [Pseudomonas stutzeri A1501]
 gi|145571118|gb|ABP80224.1| flagellar biosynthetic protein FlhB [Pseudomonas stutzeri A1501]
          Length = 378

 Score =  339 bits (870), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 97/353 (27%), Positives = 180/353 (50%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+++  +K+E P+ K++ ++  +G    SRE S  +  L  +  LL        ++ +
Sbjct: 1   MAESESGADKSEEPTEKRLRESREKGQLARSRELSTVAVTLGGIGGLLASGGGLAQTLMA 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +       ++  L D   +V LL    L A   ++P L+  ++  I   +     + + 
Sbjct: 61  MMQGTFE-LSRETLLDEGAMVRLLMGSGLMALEAIMPLLIALLIASIVGPVALGGWLFSA 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   R++   G+KR++S   LV  +K+  K ++V  +  + L+     +L      
Sbjct: 120 KAMAPKVSRMNPAAGLKRMFSTKALVELLKALGKFLVVLGVALLVLSAYQDDLLSIAKQP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V    + +   +  +  +D+ +       KL M+KQE+KDE K S G P
Sbjct: 180 LDLAIMHSVEIVGWCALWMACGLIIIAAVDVPFQLWDNKQKLMMTKQEVKDEYKDSEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K+R + + R   + +MM+A   A ++ITNPTH+A+AL+Y   +  AP LVAKG + +A
Sbjct: 240 EVKSRIRQLQREAAQRRMMQAVPEADVVITNPTHFAVALKYDGDKGGAPRLVAKGGDFVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA EH + + E P+LAR+++    ++  IP   Y AVAQ++  +Y  +
Sbjct: 300 LKIREIAQEHKVTVLESPALARAVYYSTELDQEIPAGLYLAVAQVLAYVYQLR 352


>gi|21231358|ref|NP_637275.1| flagellar biosynthesis protein FlhB [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66768589|ref|YP_243351.1| flagellar biosynthesis protein FlhB [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|21113019|gb|AAM41199.1| flagellar protein [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66573921|gb|AAY49331.1| flagellar protein [Xanthomonas campestris pv. campestris str. 8004]
          Length = 376

 Score =  339 bits (870), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 92/353 (26%), Positives = 176/353 (49%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE++    +TE P+ K++ +A  +GN P SRE S  +     +  L+   + GI    S
Sbjct: 1   MSESEDGGERTELPTEKRLREAREQGNIPQSRELSTAAVFGTGVFALMLM-ARGIGDGAS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
                  S   +  E+   +      L L    +++P + + +  G+   L+      + 
Sbjct: 60  VWMKTALSPDPKMRENPMALFGHFGDLLLQLLWVMVPLIGICLAAGLVGPLLMSGLHFSG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   +++   GIKR++  N+L   +KS ++++ VG   ++ +++    +   ++  
Sbjct: 120 KAIMPDLNKLNPMNGIKRMWGSNSLAELVKSILRLLFVGLAASLCISKGLHGLRSLVNRP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + +     + +L      +  L   D  +    W  KLKM+++EIK E+K+S G+P
Sbjct: 180 LEQAVGNGLDFTKSLLFYTAGALVLLAAFDAPYQKWNWLRKLKMTREEIKREMKESEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + +     + +MMEA   A +++ NPTHYA+AL+Y   +  APV+VAKG + +A
Sbjct: 240 EVKGRIRQMQMQMSQRRMMEALPTADVVLMNPTHYAVALKYEGGKMRAPVVVAKGVDEMA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+   +H + I   P LAR+L+++  +   IP   Y  VAQ++  +Y  +
Sbjct: 300 FRIREACEQHRVAIVTAPPLARALYREAQLGKEIPVRLYSVVAQVLSYVYQLR 352


>gi|188533614|ref|YP_001907411.1| Flagellar biosynthesis protein FlhB [Erwinia tasmaniensis Et1/99]
 gi|188028656|emb|CAO96518.1| Flagellar biosynthesis protein FlhB [Erwinia tasmaniensis Et1/99]
          Length = 383

 Score =  339 bits (870), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 97/353 (27%), Positives = 185/353 (52%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS  D+   KTE+P++ ++E A  EG  P SRE +    ++A L  L          + +
Sbjct: 1   MS-QDSDQEKTESPTAHRLEKAREEGQIPRSRELTSILMLIAGLSILWGGGEWMGRKLGA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L       + D S ++  + +L   A   V+P +   ++  I + ++    VL+ 
Sbjct: 60  LLADGLV-FNHSMVSDTSQMLRQIANLLQQAVLAVLPMMFGLVVVAIAAPMLLGGLVLSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K    +++  +G+ ++ S  +    +K+ +K  LV  +  + +  ++  ML  ++ +
Sbjct: 119 KAIKFDLGKMNPIKGLAKLVSAQSAAELLKAVLKATLVSIVCGLYIWHHWAEMLRLMAES 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + L  A   +    I+++L ++ +   D+ +    ++  L+MS Q+I+DE KQ  G+P
Sbjct: 179 PITALAGAMNMIAMCCILVVLGLSPMVGFDVFFQLFSYFKNLRMSHQDIRDEHKQQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A +I+TNPTHY++AL+Y + +  AP ++AKG   IA
Sbjct: 239 HVKGRIRQQMRAAARRRMMADVPKADVIVTNPTHYSVALQYDENKMSAPKVLAKGAGEIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++  E+ IPI E P LAR+L++   I   IP   Y AVA+++  ++  +
Sbjct: 299 LRIRELGAENRIPILEAPPLARALYRHSEIGQHIPGTLYAAVAEVLAWVWQLR 351


>gi|121997283|ref|YP_001002070.1| flagellar biosynthetic protein FlhB [Halorhodospira halophila SL1]
 gi|121588688|gb|ABM61268.1| flagellar biosynthetic protein FlhB [Halorhodospira halophila SL1]
          Length = 391

 Score =  339 bits (869), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 89/352 (25%), Positives = 169/352 (48%), Gaps = 2/352 (0%)

Query: 1   MS-ENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVT 59
           M+ E++    KTE P+ K+ E++  +G  P SRE +    +L     LL         +T
Sbjct: 1   MAQESEDGQEKTEDPTPKRREESRKKGQVPRSRELTTMLLLLVAAGALLALGPFMGNQLT 60

Query: 60  SDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLN 119
           + L     +  +  + D   ++  L          V+P + + +   + +         +
Sbjct: 61  ALLEWSF-TIDRSHIYDPGIVIERLHEALGRGLLTVLPFIAVMLAAAVIAPTALGGWSFS 119

Query: 120 LNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISA 179
            + ++P  +++S  +G +R++     V   K+  K++++G          +        A
Sbjct: 120 FHPMQPKPEKLSPIKGFQRMFGTKAAVELGKALGKVLVIGGTAVGLFVLFWDNFYTMSRA 179

Query: 180 NPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
                +            ++ L +  +  +DI +  +    K++M++QE+K+E KQ+ G 
Sbjct: 180 PLEPSMAEGMRLFYIFFFLLALSMLVVVAIDIPYQIYDHTQKIRMTRQEVKEEFKQTEGK 239

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLI 299
           P +K R +   R     +MME    A ++ITNP HYA+AL+Y Q+   AP +VAKG +L+
Sbjct: 240 PEVKQRVREQQREMTNRRMMENVPDADVVITNPAHYAVALKYDQSTMRAPTVVAKGADLL 299

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           A ++R++A E++I IF+ P LAR+L+    ++  IP   Y AVAQ++  +Y 
Sbjct: 300 AARIRELAEENDILIFQAPPLARALYHSADLDQEIPGALYFAVAQVLAYVYQ 351


>gi|327481253|gb|AEA84563.1| flagellar biosynthesis protein FlhB [Pseudomonas stutzeri DSM 4166]
          Length = 378

 Score =  339 bits (869), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 97/353 (27%), Positives = 180/353 (50%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+++  +K+E P+ K++ ++  +G    SRE S  +  L  +  LL        ++ +
Sbjct: 1   MAESESGADKSEEPTEKRLRESREKGQLARSRELSTVAVTLGGIGGLLASGGGLAQTLMA 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +       ++  L D   +V LL    L A   ++P L+  ++  I   +     + + 
Sbjct: 61  MMQGTFE-LSRETLLDEGAMVRLLMGSGLMALEAIMPLLIALLIASIVGPVALGGWLFSA 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   R++   G+KR++S   LV  +K+  K ++V  +  + L+     +L      
Sbjct: 120 KAMAPKVSRMNPAAGLKRMFSTKALVELLKALGKFLVVLGVALLVLSAYQDDLLSIAKQP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V    + +   +  +  +D+ +       KL M+KQE+KDE K S G P
Sbjct: 180 LDLAIMHSVEIVGWCALWMACGLIIIAAVDVPFQLWDNKQKLMMTKQEVKDEYKDSEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K+R + + R   + +MM+A   A ++ITNPTH+A+AL+Y   +  AP LVAKG + +A
Sbjct: 240 EVKSRIRQLQREAAQRRMMQAVPEADVVITNPTHFAVALKYDGDKGGAPRLVAKGGDFVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA EH + + E P+LAR+++    ++  IP   Y AVAQ++  +Y  +
Sbjct: 300 LKIREIAQEHKVTVLESPALARAVYYSTELDQEIPAGLYLAVAQVLAYVYQLR 352


>gi|295690541|ref|YP_003594234.1| flagellar biosynthetic protein Flhb [Caulobacter segnis ATCC 21756]
 gi|295432444|gb|ADG11616.1| flagellar biosynthetic protein FlhB [Caulobacter segnis ATCC 21756]
          Length = 361

 Score =  339 bits (869), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 107/353 (30%), Positives = 203/353 (57%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++  P++KTE PS+K++ DA  +G+   S +    +S+   +  ++         +++
Sbjct: 1   MADDTDPESKTEEPSAKRLADARAKGDVVKSADIPQLASLAGAVSVVILAGGWLTRDLSA 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L+  +A A    L     +V ++   +++A   +I  +L+    G  +++ Q   +L  
Sbjct: 61  ALYPFIAHAGTIDLSSAGAMV-VMKQATMAALPPLILVMLVSAFAGAIAHIAQSGFLLTP 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + +KP F ++ L +G+ RI+ I+  V F KS VK ++ G I  + L  +   + + +  +
Sbjct: 120 SKLKPDFSKLDLIKGLGRIFGIDGFVQFAKSAVKFLVTGLIAWMVLKPHVGEVRNLVGMD 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P ++L  A    + +L+ +++F+      D  W   ++ ++++M+ QE+KDE KQS G+P
Sbjct: 180 PAAMLPEALKLSKSLLMAVIIFLTATAAFDWFWQRQRFMNRMRMTLQEVKDEFKQSDGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K +++ I   R R +MM+A  +AT+++ NPTHYA+AL+Y   E  AP+ VAKG + +A
Sbjct: 240 HVKGKRRQIQMQRSRQRMMQAVPKATVVVMNPTHYAVALKYEAGETPAPLCVAKGVDELA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R IA EH +P+ E+P LAR+L+  V ++  IP   ++AVA++I  I + K
Sbjct: 300 LKIRAIAEEHGVPVLEDPPLARALYASVEVDEEIPVEHFEAVAKVISFILNGK 352


>gi|262276382|ref|ZP_06054191.1| flagellar biosynthesis protein FlhB [Grimontia hollisae CIP 101886]
 gi|262220190|gb|EEY71506.1| flagellar biosynthesis protein FlhB [Grimontia hollisae CIP 101886]
          Length = 377

 Score =  339 bits (869), Expect = 6e-91,   Method: Composition-based stats.
 Identities = 95/353 (26%), Positives = 178/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+END    +TE  + ++ + A  +G  P SRE +  + ++   + L++F      ++ +
Sbjct: 1   MAEND-GQERTEDATPRRQQQAREKGQVPRSRELASVAVLVVGAVALMWFGESLGNALMA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L  + T+ ++ D++ +  +           +   LL+  + G+           + 
Sbjct: 60  MMRKLF-TLTREEIFDVTSLGLIGYGAIFHIFWPITFILLMLFIAGLIGASALGGVSFSW 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
              +P   ++S  +GIKR++   + V  +KS +K+ LV  +    +  +           
Sbjct: 119 EAARPKLSKMSPLQGIKRMFGKQSWVELIKSILKVALVSGVAFYLMWASLNDFYQLSIET 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             + LYHA   +   +++I   +  +  +D+ +   Q   +LKM+KQEIKDE K++ G P
Sbjct: 179 FPTNLYHALDILLNFVLLICCSLLVVVAIDVPFQIWQHNEQLKMTKQEIKDEYKETEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM     A ++ITNP HY++ALRY    + APV+VAKG + +A
Sbjct: 239 EVKGRIRMLQREMAQRRMMAEVPSADVVITNPEHYSVALRYDSKMDKAPVVVAKGSDFLA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA EH+I I   P LAR+++    +   IP   + A+AQL+  ++  K
Sbjct: 299 LKIREIAAEHDITIVPAPPLARAVYYSTELEQQIPDGLFTAIAQLLAYVFQLK 351


>gi|123442794|ref|YP_001006771.1| flagellar biosynthesis protein FlhB [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|332161312|ref|YP_004297889.1| flagellar biosynthesis protein FlhB [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|122089755|emb|CAL12608.1| flagellar biosynthetic protein FlhB [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|318605230|emb|CBY26728.1| flagellar biosynthesis protein FlhB [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325665542|gb|ADZ42186.1| flagellar biosynthesis protein FlhB [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330860618|emb|CBX70915.1| flagellar biosynthetic protein flhB [Yersinia enterocolitica
           W22703]
          Length = 383

 Score =  338 bits (868), Expect = 6e-91,   Method: Composition-based stats.
 Identities = 103/353 (29%), Positives = 181/353 (51%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+  +K+E P++ K+E A  +G  P SRE +    + A L  L          + +
Sbjct: 1   MAE-DSDADKSEEPTAHKLEKAREKGQIPRSRELTSMLMLGAGLAILWVSGESMARQLAA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L       + D   ++  +  L       +IP     ++  +   ++    + + 
Sbjct: 60  MIAQGL-HFDHGLISDDKQMLRQIGMLLRQTLIALIPIFAGLVIVAMAVPMLLGGVLFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K   KR+S   G+KR++S   L   +K+ +K  LVG +  I L  N+  M+  ++A 
Sbjct: 119 ESIKFDLKRMSPIAGLKRMFSSQALAELLKAILKATLVGWVTGIFLWHNWPDMMRLMAAP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + L  A   +    ++++L +  +   D+ +       KL+M+KQEI+DE K   G+P
Sbjct: 179 PVAALGDALHLIIFCGLVVVLGLTPMVGFDVFFQITSHIKKLRMTKQEIRDEFKDQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A +I+TNPTHYA+AL+Y +T+  AP ++AKG   +A
Sbjct: 239 HVKGRIRQQQRAMARRRMMADVHKADVIVTNPTHYAVALQYNETKMSAPKVLAKGAGAVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++  EH IP+ E P LAR+LF+   +   IP   Y AVA+++  +Y  K
Sbjct: 299 LRIRELGAEHRIPLLEAPPLARALFRHSEVGQHIPATLYAAVAEVLAWVYQLK 351


>gi|2494575|sp|Q56886|FLHB_YEREN RecName: Full=Flagellar biosynthetic protein flhB
 gi|793892|emb|CAA88185.1| flhB [Yersinia enterocolitica]
          Length = 383

 Score =  338 bits (868), Expect = 7e-91,   Method: Composition-based stats.
 Identities = 103/353 (29%), Positives = 181/353 (51%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+  +K+E P++ K+E A  +G  P SRE +    + A L  L          + +
Sbjct: 1   MAE-DSDADKSEEPTAHKLEKAREKGQIPRSRELTSMLMLGAGLAILWVSGESMARQLAA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L       + D   ++  +  L       +IP     ++  +   ++    + + 
Sbjct: 60  MIAQGL-HFDHGLISDDKQMLRQIGMLLRQTLIGLIPIFAGLVIVAMAVPMLLGGVLFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K   KR+S   G+KR++S   L   +K+ +K  LVG +  I L  N+  M+  ++A 
Sbjct: 119 ESIKFDLKRMSPIAGLKRMFSSQALAELLKAILKATLVGWVTGIFLWHNWPDMMRLMAAP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + L  A   +    ++++L +  +   D+ +       KL+M+KQEI+DE K   G+P
Sbjct: 179 PVAALGDALHLIIFCGLVVVLGLTPMVGFDVFFQITSHIKKLRMTKQEIRDEFKDQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A +I+TNPTHYA+AL+Y +T+  AP ++AKG   +A
Sbjct: 239 HVKGRIRQQQRAMARRRMMADVHKADVIVTNPTHYAVALQYNETKMSAPKVLAKGAGAVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++  EH IP+ E P LAR+LF+   +   IP   Y AVA+++  +Y  K
Sbjct: 299 LRIRELGAEHRIPLLEAPPLARALFRHSEVGQHIPATLYAAVAEVLAWVYQLK 351


>gi|148266206|ref|YP_001232912.1| flagellar biosynthesis protein FlhB [Geobacter uraniireducens Rf4]
 gi|146399706|gb|ABQ28339.1| flagellar biosynthetic protein FlhB [Geobacter uraniireducens Rf4]
          Length = 354

 Score =  338 bits (868), Expect = 7e-91,   Method: Composition-based stats.
 Identities = 103/353 (29%), Positives = 190/353 (53%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE D   +KTE P+ K+I DA  +GN P SR+ +   +++A +I L         ++  
Sbjct: 1   MSEQD-KHSKTEQPTGKRISDAKEKGNIPRSRDLTSTVTLMAGIIALYVTGGFMFSTLKG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
               LLA    + +     +  L+  L  + + ++ P LL+ ++ G+ + + Q     + 
Sbjct: 60  SAKELLAGIATQDMTQAG-VYTLMLKLLFTTTLVLAPFLLVVVVAGLVAEISQGGISTSF 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +   F++++  +G+KR+++ +  V  +KSF+KI++VG +    + +    ++  +  +
Sbjct: 119 EKIGFDFEKLNPVQGVKRLFNKDAAVQVLKSFLKIVIVGYMAYRVMRDEVNNLIYLVDMD 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
              I         K+++     +  L+VLD+ +   ++   LKM+KQE+KDE K S G+P
Sbjct: 179 IGGITEFIGHISFKIVLHTCGALFILSVLDLIFVKWRFIENLKMTKQEVKDENKDSEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK + K     + R +M      A +++TNPTH+A+AL+Y + +  APV++AKG + +A
Sbjct: 239 HIKGKIKQKQFEQARRRMRLIIPTADVVVTNPTHFAVALKYDRQKMAAPVVLAKGADFLA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +++++IA E NI + E   LAR L+ QV     IP   Y AVA+++  +Y  K
Sbjct: 299 QRIKEIARESNITLVENRFLARELYAQVKEGEEIPEALYAAVAEILAYVYSLK 351


>gi|260886652|ref|ZP_05897915.1| flagellar biosynthetic protein FlhB [Selenomonas sputigena ATCC
           35185]
 gi|330839517|ref|YP_004414097.1| flagellar biosynthetic protein FlhB [Selenomonas sputigena ATCC
           35185]
 gi|260863795|gb|EEX78295.1| flagellar biosynthetic protein FlhB [Selenomonas sputigena ATCC
           35185]
 gi|329747281|gb|AEC00638.1| flagellar biosynthetic protein FlhB [Selenomonas sputigena ATCC
           35185]
          Length = 366

 Score =  338 bits (868), Expect = 7e-91,   Method: Composition-based stats.
 Identities = 97/346 (28%), Positives = 175/346 (50%), Gaps = 3/346 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE P++K+  DA  +G    S+E S    +LA    +    S  +  + +    + A
Sbjct: 19  GEKTEEPTAKRRNDARQKGQVARSQELSGAFVLLAGFFVMRALGSTILTEIETYTVHIYA 78

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
           +  Q    D   ++ L+    +  ++   P ++  ++ G+     Q   +     +    
Sbjct: 79  NMNQ--TVDAETVMRLIIDGMIVLAKTAFPVMIAILVMGLAINFYQVGFMFTTEPLSFKL 136

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
            +++   G  RI+S  ++V  +KS +KI ++G  + + L+     M +FI  +  S +  
Sbjct: 137 DKLNPITGFGRIFSKRSIVELLKSLLKIAIIGAFLYVYLSGEIMHMPEFIYLDLKSSMAR 196

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
               +  ++  I++    +   D  +   Q    LKMSKQ+IK+E KQ+ G+P IK + +
Sbjct: 197 MGDIIFSLVFQIIIVYFVMAAADFAYQKWQTTQDLKMSKQDIKEEFKQTEGDPQIKGKIR 256

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              +    ++MM+    A +I+TNPTHYA+AL+Y      AP +VAKGQ+L+A+K++ IA
Sbjct: 257 QKQQQMAMNRMMKEVPEADVIVTNPTHYAVALKYKAG-MKAPEVVAKGQDLVAQKIKDIA 315

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            EH + I E   LAR+L+  V +   +PP  Y+AVA+++  +Y  K
Sbjct: 316 REHRVTIVENKPLARALYAAVDVGGIVPPELYQAVAEVLAYVYRLK 361


>gi|113969638|ref|YP_733431.1| flagellar biosynthesis protein FlhB [Shewanella sp. MR-4]
 gi|114046868|ref|YP_737418.1| flagellar biosynthesis protein FlhB [Shewanella sp. MR-7]
 gi|113884322|gb|ABI38374.1| flagellar biosynthetic protein FlhB [Shewanella sp. MR-4]
 gi|113888310|gb|ABI42361.1| flagellar biosynthetic protein FlhB [Shewanella sp. MR-7]
          Length = 376

 Score =  338 bits (868), Expect = 7e-91,   Method: Composition-based stats.
 Identities = 77/340 (22%), Positives = 161/340 (47%), Gaps = 1/340 (0%)

Query: 14  PSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLASATQRK 73
           P+ +++E A  +G    S+E    + +L+    L         ++++    +  +  +  
Sbjct: 13  PTGRRLEQAREKGQVARSKELGTATVLLSAATGLYMLGPGIAKALSNVFERVF-TMDRAA 71

Query: 74  LEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKRVSLR 133
           + D + +  +   +       ++  +LL ++      +       +   + P   ++S  
Sbjct: 72  IFDTNQMFNVWGVVGSEIGWPLLKIMLLIVVVAFIGNVSLGGMNFSTQAMMPKASKMSPI 131

Query: 134 EGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAFFTVR 193
            G KR++ +  LV   K   K  +V     + L+  +  +L   + +    ++HA   + 
Sbjct: 132 AGFKRMFGVQALVELTKGIAKFSVVAIAAYLLLSHYFNDILLLSADHLPGNVHHALDLLV 191

Query: 194 KVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSR 253
            + I++   +  + V+D+ +       +LKM+KQE+KDE K + G P +K R + + R  
Sbjct: 192 WMFILLCSSVLVIVVIDVPFQIWNHNKQLKMTKQEVKDEYKDTEGKPEVKGRVRQMQREL 251

Query: 254 IRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIP 313
            + +MM     A +I+ NP HYA+A++Y    + AP ++AKG + +A K+R++A  HNI 
Sbjct: 252 AQRRMMAEVPNADVIVVNPEHYAVAIKYDVKRSAAPFVIAKGVDEVAFKIREVARAHNIA 311

Query: 314 IFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           I   P LAR+++    +   IP   + AVAQ++  ++  +
Sbjct: 312 IVSAPPLARAIYHTTKLEQQIPEGLFTAVAQVLAYVFQLR 351


>gi|302392376|ref|YP_003828196.1| flagellar biosynthetic protein FlhB [Acetohalobium arabaticum DSM
           5501]
 gi|302204453|gb|ADL13131.1| flagellar biosynthetic protein FlhB [Acetohalobium arabaticum DSM
           5501]
          Length = 353

 Score =  338 bits (868), Expect = 7e-91,   Method: Composition-based stats.
 Identities = 108/345 (31%), Positives = 180/345 (52%), Gaps = 1/345 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
           + KTE P+ K+ ++A  EG    S+E S+  ++L   I L F     +Y     ++    
Sbjct: 4   EEKTEDPTPKRRQEAREEGQVAQSQELSMAFTLLFSFIMLFFLMDNILYESMEFMNKYFT 63

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
                 L ++     LL  L     RLV P + +  + G+   L+Q   +     ++P  
Sbjct: 64  DYMTMTL-NLQTFYTLLLELMQFIFRLVAPLMFVVALVGVVVGLLQTGFLFTPTSLQPDP 122

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
            ++    G K+I+S   +  F KS +KI +VG I  +++ +N   ++ F     + ++  
Sbjct: 123 SKLDPVSGFKQIFSKQTVAEFFKSILKISIVGGIAYLTIKDNLPQLIMFSKMGLNQVVSL 182

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
               +  + I + L +  L +LD  +   +   +LKM+KQE+K+E KQ+ GNP IK RQK
Sbjct: 183 IGSIIYSLAIKVSLILILLGILDFIYQKWEHEQQLKMTKQEVKEEKKQTEGNPEIKKRQK 242

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              +    ++MME+   A ++ITNPTH A+A+++     DAP++VAKG+  IA K++K A
Sbjct: 243 EKQQEMAMNRMMESVPEADVVITNPTHIAVAIKFDIDNMDAPIVVAKGKGEIAHKIKKKA 302

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
            E  I I EE  LAR+L+ QV I   IP   Y+AVA+++  +Y  
Sbjct: 303 EECGIEIVEEKPLARALYGQVEIEEEIPMELYQAVAEILAYVYQL 347


>gi|188581880|ref|YP_001925325.1| flagellar biosynthetic protein FlhB [Methylobacterium populi BJ001]
 gi|179345378|gb|ACB80790.1| flagellar biosynthetic protein FlhB [Methylobacterium populi BJ001]
          Length = 355

 Score =  338 bits (867), Expect = 7e-91,   Method: Composition-based stats.
 Identities = 114/353 (32%), Positives = 193/353 (54%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++    ++KTE P+ ++IE A+  G+ P S E + F  + A  + L+    P    +T 
Sbjct: 1   MADESDDEDKTEDPTPRRIEQAIERGDVPNSPEINTFFILAAFTLALMLSAKPMAEGLTR 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           D+   L  A     +  +++   L    + A  L +P L + M+  I + LIQ  P+   
Sbjct: 61  DMRGFLEHAGSIPSDAGTYLGVALRAGWVCAKALAVP-LGIAMLAAIAAGLIQHRPIFTA 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R+S   G KR+   +  VNF K   KII+VGTI    L   +     F   +
Sbjct: 120 ESLMPKFARISPMAGAKRLLGTDAWVNFGKGLAKIIVVGTIAGAILWNEHDRAESFAQLD 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P + L        K++  +L   A + + D  +  H+W+++L+M+K+E+K E K+S G+P
Sbjct: 180 PGAALQGTLTLALKMMGGMLAAYAAIALGDALYQRHRWHTRLRMTKEEMKQEHKESEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + ++R++ +MM A   AT+++TNPTHYA+ALRY      APV VAKG + +A
Sbjct: 240 EVKARIRQLRQARVKKRMMAAVPTATVVVTNPTHYAVALRYETG-MAAPVCVAKGVDSLA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R +A +H++P+ E P LAR+L   V +++ IP   Y+AVA++I  +   +
Sbjct: 299 LRIRAVAADHDVPVLENPPLARALHATVEVDAEIPAEHYRAVAEVIGFVLRLR 351


>gi|149928479|ref|ZP_01916714.1| Flagellar biosynthetic protein FlhB [Limnobacter sp. MED105]
 gi|149822813|gb|EDM82064.1| Flagellar biosynthetic protein FlhB [Limnobacter sp. MED105]
          Length = 376

 Score =  338 bits (867), Expect = 8e-91,   Method: Composition-based stats.
 Identities = 93/352 (26%), Positives = 173/352 (49%), Gaps = 2/352 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E      K    S +KI  A  EGN P SRE      +LA +  L       +     
Sbjct: 1   MAEETD-QEKDLPASEQKIRKAREEGNLPRSRELGGGVVLLAGVGLLYTMGGELVSQSEK 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L    + +  D  H+      +   +  ++IP  L+ ++  I S +       + 
Sbjct: 60  LMRQGLV-LDRAQAFDTKHMGLKWVSMLQESLFILIPLFLVVVVAAIVSNIAVGGFNWST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P   +++  +G+K I+S+N L   +K+ +K +++G +  + L ++        +  
Sbjct: 119 KPLEPKLSKLNPVKGLKNIFSVNGLAELVKAILKTVVLGGVGYLLLMQDLGEFTQLSAMP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               +        K  +++ +    +  +D+ +   ++Y  L+M+ +E+K E K+S G+P
Sbjct: 179 LEHGMAETARITIKDALILAIAFLLIVSIDVPYQLWRYYKGLRMNLEELKRESKESDGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + KS+ R   R +MM +   A +I+TNPTHY++AL+Y +    AP +VAKG   +A
Sbjct: 239 HLKGKIKSMQREAARRRMMASVPNADVIVTNPTHYSVALKYDKDGKGAPRVVAKGIGPLA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
            K+R++A E+ +P+ E P LAR+L+  V +   IP   Y AVA+L+  +Y  
Sbjct: 299 LKIREVAQENKVPLVEAPPLARALYSNVELEQEIPGALYTAVAKLLAYVYAL 350


>gi|240139290|ref|YP_002963765.1| flagellar biosynthetic protein flhB [Methylobacterium extorquens
           AM1]
 gi|254561746|ref|YP_003068841.1| flagellar biosynthetic protein flhB [Methylobacterium extorquens
           DM4]
 gi|240009262|gb|ACS40488.1| flagellar biosynthetic protein flhB [Methylobacterium extorquens
           AM1]
 gi|254269024|emb|CAX24985.1| flagellar biosynthetic protein flhB [Methylobacterium extorquens
           DM4]
          Length = 354

 Score =  338 bits (867), Expect = 8e-91,   Method: Composition-based stats.
 Identities = 111/353 (31%), Positives = 190/353 (53%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS+    ++KTE P+ ++IE A+  G+ P S E + F  + A  + L+    P    +T 
Sbjct: 1   MSDETDDEDKTEDPTPRRIEQAIERGDVPNSPEINTFFILAAFTLALMLSARPVAEGLTR 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           D+   L  A     +  +++   L    +    L +P L + M+  I + LIQ  P+   
Sbjct: 61  DMRGFLEHAGGLPSDSGTYLGVALRAAWVCTKALAVP-LGIAMLAAIAAGLIQHRPIFTA 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R+S   G KR+  ++  VNF K   KII+VGTI    L   +     F   +
Sbjct: 120 ESLMPKFARISPMAGAKRLLGMDAWVNFGKGLAKIIVVGTIAGTILWSEHDRAESFAQLD 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   L        K++  +L   A + + D  +  ++W+ +L+M+K+E+K E K+S G+P
Sbjct: 180 PGVALQGTLTLALKMMGGMLAVYAVIALGDALYQRNRWHKRLRMTKEEMKQEHKESEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + ++R++ +MM A   AT+++TNPTH+A+ALRY      AP+ VAKG + +A
Sbjct: 240 EVKARIRQLRQARVKKRMMAAVPTATVVVTNPTHFAVALRYEAG-MAAPICVAKGVDSLA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R +A +H++P+ E P LAR+L   V ++  IP   Y+AVA++I  +   +
Sbjct: 299 LRIRAVAADHDVPVMENPPLARALHATVEVDEEIPAEHYRAVAEVIGFVLRLR 351


>gi|170287825|ref|YP_001738063.1| flagellar biosynthetic protein FlhB [Thermotoga sp. RQ2]
 gi|170175328|gb|ACB08380.1| flagellar biosynthetic protein FlhB [Thermotoga sp. RQ2]
          Length = 374

 Score =  338 bits (867), Expect = 8e-91,   Method: Composition-based stats.
 Identities = 101/345 (29%), Positives = 185/345 (53%), Gaps = 6/345 (1%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            +TE  + +K      EG AP+SRE ++  + L   + L  F   G+  +T D+   L+ 
Sbjct: 32  ERTERATPRKRRRVREEGRAPVSRELNMAVTFLVFALALKIFGYQGVERITEDVQAFLS- 90

Query: 69  ATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFK 128
                 E+   ++    +       ++   ++  M+ G+    +Q   +     +KP   
Sbjct: 91  -----FEETEDLLVNAVNTFKDVLLIIGAFVVFSMVAGVMIGALQTRFLFAPKALKPDLN 145

Query: 129 RVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHA 188
           R++  EG KR++S+ +LV  +KS +K+ +VG ++   L   +  M+     N +    + 
Sbjct: 146 RINPIEGFKRLFSLRSLVELLKSVLKVAIVGIVVYQVLKNRWDEMILLTEMNVNDAFANF 205

Query: 189 FFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKS 248
           +    ++ +   + +  L V D  +   ++   ++M+KQE+KDE+K+  GNP IK RQ+ 
Sbjct: 206 WDIASEITLKSGMVLLALAVFDYFYQRWEFEKSIRMTKQEMKDELKEVEGNPEIKRRQRQ 265

Query: 249 IARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAY 308
           +    +R +MME   +A ++ITNPTH+A+AL+Y     +APV+VAKG + +A K+ +IA 
Sbjct: 266 MMYDILRRRMMEEVPKADVVITNPTHFAVALKYDPDTMNAPVVVAKGVDHLALKIIEIAK 325

Query: 309 EHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           E+++P+   PSLAR+L+ +  I   IP  FY+ VA+++  +Y KK
Sbjct: 326 ENDVPVLRNPSLARALYYKTEIGEEIPVEFYRIVAEVLVYVYTKK 370


>gi|218530777|ref|YP_002421593.1| flagellar biosynthetic protein FlhB [Methylobacterium
           chloromethanicum CM4]
 gi|218523080|gb|ACK83665.1| flagellar biosynthetic protein FlhB [Methylobacterium
           chloromethanicum CM4]
          Length = 354

 Score =  338 bits (867), Expect = 9e-91,   Method: Composition-based stats.
 Identities = 111/353 (31%), Positives = 190/353 (53%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS+    ++KTE P+ ++IE A+  G+ P S E + F  + A  + L+    P    +T 
Sbjct: 1   MSDETDDEDKTEDPTPRRIEQAIERGDVPNSPEINTFFILAAFTLALMLSARPVAEGLTR 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           D+   L  A     +  +++   L    +    L +P L + M+  I + LIQ  P+   
Sbjct: 61  DMRGFLEHAGGLPSDSGTYLGVALRAAWVCTKALAVP-LGIAMLAAIAAGLIQHRPIFTA 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R+S   G KR+  ++  VNF K   KII+VGTI    L   +     F   +
Sbjct: 120 ESLMPKFARISPMAGAKRLLGMDAWVNFGKGLAKIIVVGTIAGTILWSEHDRAESFAQLD 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   L        K++  +L   A + + D  +  ++W+ +L+M+K+E+K E K+S G+P
Sbjct: 180 PGVALQGTLTLALKMMGGMLAVYAVIALGDAFYQRNRWHKRLRMTKEEMKQEHKESEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + ++R++ +MM A   AT+++TNPTH+A+ALRY      AP+ VAKG + +A
Sbjct: 240 EVKARIRQLRQARVKKRMMAAVPTATVVVTNPTHFAVALRYEAG-MAAPICVAKGVDSLA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R +A +H++P+ E P LAR+L   V ++  IP   Y+AVA++I  +   +
Sbjct: 299 LRIRAVAADHDVPVMENPPLARALHATVEVDEEIPAEHYRAVAEVIGFVLRLR 351


>gi|15643671|ref|NP_228717.1| flagellar biosynthesis protein FlhB [Thermotoga maritima MSB8]
 gi|4981445|gb|AAD35990.1|AE001755_13 flagellar biosynthesis protein FlhB [Thermotoga maritima MSB8]
          Length = 374

 Score =  338 bits (867), Expect = 9e-91,   Method: Composition-based stats.
 Identities = 101/345 (29%), Positives = 187/345 (54%), Gaps = 6/345 (1%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            +TE  + +K      EG AP+SRE ++  + L   + L  F   G+  +T D+ V L+ 
Sbjct: 32  ERTERATPRKRRRVREEGRAPVSRELNMAVTFLVFALALKIFGYQGVERITEDVQVFLS- 90

Query: 69  ATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFK 128
                 E+   ++    ++      +V   ++  M+ G+    +Q   +     +KP   
Sbjct: 91  -----FEETEDLLMNAVNIFKDVLLIVGAFVVFSMVAGVMIGALQTRFLFAPKALKPDLN 145

Query: 129 RVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHA 188
           R++  EG KR++S+ +LV  +KS +K+ +VG ++   L   +  M+     + +    + 
Sbjct: 146 RINPIEGFKRLFSLRSLVELLKSVLKVAIVGIVVYQVLKNRWDEMILLTEMSVNDAFANF 205

Query: 189 FFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKS 248
           +    ++ +   + +  L V D  +   ++   ++M+KQE+KDE+K+  GNP IK RQ+ 
Sbjct: 206 WDITSEITLKSGMILLALAVFDYFYQRWEFEKSIRMTKQEVKDELKEVEGNPEIKRRQRQ 265

Query: 249 IARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAY 308
           +    +R +M+E   +A ++ITNPTH+A+AL+Y     +APV+VAKG + +A K+ +IA 
Sbjct: 266 MMYDILRRRMLEEVPKADVVITNPTHFAVALKYDPDTMNAPVVVAKGVDHLAFKIIEIAK 325

Query: 309 EHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           E+++P+   PSLAR+L+ +  I   IP  FY+ VA+++  +Y KK
Sbjct: 326 ENDVPVLRNPSLARALYYKTEIGEEIPVEFYRIVAEVLVYVYAKK 370


>gi|117919803|ref|YP_868995.1| flagellar biosynthesis protein FlhB [Shewanella sp. ANA-3]
 gi|117612135|gb|ABK47589.1| flagellar biosynthetic protein FlhB [Shewanella sp. ANA-3]
          Length = 376

 Score =  338 bits (867), Expect = 9e-91,   Method: Composition-based stats.
 Identities = 77/340 (22%), Positives = 161/340 (47%), Gaps = 1/340 (0%)

Query: 14  PSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLASATQRK 73
           P+ +++E A  +G    S+E    + +L+    L         ++++    +  +  +  
Sbjct: 13  PTGRRLEQAREKGQVARSKELGTATVLLSAATGLYMLGPGIAKALSNVFERVF-TMERAA 71

Query: 74  LEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKRVSLR 133
           + D + +  +   +       ++  +LL ++      +       +   + P   ++S  
Sbjct: 72  IFDTNQMFNVWGVVGSEIGWPLLKIMLLIVVVAFIGNVSLGGMNFSTQAMMPKASKMSPI 131

Query: 134 EGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAFFTVR 193
            G KR++ +  LV   K   K  +V     + L+  +  +L   + +    ++HA   + 
Sbjct: 132 AGFKRMFGVQALVELTKGIAKFSVVAIAAYLLLSHYFNDILLLSADHLPGNVHHALDLLV 191

Query: 194 KVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSR 253
            + I++   +  + V+D+ +       +LKM+KQE+KDE K + G P +K R + + R  
Sbjct: 192 WMFILLCSSVLVIVVIDVPFQIWNHNKQLKMTKQEVKDEYKDTEGKPEVKGRVRQMQREL 251

Query: 254 IRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIP 313
            + +MM     A +I+ NP HYA+A++Y    + AP ++AKG + +A K+R++A  HNI 
Sbjct: 252 AQRRMMAEVPNADVIVVNPEHYAVAIKYDVKRSAAPFVIAKGVDEVAFKIREVARAHNIA 311

Query: 314 IFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           I   P LAR+++    +   IP   + AVAQ++  ++  +
Sbjct: 312 IVSAPPLARAIYHTTKLEQQIPEGLFTAVAQVLAYVFQLR 351


>gi|15887910|ref|NP_353591.1| flagellar biosynthesis protein FlhB [Agrobacterium tumefaciens str.
           C58]
 gi|2459702|gb|AAB71778.1| FlhB [Agrobacterium tumefaciens]
 gi|15155504|gb|AAK86376.1| flagellar biosynthetic protein [Agrobacterium tumefaciens str. C58]
          Length = 360

 Score =  337 bits (866), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 154/350 (44%), Positives = 235/350 (67%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++   D+KTE P+ KK+ DA  +GN P SRE  +F+S LA   YL+FF   G   +  
Sbjct: 1   MADDQDKDSKTEDPTEKKLRDAAEKGNLPFSREVPIFASSLAFYCYLVFFLPEGAGRLGV 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  L     Q  L      + LL  L  S + L++P +++F++FG+ S  +Q +P   L
Sbjct: 61  TLKDLFGQPEQWNLSTRPDALALLYFLGTSVAYLLMPAMIMFIVFGLASSFLQNLPSPVL 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             V+P + R+S  +G  RIYS    V F KS  KI++V  I+  +L  ++++++D + ++
Sbjct: 121 ERVRPQWSRISPAKGFTRIYSKQGFVEFAKSVFKIMIVSIIMFFALRGDFYSLIDLMFSD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P  I       V+K++++ILL  A L  +D+ W+ H W+S+LKM+K E+K+E KQS G+P
Sbjct: 181 PQVIFVRVVEIVKKMMVVILLSTALLAAVDVLWTRHHWFSQLKMTKHEVKEEYKQSQGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           ++K+RQ+SIAR R R +M+    RAT++I NPTH+A+ALRY++ E DAPV+VAKGQ+LIA
Sbjct: 241 VVKSRQRSIARDRARRRMINNVPRATLVIANPTHFAVALRYVREEGDAPVVVAKGQDLIA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
            K+R+IA E+NIP+FE+P LARS+F QV ++S IPPVFYKAVA+L++++Y
Sbjct: 301 LKIRQIAEENNIPVFEDPPLARSMFAQVSVDSVIPPVFYKAVAELVHRVY 350


>gi|307610486|emb|CBX00058.1| flagellar biosynthetic protein FlhB [Legionella pneumophila 130b]
          Length = 425

 Score =  337 bits (866), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 97/353 (27%), Positives = 185/353 (52%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++ +    KTE PSSK+++++  +G    S++ +    +L   +    F       + S
Sbjct: 1   MADEEQSQEKTEQPSSKRLKESRKKGQVARSKDFNATVILLFTGLGFFIFGKQLSLQIAS 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +        +  L   ++ +  L  L+ S    V+P LL+  +  + + L+    V + 
Sbjct: 61  IMQQAFD-FDRDILVTGNNSLENLFQLTKSGLWSVVPLLLVIFILSLLAPLLMGGWVFSG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F R+++ +G KR+ S+   +  +K+F+K +LV +   + L      +L+   A 
Sbjct: 120 QSIQPKFSRLNVLKGFKRMISLKGFIEMLKAFLKFVLVASASILVLRSQVPLLLELGKAP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               +      + K  ++I   +  +  +D+ +  ++    +KM+KQE+KDE K++ G P
Sbjct: 180 LEIAITSGVMILLKSFVLISASLILIAAIDVPFQLYEHSKSIKMTKQELKDEYKETEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K+  +   +   R +MM    +A +I+TNPTHYA+AL Y +    APV++AKG+NL+A
Sbjct: 240 EVKSAIRRAQQEAARRRMMSEVPKADVILTNPTHYAVALSYQKKGKKAPVVIAKGKNLVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++ K+A EH IPI   P+LAR+++    +N+ IP   Y AVAQ++  I+  +
Sbjct: 300 FQISKVAKEHKIPIISVPALARAIYFSTKLNAEIPRGLYVAVAQVLAYIFQLR 352


>gi|146341890|ref|YP_001206938.1| flagellar biosynthesis protein FlhB [Bradyrhizobium sp. ORS278]
 gi|146194696|emb|CAL78721.1| Flagellar biosynthetic protein FlhB [Bradyrhizobium sp. ORS278]
          Length = 359

 Score =  337 bits (866), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 111/353 (31%), Positives = 190/353 (53%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E    ++KTE P+ K+++ AL  G+   S+E + +  I A  + +  F      +V  
Sbjct: 1   MAEEGDTEDKTEDPTQKRLDQALERGDVVKSQELNTWFVIAAATLVMTTFSGSIGTAVLV 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L+A++      D + ++ L   LS +    +   +L+ M+  I   ++Q   V + 
Sbjct: 61  PMRNLIANSWMIH-TDGAGLLALARSLSFAVIAAIGVPILMVMLAAIAGNMMQHRLVWSG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +KPS  ++S   G KR++      NF K   K++L+GT++ + L      +   +  +
Sbjct: 120 EPLKPSLSKISPLSGAKRLFGKQAAANFAKGLFKLVLLGTVMVMILWPERLRLEALLHMD 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
              +L         ++  ++  +A + + D  + Y QWY + KMS QE+K+E KQS G+P
Sbjct: 180 VAELLGVTMSLTTHLMGSVVALLALVAIGDYLFQYRQWYERQKMSLQEMKEEFKQSEGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + I + R++ +MM A  +A++IITNPTHY++AL Y +    APV VAKG + IA
Sbjct: 240 HVKGRIRQIRQQRMKKRMMAAVPKASVIITNPTHYSVALSYERG-MQAPVCVAKGVDNIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA  H+IPI E   LAR+L+  V I+  IP   Y AVA++I  +   +
Sbjct: 299 FKIREIAKAHDIPIVENVPLARALYATVEIDEEIPVEHYHAVAEIIGYVMGLR 351


>gi|15615002|ref|NP_243305.1| flagellar biosynthesis protein FlhB [Bacillus halodurans C-125]
 gi|10175059|dbj|BAB06158.1| flagella-associated protein [Bacillus halodurans C-125]
          Length = 363

 Score =  337 bits (866), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 93/346 (26%), Positives = 179/346 (51%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE  + KK +D+  +G    S + +    +L   ++L  F  P +      L +   
Sbjct: 14  QEKTEKATPKKRQDSRKKGQVAKSTDVNTAIILLCVFLFLWLFGGPLLGGTLEKLLIHTF 73

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
            +          +  L+  +++ A+ +++P + + ++ G+ +  IQ  P+     +K   
Sbjct: 74  ESYLLMDVTEESVAELMFEITMEAAIVLLPIMAIALIAGVLASYIQVGPLFTTEPLKMKL 133

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
            ++   +G KRI+S+  LV F+KS +KI+L G      +  +   ++     +  +    
Sbjct: 134 SKIDPIKGAKRIFSVRALVEFLKSLLKIVLTGLAAFSIVWFSLEDVMLLSQKSVENSFVT 193

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
                  + I+I + +  L++ D  +  +    +++MSKQ++KDE K   G+P +K+++K
Sbjct: 194 VAQLTALLGILIAILLLILSIPDYLYQRYDHEKQIRMSKQDVKDEHKNVEGDPKVKSKRK 253

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
                    +MM+   +A ++ITNPTHYA+AL+Y Q++ DAPV+VAKG + +A K++ +A
Sbjct: 254 QKQMEMAMQRMMQEVPKADVVITNPTHYAIALKYDQSKMDAPVIVAKGVDYVAFKIKSLA 313

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            +HN+   E   LAR+L+ Q  I   +P   +KAVA+++  +Y  K
Sbjct: 314 KQHNVVTVENKPLARALYDQADIGDQVPEQLFKAVAEVLAYVYRLK 359


>gi|24374727|ref|NP_718770.1| flagellar biosynthesis protein FlhB [Shewanella oneidensis MR-1]
 gi|24349387|gb|AAN56214.1|AE015759_6 flagellar biosynthetic protein FlhB [Shewanella oneidensis MR-1]
          Length = 376

 Score =  337 bits (865), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 76/340 (22%), Positives = 162/340 (47%), Gaps = 1/340 (0%)

Query: 14  PSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLASATQRK 73
           P+ ++++ A  +G    S+E    + +L+    L         ++++    +  +  +  
Sbjct: 13  PTGRRLDQAREKGQVARSKELGTATVLLSAATGLYMLGPGIAKALSNVFERVF-TMDRAA 71

Query: 74  LEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKRVSLR 133
           + D + +  +   +       ++  +LL ++      +       +   + P   ++S  
Sbjct: 72  IFDTNQMFNVWGVVGSEIGWPLLKIMLLIVVVAFIGNVSLGGMNFSTQAMMPKASKMSPI 131

Query: 134 EGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAFFTVR 193
            G KR++ +  LV   K   K  +V     + L+  +  +L   + +    +YHA   + 
Sbjct: 132 AGFKRMFGVQALVELTKGIAKFSVVALASYLLLSHYFNDILLLSADHLPGNVYHALDLLV 191

Query: 194 KVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSR 253
            + I++   +  + V+D+ +       +LKM+KQE+KDE K + G P +K R + + R  
Sbjct: 192 WMFILLCSSVLVIVVIDVPFQIWNHNKQLKMTKQEVKDEYKDTEGKPEVKGRVRQMQREL 251

Query: 254 IRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIP 313
            + +MM     A +I+ NP HYA+A++Y    + AP ++AKG + +A K+R++A  HNI 
Sbjct: 252 AQRRMMAEVPNADVIVVNPEHYAVAIKYDVKRSAAPFVIAKGVDEVAFKIREVARAHNIA 311

Query: 314 IFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           I   P LAR+++    ++  +P   + AVAQ++  ++  +
Sbjct: 312 IVTAPPLARAIYHTTKLDQQVPEGLFTAVAQVLAYVFQLR 351


>gi|146293659|ref|YP_001184083.1| flagellar biosynthesis protein FlhB [Shewanella putrefaciens CN-32]
 gi|145565349|gb|ABP76284.1| flagellar biosynthetic protein FlhB [Shewanella putrefaciens CN-32]
          Length = 376

 Score =  337 bits (865), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 77/340 (22%), Positives = 163/340 (47%), Gaps = 1/340 (0%)

Query: 14  PSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLASATQRK 73
           P+ +++E A  +G    S+E    + +L+              +++     +  +  + +
Sbjct: 13  PTGRRLEQAREKGQVARSKELGTAAVLLSAATGFYMLGPGIATALSHVFERVF-TMDRAQ 71

Query: 74  LEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKRVSLR 133
           + D + +  +   ++   +  ++  +LL ++      +       +   + P   ++S  
Sbjct: 72  IYDTNQMFNVWGVVAGEIAWPMLKIMLLIVVVAFIGNVSLGGMNFSTQAMMPKASKMSPL 131

Query: 134 EGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAFFTVR 193
            G KR++ +  LV   K   K  +V       L+  +  +L   S +    ++HA   + 
Sbjct: 132 AGFKRMFGVQALVELTKGIAKFSVVAFSAYFLLSYYFNDILLLSSDHLPGNVHHALDLLI 191

Query: 194 KVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSR 253
            + I++   +  + V+D+ +       +LKM+KQE+KDE K + G P +K R + + R  
Sbjct: 192 WMFILLCSSVLLIVVIDVPFQIWNHNKQLKMTKQEVKDEYKDTEGKPEVKGRVRQMQREL 251

Query: 254 IRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIP 313
            + +MM     A +I+ NP HYA+A++Y    + AP ++AKG + +A K+R++A E+NI 
Sbjct: 252 AQRRMMAEVPNADVIVVNPEHYAVAVKYDVKRSAAPFVIAKGVDDVAFKIREVAREYNIA 311

Query: 314 IFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           I   P LAR+++    ++  IP   + AVAQ++  ++  +
Sbjct: 312 IVSAPPLARAIYHTTKLDQQIPEGLFTAVAQVLAYVFQLR 351


>gi|292489168|ref|YP_003532055.1| flagellar biosynthetic protein FlhB [Erwinia amylovora CFBP1430]
 gi|292900286|ref|YP_003539655.1| flagellar biosynthetic protein [Erwinia amylovora ATCC 49946]
 gi|291200134|emb|CBJ47260.1| flagellar biosynthetic protein [Erwinia amylovora ATCC 49946]
 gi|291554602|emb|CBA22250.1| Flagellar biosynthetic protein FlhB [Erwinia amylovora CFBP1430]
 gi|312173327|emb|CBX81582.1| Flagellar biosynthetic protein FlhB [Erwinia amylovora ATCC
           BAA-2158]
          Length = 381

 Score =  337 bits (865), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 97/353 (27%), Positives = 177/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS  ++ + KTEAP+  +I  A  EG  P SRE +    +L     +L      + S+  
Sbjct: 1   MS-QESDNEKTEAPTPSRIARAREEGQIPRSRELTTLLMLLVGWGLMLCSGGNLVRSLQG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            LH  L    +  + D + ++     L   A   ++P +   ++  + +  +    +L+ 
Sbjct: 60  LLHNGLI-FDRLLILDPAQMLQRSASLLGQAFMAIMPFVFGLLLTAVSAPPLIGGLILSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P  K+++   GIKR++S       +K+ +K++L      + L  N    +  I   
Sbjct: 119 KSLAPKLKKLNPLSGIKRMFSAQMASEMVKAILKVLLATLGGGLYLLLNKEKFIRLIFEP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               L      +   L+ +++ +  +   D+ +  +  + KL+MS+QEIKDE K+  G+P
Sbjct: 179 LGMALTDISSLLLGCLLAVIMSLIPMVAFDVIYQLYSHWKKLRMSRQEIKDEFKKQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R + + R+  + +MM     A +I+ NPTHY++AL+Y      AP +VAKG  L+A
Sbjct: 239 QIKGRVRQMQRAMAQRRMMTDVPDADVIVNNPTHYSVALKYQDGSLGAPKVVAKGSGLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A  H +P+ E P LAR+L++   I + IP   Y AVA+++  +Y  +
Sbjct: 299 LRIRELAESHKVPMLEAPPLARALYRHCEIGAPIPADLYHAVAEVLAWVYSLR 351


>gi|120598263|ref|YP_962837.1| flagellar biosynthesis protein FlhB [Shewanella sp. W3-18-1]
 gi|120558356|gb|ABM24283.1| flagellar biosynthetic protein FlhB [Shewanella sp. W3-18-1]
 gi|319427058|gb|ADV55132.1| flagellar biosynthetic protein FlhB [Shewanella putrefaciens 200]
          Length = 376

 Score =  337 bits (864), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 77/340 (22%), Positives = 163/340 (47%), Gaps = 1/340 (0%)

Query: 14  PSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLASATQRK 73
           P+ +++E A  +G    S+E    + +L+              +++     +  +  + +
Sbjct: 13  PTGRRLEQAREKGQVARSKELGTAAVLLSAATGFYMLGPGIATALSHVFERVF-TMDRAQ 71

Query: 74  LEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKRVSLR 133
           + D + +  +   ++   +  ++  +LL ++      +       +   + P   ++S  
Sbjct: 72  IYDTNQMFNVWGLVAGEIAWPMLKIMLLIVVVAFIGNVSLGGMNFSTQAMMPKASKMSPL 131

Query: 134 EGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAFFTVR 193
            G KR++ +  LV   K   K  +V       L+  +  +L   S +    ++HA   + 
Sbjct: 132 AGFKRMFGVQALVELTKGIAKFSVVAFSAYFLLSYYFNDILLLSSDHLPGNVHHALDLLI 191

Query: 194 KVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSR 253
            + I++   +  + V+D+ +       +LKM+KQE+KDE K + G P +K R + + R  
Sbjct: 192 WMFILLCSSVLLIVVIDVPFQIWNHNKQLKMTKQEVKDEYKDTEGKPEVKGRVRQMQREL 251

Query: 254 IRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIP 313
            + +MM     A +I+ NP HYA+A++Y    + AP ++AKG + +A K+R++A E+NI 
Sbjct: 252 AQRRMMAEVPNADVIVVNPEHYAVAVKYDVKRSAAPFVIAKGVDDVAFKIREVAREYNIA 311

Query: 314 IFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           I   P LAR+++    ++  IP   + AVAQ++  ++  +
Sbjct: 312 IVSAPPLARAIYHTTKLDQQIPEGLFTAVAQVLAYVFQLR 351


>gi|149182522|ref|ZP_01860995.1| flagellar biosynthesis protein B [Bacillus sp. SG-1]
 gi|148849782|gb|EDL63959.1| flagellar biosynthesis protein B [Bacillus sp. SG-1]
          Length = 360

 Score =  337 bits (864), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 103/346 (29%), Positives = 182/346 (52%), Gaps = 1/346 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             K+E  + KK +D+  +G    S++ +    +LA  ++L F  S     +     +   
Sbjct: 13  GEKSEKATPKKRQDSRKKGQTAKSQDVNTAIILLAVFLFLTFSASYIGDVIFDLFRISFQ 72

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
                 L   S ++ ++  L    + L+ P +L+ ++ G+ S  IQ   +     ++P  
Sbjct: 73  DYMMMDLTQDSFMLIVMEVLQ-QVAILLGPIMLVALLAGLFSNYIQVGVMFTAEPLQPKL 131

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
           +++   +G KRI+S+  +V  +KS +KI  VG I  + L  N   +L     + +  L  
Sbjct: 132 EKIDPIKGAKRIFSLRAIVELLKSILKIGFVGAITFVILWMNIDEVLGLSFKSAYDSLAA 191

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
                 ++ I   L +  L+V D  +  + +   ++MSKQ+IKDE K + G+P+IK++ K
Sbjct: 192 MASLTVQMGIAASLALLFLSVFDYLYQKYDFEKNIRMSKQDIKDEHKNAEGDPLIKSKIK 251

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              R     +MM+    A ++ITNPTHYA+AL+Y + ++DAP ++AKG + +A+K++ IA
Sbjct: 252 QRQREMAMRRMMQEVPEADVVITNPTHYAIALKYDENKSDAPYVIAKGVDYMAQKIKYIA 311

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            EH+I + E   LARSL+    I   IP  F+KAVA+++  +Y  K
Sbjct: 312 GEHDIIMVENRPLARSLYDSAEIGDTIPEEFFKAVAEILAYVYRMK 357


>gi|187926251|ref|YP_001892596.1| flagellar biosynthetic protein FlhB [Ralstonia pickettii 12J]
 gi|241665739|ref|YP_002984098.1| flagellar biosynthetic protein FlhB [Ralstonia pickettii 12D]
 gi|187728005|gb|ACD29169.1| flagellar biosynthetic protein FlhB [Ralstonia pickettii 12J]
 gi|240867766|gb|ACS65426.1| flagellar biosynthetic protein FlhB [Ralstonia pickettii 12D]
          Length = 387

 Score =  337 bits (864), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 91/353 (25%), Positives = 174/353 (49%), Gaps = 3/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE  +   KTE  S +++E A  EG+ P SRE + F+        L       + + +S
Sbjct: 1   MSEE-SDLEKTEPASPRRLEQAREEGDVPRSRELASFALTAVSAGGLWVMGDSIVRAASS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L    +            +T   +  + + + GL+L ++    S L      ++ 
Sbjct: 60  FLARCLE-FHRYNYTSGQDQWNYVTGQFMPLA-MTLGGLMLMLVIAALSPLALTRGAISF 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   R+   +G+ R++S+  L+   +  +K+ L+  +  + +      +++    +
Sbjct: 118 KPLSPDISRLFKLQGLTRMFSLEGLMELPRLLIKLFLIAGVGWLLVRYYRGDLIELPQQD 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               +           + +   +  +  +D+  S  Q+  K +M+K+E++ E ++S G+P
Sbjct: 178 LGVAMRDTLHVAGVAFLCMAAVMMLVAAVDVPLSLWQYARKHRMTKEEVRKEHRESEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +++ R   + +MM    +A +I+TNPTHYA+ALRY + E  AP ++AKG +++A
Sbjct: 238 HVKGRIRNLQRQAAQRRMMADVPKADVIVTNPTHYAVALRYSEKEGGAPRVLAKGADMVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++  EH IPI E P LAR+L++   I   IP   Y AVA+++  +Y  +
Sbjct: 298 AKIRELGTEHKIPILEAPPLARALYRHTEIGHQIPEALYAAVAEVLAYVYQLR 350


>gi|304311113|ref|YP_003810711.1| Flagellar biosynthetic protein [gamma proteobacterium HdN1]
 gi|301796846|emb|CBL45058.1| Flagellar biosynthetic protein [gamma proteobacterium HdN1]
          Length = 375

 Score =  337 bits (864), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 105/353 (29%), Positives = 186/353 (52%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++ D    KTE  + +K+E A  +G  P SR+    S ++   I +L +      +  +
Sbjct: 1   MADED-GQEKTEDATPRKLEQAYEKGQTPRSRDLVAVSMLIIGGIGMLLYVEQIYRAFVT 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
              +   +  + K+ D S ++  L   + +A + ++P      +  I + +      ++ 
Sbjct: 60  AFEMGF-TFDREKIFDDSAMMRALLQAAYAAGKSLLPLFATLAVVAIAASVASGGLHVSS 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + +   F++++   GIKR++S+ +LV  +KS +K+ LVG    + +   +   L  I   
Sbjct: 119 HPLMFKFEKLNPLSGIKRMFSLQSLVELIKSIMKVSLVGFTAWLVVKAQFAEYLGLIDEP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V    + + L +A +  +D+ +   Q+  +L+M+KQE+KDE K S G P
Sbjct: 179 IQQAMLHSISMVAWAFVWLSLSLALVAAIDVPYQNWQFRKQLRMTKQEVKDEYKDSEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK +Q+  AR      MM    +A ++ITNPTH+A+ALRY  T+  AP LVAKG +LIA
Sbjct: 239 EIKAKQRQRAREMAFAGMMAEVPKADVVITNPTHFAVALRYDPTKGGAPKLVAKGADLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           ++++++A  +N+ I   P LARS+F    +   IP   Y AVAQ++  +YH K
Sbjct: 299 EQIKRVAIANNVVILAAPPLARSIFYHTKLFKEIPSGLYVAVAQVLAYVYHLK 351


>gi|300854222|ref|YP_003779206.1| bifunctional flagellar biosynthesis proteins FliR/FlhB [Clostridium
           ljungdahlii DSM 13528]
 gi|300434337|gb|ADK14104.1| fusion of flagellar biosynthesis proteins FliR and FlhB
           [Clostridium ljungdahlii DSM 13528]
          Length = 606

 Score =  337 bits (864), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 97/347 (27%), Positives = 185/347 (53%), Gaps = 2/347 (0%)

Query: 7   PDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLL 66
            D+KTE  + KK  D+  +G    S+E  L  ++LA  + +         S+ S +   L
Sbjct: 262 KDDKTEEATPKKKSDSRKKGQIARSKEIGLTMTLLASTLVIAVLGGYVGTSLGSTMVAFL 321

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
                  L + S +  ++       + + +P  +  +  G+ + ++Q   ++    +KP 
Sbjct: 322 NDYINTSL-NYSSVNKIMFITIWRIAIVFLPIAVPILAIGVLANMVQTRGLITFETLKPD 380

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
           F +++   G KR++S  +++  +K    + +VG +    + +NY  +L+    +  ++  
Sbjct: 381 FSKLNPISGFKRMFSARSVMELLKDTAIVSIVGYVGYKFIKDNYMYILNLGQLDSRAVAK 440

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
                   +   I L +  + +LD  +  +Q+   L+MSKQEIK+E KQ  G+P IK ++
Sbjct: 441 AIGSLAVGIFFRITLIMLIIAILDYMFQRYQYNKDLRMSKQEIKEEFKQDEGDPQIKGKR 500

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           +   R     +MM+   +AT+++TNPTH A+AL+Y + +N APVLVAKG + +A K+++I
Sbjct: 501 RQKQRELAMRRMMQEVPKATVVVTNPTHVAVALKYEEGQN-APVLVAKGLDAVALKIKEI 559

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A ++++PI E   LAR ++K+V I+  IP   Y+AVA+++  +Y  +
Sbjct: 560 AKDNDVPIIENRPLARLIYKEVEIDMEIPAEMYQAVAEILALVYKMR 606


>gi|221635443|ref|YP_002523319.1| flagellar biosynthetic protein FlhB [Thermomicrobium roseum DSM
           5159]
 gi|221157327|gb|ACM06445.1| flagellar biosynthetic protein FlhB [Thermomicrobium roseum DSM
           5159]
          Length = 363

 Score =  337 bits (864), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 96/345 (27%), Positives = 171/345 (49%), Gaps = 1/345 (0%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            +TE  + ++ ++A   G  P S + +    +LA   +L ++      ++   L    + 
Sbjct: 4   ERTERATPRRRQEARKRGQVPRSADLTSALVLLAGAFFLPWYAGAAGQTLWDYLERAFSG 63

Query: 69  ATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFK 128
              R L     IV L      +  +L +P L LF   G+ S L+Q   V     +KP ++
Sbjct: 64  PLPRDLTGP-DIVALAWASGATVLKLALPILGLFAAVGVASTLVQAGFVFAPAVLKPDWR 122

Query: 129 RVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHA 188
           R+    G +R++S   L    K+ +KI +V  +    +  +     D   A P +I    
Sbjct: 123 RIDPIAGFQRLFSRRGLFETGKALLKIAIVLAVTYPLIQRDLPRYADLTGAEPAAIAQAI 182

Query: 189 FFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKS 248
             ++R + + +      L +LD G+       +L+M++ E+K+E++Q+ G+P IK R + 
Sbjct: 183 GQSMRDLAVRVGAAYLALAILDYGFQRWDLEQRLRMTRHELKEELRQTEGDPEIKARIRR 242

Query: 249 IARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAY 308
           + R     +MM    +AT+++TNPTH A+ALRY      APV+VAKG   +A+++  IA 
Sbjct: 243 LQRQMAMRRMMAQVPKATVVVTNPTHLAVALRYEPRSMRAPVVVAKGAGAVAERITAIAR 302

Query: 309 EHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +H IP+     LA++L++ V +   IP   Y+AVA +I  +Y  +
Sbjct: 303 QHTIPVLRNQPLAQALYRTVEVGQEIPITLYEAVADIIAYVYRLR 347


>gi|83309718|ref|YP_419982.1| flagellar biosynthesis protein FlhB [Magnetospirillum magneticum
           AMB-1]
 gi|82944559|dbj|BAE49423.1| Flagellar biosynthesis pathway [Magnetospirillum magneticum AMB-1]
          Length = 355

 Score =  337 bits (864), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 114/353 (32%), Positives = 201/353 (56%), Gaps = 3/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E    D+KTE P+ +K+  A  +GN P S+E  +++S++  L+ +  F       +  
Sbjct: 1   MAE--DSDDKTEEPTDRKLSQAREQGNIPTSQEVKIWASLVGALVVVTLFAPYMARDIGR 58

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   +       +     +  LL+ +++   +L+I  +++ ++  I S + Q   +   
Sbjct: 59  LLLPFVEHPHAFPM-GREDVGQLLSGITVDMIKLLIMPMMMLVVLAIASAMGQSGLMFLP 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + +   F ++S  +G++RI+S  NLV F+KS  K+  +G +I + L  +        + +
Sbjct: 118 DKLTLDFGKLSPGKGLQRIFSGRNLVEFVKSLFKVSAIGFVIFLILKSHMSEYAGLAALD 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             ++L +    V  ++I+++L +  L   D  +    +  ++KM+KQEIKDE KQ+ G+P
Sbjct: 178 LMAVLDYLRHQVITMIIVVVLMVFVLAAADWFYQRWAFTQQMKMTKQEIKDEHKQTEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           +IK R +++   R R +MM A  RA++++TNPTHYA+AL+Y Q    APVLVAKG +LIA
Sbjct: 238 MIKGRLRALRMQRARQRMMAAVPRASVVVTNPTHYAVALQYDQDSMGAPVLVAKGVDLIA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           K++R +A E+ +PI E P LAR+L+  V ++  IPP  YK VA++I  +   K
Sbjct: 298 KRIRDLATENEVPIVENPPLARALYATVELDQEIPPEHYKTVAEIIGYVMKLK 350


>gi|212639548|ref|YP_002316068.1| flagellar biosynthesis protein FlhB [Anoxybacillus flavithermus
           WK1]
 gi|212561028|gb|ACJ34083.1| Flagellar biosynthesis pathway, component FlhB [Anoxybacillus
           flavithermus WK1]
          Length = 360

 Score =  337 bits (864), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 89/346 (25%), Positives = 172/346 (49%), Gaps = 1/346 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE  + +K ++   +G    S + +    +L   + L F       ++T        
Sbjct: 13  GEKTEKATPRKRQEVRKKGQVAKSADVTAAFLMLIVFLVLSFSSGMWGDAITRLFRQSFQ 72

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
                 +  I  +  +   L    + LV P  L  +   + +  +Q   +     ++   
Sbjct: 73  HYFFMDV-TIDSVQLIFVDLLQQLALLVGPIFLAAIAAALFANFVQVGFLFTTEPLQMKL 131

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
            ++   +G KRI+S+  LV  +KS +K++ +  +    L  +   +L     +  +I   
Sbjct: 132 SKLDPIQGFKRIFSLRALVELLKSILKVLFISVVTFSILWMHIDDILSLSHKSIGAIAAT 191

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
                 ++ ++  + +  L++ D  +  + +   ++MSKQ+IKDE K++ G+P+IK+R K
Sbjct: 192 LGRLTIQMGLVASVALLFLSLFDYLYQRYDFEKNIRMSKQDIKDEYKKTEGDPLIKSRIK 251

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              R     +MM+    A ++ITNPTH+A+AL+Y + + DAP++VAKG + +A+K++ IA
Sbjct: 252 QKQREMAMRRMMQEVPEADVVITNPTHFAVALKYDEQQADAPIVVAKGADYMAQKIKDIA 311

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++++ I E   LAR+L+ Q  I   IP  F+KAVA+++  +Y  K
Sbjct: 312 KKNDVMIVENRPLARALYDQTDIGMVIPEAFFKAVAEILAYVYKTK 357


>gi|163794129|ref|ZP_02188102.1| flagellar biosynthesis protein B [alpha proteobacterium BAL199]
 gi|159180743|gb|EDP65262.1| flagellar biosynthesis protein B [alpha proteobacterium BAL199]
          Length = 358

 Score =  336 bits (863), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 113/353 (32%), Positives = 198/353 (56%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS++     KTE P+ KK+ DA  +G    S+E + F+S+LA    +          + S
Sbjct: 1   MSDSQDDSQKTEEPTGKKLGDARKKGQIAQSKEVTNFASLLALTFAVTILAPYMAIQLYS 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            + V++  A   ++ D      +L  L +     + P L   M+ G+ + L Q   +   
Sbjct: 61  SMAVVIEHAAVARI-DAGSTSEILMGLVIDTFLALAPTLGTVMVLGVAATLGQSGILFTT 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + + P  +++S   G KR++S+ ++V F+K  +K+ +V  I  + ++       + ++ +
Sbjct: 120 DPIMPKLEKLSPLAGFKRLFSLKSIVEFIKGIIKLAIVAFIAYVLMSPELDRAEELLTMD 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
              +L      V ++++ +L F+A + + D  +  ++ Y +L+MS+Q+I+DE KQ+ G+P
Sbjct: 180 LIEVLKEIQTLVIRLMMGVLAFMAVVAIADYIYQRYEHYKQLRMSRQDIRDEHKQAEGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R + I   R R +MM A  +A ++ITNPTH+A+AL+Y  +   APV+VAKG + +A
Sbjct: 240 QIKARLRQIRADRARRRMMAAVPKADVVITNPTHFAVALQYDTSAMAAPVVVAKGSDAVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EH +PI E P LAR+LF  V I+  IP  +YKAVAQ+I  +Y  K
Sbjct: 300 FRIREVAKEHKVPIVENPPLARALFASVEIDEQIPETYYKAVAQVISYVYRLK 352


>gi|52080241|ref|YP_079032.1| flagellar biosynthesis protein FlhB [Bacillus licheniformis ATCC
           14580]
 gi|52785618|ref|YP_091447.1| flagellar biosynthesis protein FlhB [Bacillus licheniformis ATCC
           14580]
 gi|319645980|ref|ZP_08000210.1| FlhB protein [Bacillus sp. BT1B_CT2]
 gi|52003452|gb|AAU23394.1| flagella-associated protein [Bacillus licheniformis ATCC 14580]
 gi|52348120|gb|AAU40754.1| FlhB [Bacillus licheniformis ATCC 14580]
 gi|317391730|gb|EFV72527.1| FlhB protein [Bacillus sp. BT1B_CT2]
          Length = 359

 Score =  336 bits (863), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 105/346 (30%), Positives = 185/346 (53%), Gaps = 1/346 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE  + KK  ++  +G    S + +   ++L   +  LF        +   +     
Sbjct: 12  GEKTEKATPKKRRESRKKGQVAKSADVNTAVTLLIVFLSFLFIGPFMRDRLLGLIEKYYK 71

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
                K+  +++I  L   + L +  ++ P LL  ++ G+ S  +Q   +     +KP  
Sbjct: 72  ELITMKV-SVANIPGLFQSVVLESGLIMAPLLLTAVVSGVLSNYMQVGFLFAPEAIKPDL 130

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
           K++    G KRIYSI  +V  +KS +KI++VG +    L  N+  +L   + +    L +
Sbjct: 131 KKLDPLNGFKRIYSIRAIVELLKSILKIVIVGGVTFAVLWLNFDKILRIPALSAGEALSY 190

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
             +    + +   + +  L VLD  +    +   ++MSKQ+IKDE K++ G+P+IK++ K
Sbjct: 191 VGWLTFLMGVSAAVALIFLAVLDYLYQKFDYEKNIRMSKQDIKDEYKKTEGDPLIKSKIK 250

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              +     +MM+   +A +IITNPTHYA+AL+Y + + DAP ++AKG +L+A K+R+IA
Sbjct: 251 QKQKEMAMRRMMQEVPKADVIITNPTHYAVALKYDENKMDAPFIIAKGVDLMALKIRQIA 310

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            EH++   E   LAR+L+ QV I+ A+P  F+KAVA+++  +Y  K
Sbjct: 311 KEHDVMTVENRPLARALYDQVEIDQAVPEEFFKAVAEILAYVYKTK 356


>gi|45479286|gb|AAS66688.1| FlhB [Agrobacterium sp. H13-3]
          Length = 374

 Score =  336 bits (863), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 151/352 (42%), Positives = 232/352 (65%)

Query: 2   SENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSD 61
           +++   D+KTE P+ KK+ DA  +GN P SRE  +F+S LA   YL+FF   G   +   
Sbjct: 16  ADDQDKDSKTEDPTEKKLRDAAEKGNLPFSREVPIFASSLAFYCYLVFFLPDGAGRLGVT 75

Query: 62  LHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLN 121
           L  L     Q  L      + LL  L  S + L++P +++F++FG+ S   Q +P   L 
Sbjct: 76  LKDLFGQPEQWNLSTRPDALSLLYFLGTSMAYLLMPAMIMFIVFGLASSFFQNLPSPVLE 135

Query: 122 HVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANP 181
            V+P + R+S  +G  RIYS    V F KS  KI++V  I+ +SL  ++++++D + ++P
Sbjct: 136 RVRPQWSRISPAKGFGRIYSKQGFVEFGKSLFKILIVSIIMFLSLRGDFYSLIDLMFSDP 195

Query: 182 HSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPI 241
             I        +K++++IL   A L  +D+ W+ H W+S+LKM+K E+K+E KQS G+P+
Sbjct: 196 QVIFVRVVELTKKMMVVILFSTALLAAVDLLWTRHHWFSQLKMTKHEVKEEYKQSQGDPV 255

Query: 242 IKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAK 301
           +K RQ+S+AR R R +M++   RAT++I NPTH+A+ALRY++ E DAPV+VAKGQ+LIA 
Sbjct: 256 VKARQRSVARDRARRRMIDNVPRATLVIANPTHFAVALRYVREEGDAPVVVAKGQDLIAL 315

Query: 302 KMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           K+R+IA ++NIP+FE+P LARS+F QV I+S IPP FYKAVA+L++++Y  K
Sbjct: 316 KIREIAEKNNIPVFEDPPLARSMFAQVSIDSVIPPAFYKAVAELVHRVYAMK 367


>gi|332799194|ref|YP_004460693.1| flagellar biosynthetic protein FlhB [Tepidanaerobacter sp. Re1]
 gi|332696929|gb|AEE91386.1| flagellar biosynthetic protein FlhB [Tepidanaerobacter sp. Re1]
          Length = 358

 Score =  336 bits (863), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 96/347 (27%), Positives = 178/347 (51%), Gaps = 1/347 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLL- 66
           + +TE  + ++ + A   G    SRE +    +L   + +       + ++    + +L 
Sbjct: 8   EERTEKATPRRRQKARERGQVFSSRELNSALVLLGSFLLIKIVGKNFVMNIMDFFNHILT 67

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
            +  +  +  +  I      + + A +   P  L      + S  +Q   VL+L  V P 
Sbjct: 68  ETINREDIFTLEGIETFSYEILIFAGKNFAPVALGLSCICLISNYMQVGFVLSLEPVSPK 127

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
            +R++  EG KRI+S  +L+  +KS  KI +V  ++  ++ +        ++ N      
Sbjct: 128 LERINPLEGFKRIFSRRSLLELIKSIAKITVVAYVVCTAIIKYKDLFPLMLNMNLLDASS 187

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
                  +V +     +  ++ LD  + ++++ + L MSKQ+IK+E K+  GNP IK+R 
Sbjct: 188 LTLSIAFEVGMKAAATLLIVSALDYFYQWYEYETSLMMSKQDIKEEYKEVEGNPQIKSRI 247

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           + + R   R +MM+   +A ++ITNPTHYA+AL Y    + APV++AKG + +A+K+++I
Sbjct: 248 RQMQRQMARTRMMKDVEKADVVITNPTHYAVALAYDAALHSAPVVLAKGVDKLAEKIKEI 307

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A + ++PI E  +LA++L+K V I   IP   Y AVA+++  IY  K
Sbjct: 308 ATKEDVPIVENKALAQTLYKTVEIGDIIPESLYNAVAEILAFIYSLK 354


>gi|319790410|ref|YP_004152043.1| flagellar biosynthetic protein FlhB [Thermovibrio ammonificans
           HB-1]
 gi|317114912|gb|ADU97402.1| flagellar biosynthetic protein FlhB [Thermovibrio ammonificans
           HB-1]
          Length = 347

 Score =  336 bits (862), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 93/353 (26%), Positives = 177/353 (50%), Gaps = 9/353 (2%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++ +   KTE  + ++ + A  EG    S++ S+  S++   + L F+       +  
Sbjct: 1   MAKDPS---KTEKATPRRRQKAREEGQVLRSQDLSIAFSLVLVAVTLFFYLPFAFRELLK 57

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
             +         +L     +   +       + L  P  L+ ++ G+ S ++Q   +  L
Sbjct: 58  LFNYTFEELPFLELNQFVFVSLEI------LALLTFPVFLVLLVGGVLSNVVQFGFLFTL 111

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P    ++  +G +R++S+  L   +KS VK+     +   ++         + S  
Sbjct: 112 KPLVPKLDPINPVKGFQRLFSLKTLFELVKSLVKLGFASAVGYFAVKYLTRYFTSYASFP 171

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               LY+   ++  +++   L    +  LD  +   ++   LKMSKQE+K+E KQ  G+P
Sbjct: 172 LEVQLYYLAKSLVVLVVAFALLAVPVAGLDFLYRRWEYEENLKMSKQEVKEERKQYEGHP 231

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           +IK+  +   R     +MM    +A ++ITNP HYA+AL+Y + +  AP +VAKG + +A
Sbjct: 232 LIKSEIRKRQRQLAMRRMMAEVPKADVVITNPEHYAVALKYERGKMYAPKVVAKGVDSVA 291

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+++IA EH +P+ E P LAR+L++   +   IP  FY+AVA+++ KIY ++
Sbjct: 292 LKIKEIALEHGVPVEENPPLARALYESCEVGDFIPEEFYRAVARILAKIYRRR 344


>gi|330828812|ref|YP_004391764.1| flagellar biosynthetic protein FlhB [Aeromonas veronii B565]
 gi|328803948|gb|AEB49147.1| Flagellar biosynthetic protein FlhB [Aeromonas veronii B565]
          Length = 376

 Score =  336 bits (862), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 85/354 (24%), Positives = 169/354 (47%), Gaps = 4/354 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++ D    +TE P+ K+++ A  +G    S+E    S +L+ +  LL        ++  
Sbjct: 1   MADTD--QERTEQPTGKRLQQAREKGQIARSKELGTASVLLSAVFGLLMLKGSLATAMIK 58

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            + +   +  + +  D + ++ ++  L       +     L  +       +      + 
Sbjct: 59  VVTMGF-TLDREQAFDPNAMIAMVPALLGELVLPLGLLFALVAIAAFIGNTLMGGMNFST 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   ++S   G+KR++ + +L+  +KS  K++ +       L+  +  +L+     
Sbjct: 118 EAMMPKMSKLSPLSGLKRMFGVQSLIELVKSIAKVVFITLFAWWMLSSQFNHLLNLSMEG 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               +  A      +LI++   +  +  +D+ +       +LKM+KQE+KDE K S G P
Sbjct: 178 FPGGIIDALELFLWMLIILCCALLPIVAIDVPFQQWNHMRQLKMTKQEVKDEFKDSEGKP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTE-NDAPVLVAKGQNLI 299
            +K + + +       +MM    +A ++ITNPTHY++AL+Y   +   AP +VAKG + I
Sbjct: 238 EVKGKIRQLQMQMAMRRMMGDVPKADVVITNPTHYSVALKYDAGKPGAAPKVVAKGTDEI 297

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A K+R+IA E+ IPI   P+L R+++    +   IP   + AVAQ++  ++  K
Sbjct: 298 AMKIREIAREYEIPIMPSPALTRAIYHSTELGHEIPEGLFAAVAQVLAYVFQLK 351


>gi|254497495|ref|ZP_05110288.1| flagellar biosynthesis protein FlhB [Legionella drancourtii LLAP12]
 gi|254353310|gb|EET12052.1| flagellar biosynthesis protein FlhB [Legionella drancourtii LLAP12]
          Length = 378

 Score =  336 bits (862), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 101/353 (28%), Positives = 186/353 (52%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE +  D KTE PS+K++++A  +G    S++ +   ++L   +  L F       +  
Sbjct: 1   MSEQNN-DEKTEQPSAKRLKEARQKGQVARSKDFNTTVALLFTAVGFLAFGKQLSDQLAL 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +       T   +  +  +  L     +     ++P L+   +  + + L+    V + 
Sbjct: 60  MMRHSFEFDTNVIITPVVSLERLFFLAKM-GFWALVPILIFIFVVSLAAPLVMGGWVFSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             V+P F R+++ +G+KR+ S+ N V  +KSF K +LV ++  I L     T+L      
Sbjct: 119 KVVQPKFSRLNVFQGLKRMVSLKNFVEMIKSFFKFVLVASVAVIVLKSQIPTLLSLAHVP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             + +      V K  +++   +  + +LD+ +  ++    +KM+KQE++DE K++ G P
Sbjct: 179 IETAIGSGALIVVKCFVLVAASLLLIAMLDVPFQLYEHNKNMKMTKQELRDEYKETEGKP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +KN  +   +   + +MM     A +++TNPTHYA+A+RY +  N APV+VAKG++L+A
Sbjct: 239 EVKNAIRRAQQEIAKRRMMTEIPTANVVLTNPTHYAVAIRYKEKGNKAPVVVAKGKDLVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++ K+A EH IPI   P LAR+L+    +N+ IP   Y AVAQ++  ++  +
Sbjct: 299 FQINKVAKEHEIPIISVPPLARALYFSTKLNAEIPRGLYIAVAQVLAYVFQLR 351


>gi|224373568|ref|YP_002607940.1| flagellar biosynthetic protein FlhB [Nautilia profundicola AmH]
 gi|223588472|gb|ACM92208.1| flagellar biosynthetic protein FlhB [Nautilia profundicola AmH]
          Length = 351

 Score =  336 bits (862), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 106/353 (30%), Positives = 185/353 (52%), Gaps = 5/353 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+       KTE P+ KK++DA  EGN P S E S F  +   +I ++F+     Y +  
Sbjct: 1   MA---DDMEKTEDPTPKKLQDARKEGNVPKSMETSGFVVLFVAIIVIIFYLKYITYYLEK 57

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
                 +       ++I  +  ++   +L+   L+ P L   ++ GI   ++Q   +  +
Sbjct: 58  FYMYYTSFIGVEITKNI--VFEIVLKSALNFFILLAPLLGAVVLAGILGNVMQFGFLFTV 115

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F++++  +GIKR++S+  LV  +K  +K+ +   +      +    +      +
Sbjct: 116 KPIIPKFEKINPIKGIKRLFSLKTLVEGIKMTLKVSVAFGVGAWLFMKFLEEIPKLELMS 175

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               L         ++  +L        +D  +  + +   L+MSKQEIKDE KQ+ GNP
Sbjct: 176 FFEQLKWFEEKALIIISAMLAVFLVFAAIDFIYQRYSYKKSLRMSKQEIKDEYKQTEGNP 235

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK + + + R   + +MM    +A ++ITNPTHYA+A+RY +T+++AP ++AKG + +A
Sbjct: 236 EIKAKIRQLQREMAKKRMMSEVPKADVVITNPTHYAVAIRYDKTKDEAPRVIAKGVDNLA 295

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+++IA EH+I I E P LAR L+K V I+  IP   YKAVA+++  +Y  K
Sbjct: 296 LKIKEIAREHDIMIVENPPLARELYKLVDIDELIPQKLYKAVAEVLAFVYKAK 348


>gi|309778952|ref|ZP_07673722.1| flagellar biosynthetic protein FlhB [Ralstonia sp. 5_7_47FAA]
 gi|308922299|gb|EFP67926.1| flagellar biosynthetic protein FlhB [Ralstonia sp. 5_7_47FAA]
          Length = 387

 Score =  336 bits (861), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 90/353 (25%), Positives = 174/353 (49%), Gaps = 3/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE  +   KTE  S +++E A  EG+ P SRE + F+        L       + + ++
Sbjct: 1   MSEE-SDLEKTEPASPRRLEQAREEGDVPRSRELASFALTAVSAGGLWVMGDSIVRAASA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L    +            +T   +  + + + GL+L ++    S L      ++ 
Sbjct: 60  FLARCLE-FHRYNYTSGQDQWNYVTGQFMPLA-MALGGLMLMLVIAALSPLALTRGAISF 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   R+   +G+ R++S+  L+   +  +K+ L+  +  + +      +++    +
Sbjct: 118 KPLSPDISRLFKLQGLTRMFSLEGLMELPRLLIKLFLIAGVGWLLVRYYRGDLIELPQQD 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               +           + +   +  +  +D+  S  Q+  K +M+K+E++ E ++S G+P
Sbjct: 178 LGVAMRDTLHVAGVAFLCMAAVMMLVAAVDVPLSLWQYARKHRMTKEEVRKEHRESEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +++ R   + +MM    +A +I+TNPTHYA+ALRY + E  AP ++AKG +++A
Sbjct: 238 HVKGRIRNLQRQAAQRRMMADVPKADVIVTNPTHYAVALRYSEKEGGAPRVLAKGADMVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++  EH IPI E P LAR+L++   I   IP   Y AVA+++  +Y  +
Sbjct: 298 AKIRELGTEHKIPILEAPPLARALYRHTEIGHQIPEALYAAVAEVLAYVYQLR 350


>gi|217972629|ref|YP_002357380.1| flagellar biosynthesis protein FlhB [Shewanella baltica OS223]
 gi|217497764|gb|ACK45957.1| flagellar biosynthetic protein FlhB [Shewanella baltica OS223]
          Length = 376

 Score =  336 bits (861), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 80/340 (23%), Positives = 163/340 (47%), Gaps = 1/340 (0%)

Query: 14  PSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLASATQRK 73
           P+ +++E A  +G    S+E    + +++              S+T     +  +  + +
Sbjct: 13  PTGRRLEQAREKGQIARSKELGTAAVLISAACGFYMLGPSLATSLTRVFETVF-TMDRAQ 71

Query: 74  LEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKRVSLR 133
           + D   +  +   ++   +  +   +LL ++      +       +   + P   ++S  
Sbjct: 72  IFDTEEMFNVWGVVASEIAWPMAKIMLLIVVVAFIGNVALGGMNFSTQAMMPKASKMSPA 131

Query: 134 EGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAFFTVR 193
            G+KR++ +  LV   K   K  +V     + L+  +  ++   S +    +YHA   + 
Sbjct: 132 AGLKRMFGVQALVELTKGIAKFSVVAFSAYLLLSFYFNDIMLLSSDHLPGNVYHALDLLV 191

Query: 194 KVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSR 253
            + I++   I  + V+D+ +       +LKM+KQE+KDE K + G P +K R + + R  
Sbjct: 192 WMFILLCSSILLIVVIDVPFQIWNHNKQLKMTKQEVKDEYKDTEGKPEVKGRVRQMQREL 251

Query: 254 IRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIP 313
            + +MM     A +I+ NP H+A+A++Y    + AP ++AKG + +A K+R+IA EHNI 
Sbjct: 252 AQRRMMAEVPNADVIVVNPEHFAVAIKYDVQRSAAPFVIAKGVDDVAFKIREIAREHNIA 311

Query: 314 IFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           I   P LAR+++    ++  IP   + AVAQ++  ++  +
Sbjct: 312 IVSAPPLARAIYHTTKLDQQIPEGLFTAVAQILAYVFQLR 351


>gi|160876164|ref|YP_001555480.1| flagellar biosynthesis protein FlhB [Shewanella baltica OS195]
 gi|160861686|gb|ABX50220.1| flagellar biosynthetic protein FlhB [Shewanella baltica OS195]
 gi|315268360|gb|ADT95213.1| flagellar biosynthetic protein FlhB [Shewanella baltica OS678]
          Length = 376

 Score =  336 bits (861), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 80/340 (23%), Positives = 163/340 (47%), Gaps = 1/340 (0%)

Query: 14  PSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLASATQRK 73
           P+ +++E A  +G    S+E    + +++              S+T     +  +  + +
Sbjct: 13  PTGRRLEQAREKGQIARSKELGTAAVLISAACGFYMLGPSLATSLTRVFETVF-TMDRAQ 71

Query: 74  LEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKRVSLR 133
           + D   +  +   ++   +  +   +LL ++      +       +   + P   ++S  
Sbjct: 72  IFDTEEMFNVWGVVASEIAWPMAKIMLLIVVVAFIGNVALGGMNFSTQAMMPKASKMSPA 131

Query: 134 EGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAFFTVR 193
            G+KR++ +  LV   K   K  +V     + L+  +  ++   S +    +YHA   + 
Sbjct: 132 AGLKRMFGVQALVELTKGIAKFSVVAFSAYLLLSFYFNDIMLLSSDHLPGNVYHALDLLV 191

Query: 194 KVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSR 253
            + I++   I  + V+D+ +       +LKM+KQE+KDE K + G P +K R + + R  
Sbjct: 192 WMFILLCSSILLIVVIDVPFQIWNHNKQLKMTKQEVKDEYKDTEGKPEVKGRVRQMQREL 251

Query: 254 IRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIP 313
            + +MM     A +I+ NP H+A+A++Y    + AP ++AKG + +A K+R+IA EHNI 
Sbjct: 252 AQRRMMTEVPNADVIVVNPEHFAVAIKYDVQRSAAPFVIAKGVDDVAFKIREIAREHNIA 311

Query: 314 IFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           I   P LAR+++    ++  IP   + AVAQ++  ++  +
Sbjct: 312 IVSAPPLARAIYHTTKLDQQIPEGLFTAVAQILAYVFQLR 351


>gi|288573010|ref|ZP_06391367.1| flagellar biosynthetic protein FlhB [Dethiosulfovibrio
           peptidovorans DSM 11002]
 gi|288568751|gb|EFC90308.1| flagellar biosynthetic protein FlhB [Dethiosulfovibrio
           peptidovorans DSM 11002]
          Length = 364

 Score =  336 bits (861), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 85/343 (24%), Positives = 168/343 (48%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
           + KTE  + +K      EG    S++    + I+A LI ++ F       + S +   L 
Sbjct: 15  EEKTEPATPRKRRKEREEGRVAKSQDLGASAVIIAGLIAVILFGGWIFDVILSFIRECLF 74

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
                 L        L      +    ++P ++   +      + Q   V+    + P  
Sbjct: 75  FIGDGTLGRTGWFHSLTMRSISAYGLAIVPMVVGCFLAAFFVSVAQVGFVMTSKPLIPKM 134

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
            R +   G+K++ S+ +LV  +K  +K +++  ++  +L  +   M+  +       +  
Sbjct: 135 NRFNPISGLKKVISLRSLVEMVKGILKALILAIVLYSALRGDLADMVMAVRYPIGPAVSL 194

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
             + +  + + +   +  + + D  +   ++   +KMSKQEIK+E KQ  G+P IK + +
Sbjct: 195 LLWRIWLLCVKMTFLLLVIAIFDWSYQKWEFEKNIKMSKQEIKEEYKQMEGDPQIKQKIR 254

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              R   + +MM    +A ++ITNPT  A+AL+Y + + DAPV++AKG+ L+A+++R+IA
Sbjct: 255 QKQREMAKQRMMADVPQADVVITNPTTLAIALQYDREKMDAPVVLAKGKGLLARRIREIA 314

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
            E+++P+ E   LA +L   V +  +IP   YK+VA+++  +Y
Sbjct: 315 EENDVPVVENKPLAWALHDSVEVGESIPETLYKSVAEVLAFVY 357


>gi|253990145|ref|YP_003041501.1| flagellar biosynthesis protein FlhB [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|211639018|emb|CAR67632.1| flagellar biosynthetic protein flhb [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|253781595|emb|CAQ84758.1| flagellar biosynthetic protein flhb [Photorhabdus asymbiotica]
          Length = 383

 Score =  336 bits (861), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 99/353 (28%), Positives = 177/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   KTE P+  K E A  EG    SRE S    + + L  L        + ++ 
Sbjct: 1   MAE-DSDLEKTEEPTPHKREKARKEGQIARSRELSSILMLTSGLSLLWLSGQSIAHELSL 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +     +     + +   +V  +  L   A   ++P     ++  + +  +    V + 
Sbjct: 60  MVFEGF-NFDHSMVSNDKQMVQQIGRLLRQAVWALLPVFAGLVLVALSAPALLGGLVFST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K   K+++   G+KRI+S+N L    K+ +K   VG    + L  N+ +ML  I+  
Sbjct: 119 KSIKFDPKKLNPISGLKRIFSMNALAELFKALLKAGFVGIGAALFLWMNWPSMLRLIAQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   L  A   +     +++  +  +   D+ +  +    KL+M++QEIKDE K+  G+P
Sbjct: 179 PLLALDDAMQMLIFAGYVVVFMLIPMVAFDVVYQIYSHLKKLRMTRQEIKDEFKEQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A +I+TNPTHYA+AL+Y + +  AP ++AKG  +IA
Sbjct: 239 HVKARIRQQQRAAARQRMMADVPKADVIVTNPTHYAVALQYDEKQMSAPKVLAKGAGIIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            +++++  E+ IP+ E P LAR+L++   +   IP   Y AVA+++  +Y  K
Sbjct: 299 LRIKEMGTENRIPLLEAPPLARALYRHSEVGGHIPATLYAAVAEVLAWVYQLK 351


>gi|296330853|ref|ZP_06873328.1| flagellar biosynthesis protein FlhB [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305674371|ref|YP_003866043.1| flagellar export machinery protein [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296151858|gb|EFG92732.1| flagellar biosynthesis protein FlhB [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305412615|gb|ADM37734.1| component of the flagellar export machinery [Bacillus subtilis
           subsp. spizizenii str. W23]
          Length = 360

 Score =  335 bits (860), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 107/346 (30%), Positives = 181/346 (52%), Gaps = 1/346 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE  + KK +D   +G    S + +   S+L   + L+         + S L     
Sbjct: 12  GEKTEKATPKKRKDTRKKGQVAKSADVNTAVSLLVIFLSLIAIGPFMRDRLLSFLETFYT 71

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
            +   KL + +++  L   L    + ++ P +L+ ++ G+ S  +Q   + +   ++P  
Sbjct: 72  ESLTMKLSE-ANVHTLFISLLKDTAFVLAPIMLVALVAGVVSNYMQVGFLFSAEVIQPKL 130

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
           +++   +G KRIYS+  +V  +KS +KI +VG      L  +Y  +L      P   L  
Sbjct: 131 EKLDPIKGFKRIYSMRAIVELIKSILKITVVGFAAFAVLWLHYGEILRLPLLTPEEALSF 190

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
                  + +     +  L  LD  +    +   +KMSKQ+IKDE K+S G+PIIK++ K
Sbjct: 191 VSKLTLWMGLSGAGALLLLAGLDYLYQRFDYEKNIKMSKQDIKDEYKKSEGDPIIKSKIK 250

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              R     +MM+   +A +IITNPTHYA+AL+Y + + DAP +VAKG + +A K+RKIA
Sbjct: 251 QRQREMAMRRMMQEVPKADVIITNPTHYAIALKYDEEKMDAPYIVAKGVDHLALKIRKIA 310

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            EH++ + E   LAR+L+ QV I+ A+P  F+K +A+++  +Y  K
Sbjct: 311 KEHDVMMVENRPLARALYDQVEIDQAVPEEFFKVLAEILAYVYKTK 356


>gi|241203095|ref|YP_002974191.1| flagellar biosynthesis protein FlhB [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240856985|gb|ACS54652.1| flagellar biosynthetic protein FlhB [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 359

 Score =  335 bits (860), Expect = 6e-90,   Method: Composition-based stats.
 Identities = 153/350 (43%), Positives = 238/350 (68%), Gaps = 1/350 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++ D  D+KTEAP++KK  DA  +GN P SRE S+F++ILA  IYL+FF    +  ++ 
Sbjct: 1   MAD-DDKDSKTEAPTAKKQSDAAEKGNVPSSRELSIFATILATFIYLVFFLPDSVGRMSE 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  +     Q K+E    ++ L   L  +++ LV P  +LFM+FG+ S + Q +P L L
Sbjct: 60  TLRDIFEQPDQWKIETGPDVLALFVRLGWASAALVAPAFILFMVFGVASSVFQNLPTLVL 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P   R+S  +G  R++S+  LV F KS  K+++VG I+   L   YF  +D + ++
Sbjct: 120 ERIRPQASRISPIKGWSRLFSVPGLVEFGKSLFKVVVVGVILFFVLRSEYFGSIDAMFSD 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P +IL      +RK++I++L+  A + + D+ W+ H W+++LKM++ E+K+E KQ+ G+P
Sbjct: 180 PQTILVRLMAAMRKIIIVMLIATAIVAIADLFWTRHHWFTELKMTRHEVKEENKQAQGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K+RQ+S+ R R R +M+    RAT++I NPTHYA+ALRY + ENDAPV++AKGQ+LIA
Sbjct: 240 FVKSRQRSLMRDRARRRMIADVHRATLVIANPTHYAVALRYAREENDAPVVLAKGQDLIA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
            K+R+IA ++ IP+FE+P LARS+F QV I+S IP VFYKAVA+LI+++Y
Sbjct: 300 LKIREIAEKNGIPVFEDPPLARSMFAQVSIDSVIPSVFYKAVAELIHRVY 349


>gi|83858790|ref|ZP_00952312.1| flagellar biosynthesis protein [Oceanicaulis alexandrii HTCC2633]
 gi|83853613|gb|EAP91465.1| flagellar biosynthesis protein [Oceanicaulis alexandrii HTCC2633]
          Length = 358

 Score =  335 bits (859), Expect = 6e-90,   Method: Composition-based stats.
 Identities = 106/352 (30%), Positives = 178/352 (50%), Gaps = 1/352 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E +    KTE P+ +K+  A  EG+ P S+E S + ++ A L  L F     + ++  
Sbjct: 1   MAEGEDKSEKTEEPTDRKLRQAREEGDVPKSQEVSGWFTLTAGLAMLAFLAPGMVTNLAE 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L V LA   +  + D +  V L    ++    +V       ++  I   L+Q   +   
Sbjct: 61  MLLVFLAQPHELAV-DPTGAVTLAAATAMRLVLVVGLAFATLLVAAIFGNLVQTGVMFTP 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   ++   +G+ R++     +NF K   K+ +VG  I   L      +       
Sbjct: 120 KKIAPKLDKLDPIKGLTRMFGPEGWMNFFKGVGKMTIVGLAIAAVLWPRRNELAVLPGVA 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P  IL   +    +++I  L+    + VLD  +   Q+  + KMS++EI+DE+K + G+P
Sbjct: 180 PIGILQEVYSAAIQLMIAALIAYTAIAVLDFLFQRKQYIDRHKMSRKEIRDEMKDTEGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           +I+ + + I + R + +MM     A ++ITNPTHYA+AL Y Q    AP+ VAKG + +A
Sbjct: 240 MIRAKLRQIRQERAQRRMMARVPDAAVVITNPTHYAVALEYEQGRTPAPICVAKGTDEVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
            ++R +A EH+IPI E+P LAR LF  V +   IPP  + AVA++I  +   
Sbjct: 300 LRIRALAEEHDIPIVEDPPLARGLFASVELEEVIPPEHFTAVAKIIGYVLML 351


>gi|23099029|ref|NP_692495.1| flagellar biosynthesis protein FlhB [Oceanobacillus iheyensis
           HTE831]
 gi|22777257|dbj|BAC13530.1| flagella-associated protein [Oceanobacillus iheyensis HTE831]
          Length = 359

 Score =  335 bits (859), Expect = 7e-90,   Method: Composition-based stats.
 Identities = 98/346 (28%), Positives = 174/346 (50%), Gaps = 1/346 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE  + KK  D   +G    S++ +    +L C I L  F S  +  +T        
Sbjct: 12  GEKTEKATPKKRLDERKKGRVAKSQDVNTALLLLGCFIALFVFGSYMLQYMTGFFEKSFT 71

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
                 L +  ++  +    SL A  ++ P +++ ++ G+ + L+Q   + +   +K   
Sbjct: 72  EYIHWDLTE-KNVQLMFNSASLDAGMMLAPIMIIAIITGMAANLVQVRFLFSTEPLKFDL 130

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
           K++   +G KRI+SI  LV F+KS +KI+ VG +    +      ML     +    L  
Sbjct: 131 KKIDPIQGAKRIFSIRALVEFLKSMLKIVFVGIVTFYVIWIFKDDMLMTAFLDAKGALGF 190

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
                  +    ++ +  L + D  +    +   ++MSKQ+IKDE K   G+P+IK++ K
Sbjct: 191 FATVTAIMGFAAIILLVFLALFDYWYQKFDFEKNIRMSKQDIKDEYKNVEGDPLIKSKIK 250

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              R     +MM     A +IITNPTHYA+A++Y +++ +AP ++AKG + IA+K+++IA
Sbjct: 251 EKQRQMATRRMMSEVPNADVIITNPTHYAVAIKYDESKANAPYILAKGTDQIAQKIKEIA 310

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
             H++ + E   LAR L   V I   IP  +++AVA+++  +Y  +
Sbjct: 311 KNHDVIMVENRPLARGLHDAVEIGEIIPEAYFQAVAEVLAYVYRME 356


>gi|71906378|ref|YP_283965.1| flagellar biosynthesis protein FlhB [Dechloromonas aromatica RCB]
 gi|71845999|gb|AAZ45495.1| Flagellar biosynthetic protein FlhB [Dechloromonas aromatica RCB]
          Length = 379

 Score =  335 bits (859), Expect = 7e-90,   Method: Composition-based stats.
 Identities = 104/352 (29%), Positives = 178/352 (50%), Gaps = 3/352 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   KTE P+ ++IE A  +G  P SRE + F  +           S  +     
Sbjct: 3   MAE-DSDLEKTEEPTGRRIEQAREQGQVPHSRELATFLVLAVAGATFWMMGSWFMQRSLV 61

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +       ++  + D   ++  L  +S  A  +  P L L ++  I         V + 
Sbjct: 62  IMQKGFFVESRY-MRDPDLMLPRLAEISGDALFVFSPLLGLLLLAAILPPFFLNAWVFSP 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   R++   G  R++S N+L+   K+ +K +LVG +  + + +    +   +   
Sbjct: 121 KALVPDLNRLNPLSGFGRMFSWNSLMELAKAVLKAVLVGGVAAMLIWKERDEIFGLLGEP 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               L HA   V    ++++  +  + V D+ +   Q++ KLKMSK+E+K E+K+  G+P
Sbjct: 181 LEVGLAHAGHLVSFSFLILVATLVLVVVADVPFQLWQYFDKLKMSKEEVKQEMKEMMGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +S+     R +MM A  +A +++TNPTHYA+AL Y      AP +VAKG   +A
Sbjct: 241 HVKGRIRSLQMQAARKRMMSAVPKANVVVTNPTHYAVALAYQTG-MGAPKVVAKGVGAVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
            K+++IA EH +PI E P LAR+L+K   +++ IP   Y AVA+++  IY  
Sbjct: 300 LKIKEIANEHAVPIMEAPPLARALYKHSELDTEIPSALYNAVAEVLAYIYQL 351


>gi|332305672|ref|YP_004433523.1| flagellar biosynthetic protein FlhB [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332173001|gb|AEE22255.1| flagellar biosynthetic protein FlhB [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 374

 Score =  335 bits (859), Expect = 8e-90,   Method: Composition-based stats.
 Identities = 92/349 (26%), Positives = 168/349 (48%), Gaps = 1/349 (0%)

Query: 5   DAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHV 64
              + KTE P+SKKI D+  +G    S+E S    ++      +        ++      
Sbjct: 2   SDANEKTEDPTSKKITDSRKKGQVARSKELSTALVLVFSAAAFIMMGGQIAKAIYLVTQR 61

Query: 65  LLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVK 124
              + ++ +  D +H+         + +  V+  +++    GI   +             
Sbjct: 62  TF-TLSRDETYDFTHMFQAWGSAIETVAGPVMLYMVIITAAGIYGNIALGGYNFTWQGAA 120

Query: 125 PSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSI 184
           P   +++   G KR++ +N LV  +K+  K+I+V  +  I++       L          
Sbjct: 121 PKANKLNPLAGFKRMFGMNGLVELLKAIAKVIVVMGMAYIAMLVFKDEALHLDLELYPQN 180

Query: 185 LYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKN 244
           L+HA   +    +M+   +  +   D+ +  ++   ++KMSKQE+KDE K + G+P +KN
Sbjct: 181 LFHAMDLISWAFLMMCCALIPIAAFDVPYQSYKHNKEMKMSKQEVKDENKNAEGDPQVKN 240

Query: 245 RQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMR 304
           R + +      ++MM+    A +++TNPTHY++AL+Y Q    APVLVAKG + +A  +R
Sbjct: 241 RIRRLQFQAAANRMMQEVPTADVVVTNPTHYSIALKYDQQGTRAPVLVAKGVDEMAMHIR 300

Query: 305 KIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           KIA  H +PI   P LAR+++    + S IP   + AVAQ++  ++  K
Sbjct: 301 KIADAHEVPIVASPMLARAIYYSTEVESEIPTQLFMAVAQILAYVFQLK 349


>gi|70729046|ref|YP_258780.1| flagellar biosynthesis protein FlhB [Pseudomonas fluorescens Pf-5]
 gi|68343345|gb|AAY90951.1| flagellar biosynthetic protein FlhB [Pseudomonas fluorescens Pf-5]
          Length = 378

 Score =  335 bits (859), Expect = 8e-90,   Method: Composition-based stats.
 Identities = 98/353 (27%), Positives = 174/353 (49%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+++  +KTE P+ K+ +D+  +G    S+E +  + +LA    LL +       +  
Sbjct: 1   MAESESGQDKTEEPTEKRKKDSREKGEIARSKELNTLAIMLAGAGGLLVYGGGLALDLLE 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            + +   S  +  L     +   L H    A   V P LL  ++  +   +     +   
Sbjct: 61  IMRLNF-SLPREVLLSPGAMGLYLLHSGKIAILAVQPVLLTLLLAAVIGPISLGGWLFAG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R++   G+KR++S   L+  +K+  K  LV  +    L+ +   +L      
Sbjct: 120 KSLAPKFSRMNPANGLKRMFSPTALIELLKALAKFALVLFVALSVLSADIDDLLRIAHEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V    + +   +  +  +D+    +Q + KL M+KQE++DE K   G P
Sbjct: 180 LEKAIIHSIQVVGWSTLWMACGLILIAAVDVPVQLYQAHKKLLMTKQEVRDEHKDQEGRP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM A   A ++ITNPTHYA+AL+Y   +  APVL+AKG + +A
Sbjct: 240 EVKQRIRQLQREMSQRRMMAAIPEADVVITNPTHYAVALKYDAEKGGAPVLLAKGSDFLA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+IA  H + + E P+LARS+F    +   IP   Y AVAQ++  +Y  +
Sbjct: 300 LQIREIAVAHEVMLLESPALARSIFYSTELEEEIPAGLYLAVAQVLAYVYQIR 352


>gi|224826341|ref|ZP_03699443.1| flagellar biosynthetic protein FlhB [Lutiella nitroferrum 2002]
 gi|224601442|gb|EEG07623.1| flagellar biosynthetic protein FlhB [Lutiella nitroferrum 2002]
          Length = 388

 Score =  334 bits (858), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 83/354 (23%), Positives = 174/354 (49%), Gaps = 3/354 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   +TEA + ++++ A  EGN P SRE S F+  +  +  L+         +  
Sbjct: 1   MAE-DSDLERTEAATGRRLQQAREEGNIPRSRELSTFAVTMTGVALLMAMGERLGNFMLQ 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L  +     ++    ++             ++P      +  + + L+     L  
Sbjct: 60  LMRRLF-TFDHDMVQHTDPVLLRFKESLTDTLLQLMPLFGGLALVAVAAPLLVGGWNLTF 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P   +++   GI+R++S++ L   +K+ +K +++G + T  +      ++  I+  
Sbjct: 119 KGIEPKLSKLNPAHGIQRMFSLSALTEALKAILKSVVIGGVATWVIWNERAELIGLIAMP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             + L           ++++  +  L V+D+ +    ++ +L+M+K+E+K E K+  G+P
Sbjct: 179 LETALGKMMQLTFHTFLLVVGAMLLLVVVDVPFQIWNYHKQLRMTKEEVKQEYKEQEGSP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   + +MM+    A +I+TNPTHYA+AL+Y +    AP ++AKG+  +A
Sbjct: 239 EVKGRIRQLQRQAAQRRMMQEIPSANVIVTNPTHYAVALKYTEG-MRAPQVIAKGRLKLA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKKI 354
           +K+     EH + +   PS AR+L+    +   +P   Y A AQ++  +Y  K+
Sbjct: 298 EKIIDTGREHRVTVMRVPSFARALYFHSELGEEVPSRLYGAAAQILAYVYQLKL 351


>gi|15964403|ref|NP_384756.1| flagellar biosynthesis protein FlhB [Sinorhizobium meliloti 1021]
 gi|307311545|ref|ZP_07591186.1| flagellar biosynthetic protein FlhB [Sinorhizobium meliloti BL225C]
 gi|307318900|ref|ZP_07598331.1| flagellar biosynthetic protein FlhB [Sinorhizobium meliloti AK83]
 gi|17380369|sp|O54243|FLHB_RHIME RecName: Full=Flagellar biosynthetic protein flhB
 gi|15073580|emb|CAC45222.1| Flagellar biosynthetic transmembrane protein [Sinorhizobium
           meliloti 1021]
 gi|306895314|gb|EFN26069.1| flagellar biosynthetic protein FlhB [Sinorhizobium meliloti AK83]
 gi|306899562|gb|EFN30191.1| flagellar biosynthetic protein FlhB [Sinorhizobium meliloti BL225C]
          Length = 360

 Score =  334 bits (858), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 156/350 (44%), Positives = 243/350 (69%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E    D+KTEAPS KKI DA  +GN P SRE + F+S LA  I+++FF S G  ++  
Sbjct: 1   MAEEQDKDSKTEAPSEKKISDATEKGNVPFSREVTAFASTLAIYIFVVFFLSDGAANMAE 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  +       +L+  +  V L++H+ L  + LV+P  +L ++FG+GS + Q +P   L
Sbjct: 61  ALKDIFEQPEAWRLDTATDAVALISHVVLKCAALVLPVFILLILFGVGSSIFQNLPRPVL 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + ++P + RVS   G KRIY +  LV F KS  KII+V  ++ + L  +YF  LD + ++
Sbjct: 121 DRIQPKWNRVSPAAGFKRIYGVQGLVEFGKSLFKIIVVSIVVVLVLWNDYFATLDMMFSD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P +I       +++++I++L   ATL ++D+ W+ H WY++L+M++QE+KDE+KQS G+P
Sbjct: 181 PVTIFTTMISDLKQIIIVVLFATATLAIVDLFWTRHHWYTELRMTRQEVKDELKQSQGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           I+K+R +S+ R R R +M+ +  RAT+II NPTHYA+ALRY++ E+DAPV+VA G++L+A
Sbjct: 241 IVKSRLRSMQRDRARKRMISSVPRATLIIANPTHYAVALRYVREESDAPVVVAMGKDLVA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
            K+R+IA ++ IP+FE+P LARS+F QV ++S IPPVFYKAVA+LI+++Y
Sbjct: 301 LKIREIAEKNGIPVFEDPPLARSMFAQVSVDSVIPPVFYKAVAELIHRVY 350


>gi|227820846|ref|YP_002824816.1| flagellar biosynthesis protein FlhB [Sinorhizobium fredii NGR234]
 gi|227339845|gb|ACP24063.1| flagellar biosynthetic protein FlhB [Sinorhizobium fredii NGR234]
          Length = 360

 Score =  334 bits (857), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 158/350 (45%), Positives = 242/350 (69%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS++   D+KTEAPS KK+ DA  +GN P SRE + F+S LA  I+++FF S G  S   
Sbjct: 1   MSDDQDKDSKTEAPSEKKLSDAAEKGNVPFSREVTAFASTLAVYIFIVFFLSDGAASTAE 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  +       +LE  +  V L++H+ L ++ LV+P  +L ++FG+GS + Q +P   L
Sbjct: 61  ALKDIFEQPEAWRLETATDAVGLISHVVLKSAGLVLPVFVLLIIFGVGSSIFQNLPRPVL 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + + P+  RVS   G KRI+ +  LV F KS  KII+V  I+ + L  +YF  LD + ++
Sbjct: 121 DRIMPNMNRVSPIAGFKRIFGVPGLVEFAKSLFKIIVVSIIVVLVLWNDYFATLDLMFSD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P +I       +++++ ++LL  A L ++D+ W+ H WYS+LKM+KQE+K+E+KQS G+P
Sbjct: 181 PVTIFATMISDLKQIVTVVLLATAVLAIVDLFWTRHHWYSELKMTKQEVKEELKQSQGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           I+K+R +S+ R R R +M+ +  RAT++I NPTHYA+ALRY++ E+DAPV+VA GQ+L+A
Sbjct: 241 IVKSRLRSMQRDRARKRMIASVPRATLVIANPTHYAVALRYVREESDAPVVVAMGQDLVA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
            K+R+IA ++ IP+FE+P LARS+F QV ++S IPPVFYKAVA+LI+++Y
Sbjct: 301 LKIREIAEKNGIPVFEDPPLARSMFAQVSVDSVIPPVFYKAVAELIHRVY 350


>gi|109899339|ref|YP_662594.1| flagellar biosynthetic protein FlhB [Pseudoalteromonas atlantica
           T6c]
 gi|109701620|gb|ABG41540.1| flagellar biosynthetic protein FlhB [Pseudoalteromonas atlantica
           T6c]
          Length = 374

 Score =  334 bits (857), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 91/349 (26%), Positives = 168/349 (48%), Gaps = 1/349 (0%)

Query: 5   DAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHV 64
              + KTE P+SKKI D+  +G    S+E S    ++      +        ++      
Sbjct: 2   SDANEKTEDPTSKKITDSRKKGQVARSKELSTALVLVFSAAAFIMMGGQIAKAIYLVTQR 61

Query: 65  LLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVK 124
              + ++ +  D +H+         + +  V+  +++    GI   +             
Sbjct: 62  TF-TLSRDETYDFTHMFQAWGSAIETVATPVMLYMVIITAAGIYGNIALGGYNFTWQGAA 120

Query: 125 PSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSI 184
           P   +++   G KR++ +N LV  +K+  K+I+V  +  +++       L          
Sbjct: 121 PKANKLNPLAGFKRMFGMNGLVELLKAIAKVIVVMGMAYVAMLVFKDEALHLDLELYPQN 180

Query: 185 LYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKN 244
           L+HA   +    +M+   +  +   D+ +  ++   ++KMSKQE+KDE K + G+P +KN
Sbjct: 181 LFHAMDLISWAFLMMCCALIPIAAFDVPYQSYKHNKEMKMSKQEVKDENKNAEGDPQVKN 240

Query: 245 RQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMR 304
           R + +      ++MM+    A +++TNPTHY++AL+Y Q    APVLVAKG + +A  +R
Sbjct: 241 RIRRLQFQAAANRMMQEVPTADVVVTNPTHYSIALKYDQQGTRAPVLVAKGVDEMAMHIR 300

Query: 305 KIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           KIA  H +PI   P LAR+++    + S IP   + AVAQ++  ++  K
Sbjct: 301 KIADAHEVPIVASPMLARAIYYSTEVESEIPAKLFMAVAQILAYVFQLK 349


>gi|254517020|ref|ZP_05129078.1| flagellar biosynthetic protein FlhB [gamma proteobacterium NOR5-3]
 gi|219674525|gb|EED30893.1| flagellar biosynthetic protein FlhB [gamma proteobacterium NOR5-3]
          Length = 384

 Score =  334 bits (857), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 88/353 (24%), Positives = 177/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E      +TE P+ ++ E+A  +G  P SRE +   S+L   + L       + ++ +
Sbjct: 1   MAEEQTGQERTEQPTERRKEEARRKGQVPRSRELNTMLSLLITGVGLWVLGGGLVDNLLA 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
                  S  +  + D   +     H+ +SA   + P   + ++  +   LI      +L
Sbjct: 61  ITSAGF-SVDRAAVFDTQQLPVHFMHMVISALLALAPLFAVTVVAALAGPLIMGGWSFSL 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +    +++   +G+ R++S+  L    K+ +K +L+  +  + +      +L   +  
Sbjct: 120 EAMAFKLEKLDPVKGLGRVFSLKGLAELAKALIKFLLLMGVAYLMIMSFERQILTLSALT 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P          +   LI++   +  + + D+ +    +  +L+M++QE++DE+K++ G P
Sbjct: 180 PGEASARVVTMLVTALIILSSAMVLIVMFDVPFELWNFNKQLRMTRQEVRDEMKETDGRP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +++ R   + +MM+    A ++ITNPTHY++AL Y      AP +VAKG++LIA
Sbjct: 240 EVKQRIRNLQREVSQRRMMQDVPTADVVITNPTHYSIALSYSDGS-GAPRVVAKGRDLIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R IA EH +P++E P LAR+L+    +   IP   Y AVA+++  ++  +
Sbjct: 299 LQIRTIAQEHEVPLYEAPPLARALYASTEVGDEIPGDLYLAVARVLAYLFQLR 351


>gi|251797425|ref|YP_003012156.1| flagellar biosynthetic protein FlhB [Paenibacillus sp. JDR-2]
 gi|247545051|gb|ACT02070.1| flagellar biosynthetic protein FlhB [Paenibacillus sp. JDR-2]
          Length = 365

 Score =  334 bits (857), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 90/347 (25%), Positives = 179/347 (51%), Gaps = 1/347 (0%)

Query: 7   PDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLL 66
              KTE  + KK ++A  +G    S +      +L          S     + S    L 
Sbjct: 14  SQEKTEKATPKKTQEARKKGQIAKSNDLPSSMILLFTFATFAALGSYYKTRIMSVFQELF 73

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
            +     +   ++I+ L   L++     + P   + ++  I   ++Q   +L    +KP 
Sbjct: 74  DNWLTMDVTT-ANIMPLFDKLAVDMLMFLAPIFAIVVIVAILGNVVQFGFLLTGESLKPK 132

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
           F +++   G K+I+S+  +V F+KS +K++++G ++  ++  ++  +L   S +   I  
Sbjct: 133 FSKLNPINGFKQIFSMRTVVEFLKSILKLLIIGILVYRAIWSDWDKILVLSSLSVQQIFS 192

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
                  K+ +     +  L   D  +  ++    L+MSKQ+IKDE K+S G+P+IK + 
Sbjct: 193 FTAGLTVKLGLETGAVLVILAFADYMYQRYEHAKSLRMSKQDIKDEYKKSEGDPLIKGKI 252

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           +   R     +MM+   +A ++ITNPTH+A+AL+Y  ++ +AP+++AKG + +A ++R++
Sbjct: 253 RERQRRMAMQRMMQEVPKADVVITNPTHFAIALQYDASKMEAPLIIAKGMDHLALRIREV 312

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A EH + + E   LAR+L+++  I  +IP   ++AVA+++  +Y  K
Sbjct: 313 AKEHGVVMMENKPLARALYERADIGDSIPADLFQAVAEVLAAVYKMK 359


>gi|126175115|ref|YP_001051264.1| flagellar biosynthesis protein FlhB [Shewanella baltica OS155]
 gi|125998320|gb|ABN62395.1| flagellar biosynthetic protein FlhB [Shewanella baltica OS155]
          Length = 376

 Score =  334 bits (857), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 80/340 (23%), Positives = 161/340 (47%), Gaps = 1/340 (0%)

Query: 14  PSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLASATQRK 73
           P+ ++IE A  +G    S+E    + +++              S+T     +  +  + +
Sbjct: 13  PTGRRIEQAREKGQIARSKELGTAAVLISAACGFYMLGPSLATSLTRVFETVF-TMDRAQ 71

Query: 74  LEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKRVSLR 133
           + D   +  +   ++   +  +   +LL ++      +       +   + P   ++S  
Sbjct: 72  IFDTEEMFNVWGVVASEIAWPMAKIMLLIVVVAFIGNVALGGMNFSTQAMMPKASKMSPA 131

Query: 134 EGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAFFTVR 193
            G KR++ +  LV   K   K  +V     + L+  +  ++   S +    +YHA   + 
Sbjct: 132 AGFKRMFGVQALVELTKGIAKFSVVAFSAYLLLSFYFNDIMLLSSDHLPGNVYHALDLLV 191

Query: 194 KVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSR 253
            + I++   I  + V+D+ +       +LKM+KQE+KDE K + G P +K R + +    
Sbjct: 192 WMFILLCSSILLIVVIDVPFQIWNHNKQLKMTKQEVKDEYKDTEGKPEVKGRVRQMQHEL 251

Query: 254 IRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIP 313
            + +MM     A +I+ NP H+A+A++Y    + AP ++AKG + +A K+R+IA EHNI 
Sbjct: 252 AQRRMMAEVPNADVIVVNPEHFAVAIKYDVQRSAAPFVIAKGVDDVAFKIREIAREHNIA 311

Query: 314 IFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           I   P LAR+++    ++  IP   + AVAQ++  ++  +
Sbjct: 312 IVSAPPLARAIYHTTKLDQQIPEGLFTAVAQILAYVFQLR 351


>gi|291288733|ref|YP_003505549.1| flagellar biosynthetic protein FlhB [Denitrovibrio acetiphilus DSM
           12809]
 gi|290885893|gb|ADD69593.1| flagellar biosynthetic protein FlhB [Denitrovibrio acetiphilus DSM
           12809]
          Length = 352

 Score =  334 bits (856), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 102/353 (28%), Positives = 189/353 (53%), Gaps = 5/353 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++      KTE P+ KK+ DA NEGN   SRE     ++L    +  ++    ++ +  
Sbjct: 1   MADE---QEKTEDPTGKKLTDAKNEGNVAKSRELPAAVTLLLVTFFFYYYGPYLMHGLAR 57

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  +            +H + L +   + +++L+ P + L ++ G+ S ++Q   +   
Sbjct: 58  LIREIFMMTNYEINTQSAHKIMLFS--IIESAKLLAPFMALVLVVGVASNVLQTGFMFTP 115

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +    +R+   +G  R +S  +LV  MKS  K+ +V  +  + + ++  T++     +
Sbjct: 116 KALSAKLERIDPIKGFGRFFSKKSLVELMKSLFKVFVVTYVAYLIVKKHIVTIISMADMD 175

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            + I       V +++  + L    + + D  +  +Q+   LKMSK E+K+E KQ+ G+P
Sbjct: 176 FYDIFSVFGKIVYEIMWKVSLLALFMALADFIFQKYQFKQDLKMSKHEVKEERKQAEGDP 235

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +SI R   R +MM+   ++ +++TNPTH+A+AL+Y   E+ APV++AKGQ L+A
Sbjct: 236 HVKGRIRSIQREMARKRMMDDVPKSDVVVTNPTHFAVALKYSPGEDRAPVVMAKGQRLMA 295

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++++IA +  I + E+P +ARSLFK V I   IP   YKAVA+++  +   K
Sbjct: 296 LRIKEIAKQSGILVHEDPPIARSLFKTVDIGDEIPENLYKAVAEILALVDKFK 348


>gi|317129190|ref|YP_004095472.1| flagellar biosynthetic protein FlhB [Bacillus cellulosilyticus DSM
           2522]
 gi|315474138|gb|ADU30741.1| flagellar biosynthetic protein FlhB [Bacillus cellulosilyticus DSM
           2522]
          Length = 359

 Score =  334 bits (856), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 91/345 (26%), Positives = 167/345 (48%), Gaps = 1/345 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE  + KK +++  +G    S + +    +L   +      S  +  +         
Sbjct: 12  QEKTEKATPKKRKESRQKGQVSKSSDVNTSFILLFVFLAFWLMGSFSVDQLIGITRYSFQ 71

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
                +L + +++  +  + S+ A+ +V P + + M+  I S  +Q   +     +K   
Sbjct: 72  EYLLMELTE-ANVYSMFINFSIQAAIVVGPFMFIAMLAAIFSNYLQVGILFAPEAIKMKL 130

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
            ++   +G KRI+S+  LV F+KS +KI+ VG      +      +L     +    +  
Sbjct: 131 SKLDPIQGAKRIFSVRALVEFLKSLLKIVCVGFAGFTVIWIAIDDILMLSLYSVGESVRL 190

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
               +  + + +   +  L+V D  +  +     +KMSKQ++KDE K++ G+P+IK++ K
Sbjct: 191 IGNLLIMMGLAVAFLLIFLSVFDYLYQKYDHEKNIKMSKQDVKDEYKKTEGDPLIKSKIK 250

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              R     +MM    +A ++ITNPTHYA+AL+Y      AP++VAKG + IA K+  IA
Sbjct: 251 EKQRQMAMSRMMAEVPKADVVITNPTHYAIALKYDDQNMAAPIIVAKGVDFIALKVINIA 310

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
             +N+   E   LAR+L+ Q  I   +P   +KAVA+++  +Y  
Sbjct: 311 KNNNVMTVENRPLARALYAQADIGDPVPEDLFKAVAEVLAYVYRI 355


>gi|163758003|ref|ZP_02165091.1| flagellar biosynthesis protein B [Hoeflea phototrophica DFL-43]
 gi|162284292|gb|EDQ34575.1| flagellar biosynthesis protein B [Hoeflea phototrophica DFL-43]
          Length = 363

 Score =  334 bits (856), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 151/350 (43%), Positives = 232/350 (66%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E +  D+KTE P+ KK+ DA+++GN P SRE  +F+SIL  L++L+FF        T+
Sbjct: 1   MAEGEDKDSKTEEPTEKKLRDAIDKGNIPFSREVPIFASILGTLLFLVFFLPSAASRFTN 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  L   +   +LE     V L   L + A  +++P   L M FGI + ++Q +P   L
Sbjct: 61  SLRDLFEQSDDWRLETGGDAVALFQSLFIEAGVVMVPAFALLMGFGIAASVLQNMPSPVL 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + ++P  +R+S+ +G  RIY I  +V F KS  KII V   ++I++ + +F  LDF+  +
Sbjct: 121 DRIQPKLERISIVKGFGRIYGIKGMVEFAKSMFKIIAVSLFVSIAMKDEFFRSLDFMFMD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P  ++        KV+ ++L+  A L VLD+ W+ + W++  KMSKQ+IKDE+KQS G+P
Sbjct: 181 PTLVVPDMARIAAKVVAVVLISTALLAVLDVLWTRYSWHNDQKMSKQDIKDELKQSDGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           I+K RQ+S+AR R R +M+    RAT++I NPTH+A+ALRY++ E  APV++AKGQ+LIA
Sbjct: 241 IVKARQRSLARDRARRRMIAEVPRATMVIANPTHFAVALRYVREEGGAPVVIAKGQDLIA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
            K+R++A  H IP+FE+P LARS+F QV +++ IP VFYKAVA+L+++IY
Sbjct: 301 LKIREVAEAHGIPVFEDPPLARSMFAQVSVDNFIPAVFYKAVAELVHRIY 350


>gi|2916784|emb|CAA11951.1| flhB protein [Sinorhizobium meliloti]
          Length = 360

 Score =  333 bits (855), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 156/350 (44%), Positives = 243/350 (69%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E    D+KTEAPS KKI DA  +GN P SRE + F+S LA  I+++FF S G  ++  
Sbjct: 1   MAEEQDKDSKTEAPSEKKISDATEKGNVPFSREVTAFASTLAIYIFVVFFLSDGAANMAE 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  +       +L+  +  V L++H+ L  + LV+P  +L ++FG+GS + Q +P   L
Sbjct: 61  ALKDIFEQPEAWRLDTATDAVALISHVVLKCAALVLPVSILLILFGVGSSIFQNLPRPVL 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + ++P + RVS   G KRIY +  LV F KS  KII+V  ++ + L  +YF  LD + ++
Sbjct: 121 DRIQPKWNRVSPAAGFKRIYGVQGLVEFGKSLFKIIVVSIVVVLVLWNDYFATLDMMFSD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P +I       +++++I++L   ATL ++D+ W+ H WY++L+M++QE+KDE+KQS G+P
Sbjct: 181 PVTIFTTMISDLQQIIIVVLFATATLAIVDLFWTRHHWYTELRMTRQEVKDELKQSQGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           I+K+R +S+ R R R +M+ +  RAT+II NPTHYA+ALRY++ E+DAPV+VA G++L+A
Sbjct: 241 IVKSRLRSMQRDRARKRMISSVPRATLIIANPTHYAVALRYVREESDAPVVVAMGKDLVA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
            K+R+IA ++ IP+FE+P LARS+F QV ++S IPPVFYKAVA+LI+++Y
Sbjct: 301 LKIREIAEKNGIPVFEDPPLARSMFAQVSVDSVIPPVFYKAVAELIHRVY 350


>gi|285018167|ref|YP_003375878.1| flagellar biosynthesis pathway component flhb protein [Xanthomonas
           albilineans GPE PC73]
 gi|283473385|emb|CBA15890.1| probable flagellar biosynthesis pathway component flhb protein
           [Xanthomonas albilineans]
          Length = 376

 Score =  333 bits (855), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 84/353 (23%), Positives = 171/353 (48%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSEN+    +TE P+ K++ +   +GN P SRE +  +   + +  L+           +
Sbjct: 1   MSENEEGAERTEQPTEKRLRETREQGNIPRSRELATAAVFSSSIFALMGMSGSLTAGAVA 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L        +    +      L +    +V+P + + +  G  + L+      + 
Sbjct: 61  WMKHAL-QPDPHLRDTPQALFGYFGDLLIGLFWVVLPLIGICVAAGFIAPLLMGSLRFSG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   R++   G+ R+Y   +LV  +KS +++  VG    + + +    +   +   
Sbjct: 120 QALIPKLDRLNPMAGLARLYGTESLVELLKSMLRMGFVGGAAFLCIWKGLDGLRGLLQQP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H       +L+     +A L  +D  +    + +KLKM+++E++ E+K++ G+P
Sbjct: 180 LEQAIGHGLGFTLSMLLYTAGALALLAAIDAPYQKWHYINKLKMTREEVRREMKENDGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + +     + +MMEA  +A +++ NPTHYA+AL+Y      AP ++AKG + IA
Sbjct: 240 EVKGRIRQMQMQMSQRRMMEAVPKADVVVVNPTHYAVALKYESGRMRAPTVLAKGVDEIA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++  +H + +   P LAR+L+++  +   IP   Y AVAQ++  +Y  +
Sbjct: 300 FRIREVGEQHRVAVVSAPPLARALYREGQLGKEIPVRLYSAVAQILSYVYQLR 352


>gi|154253017|ref|YP_001413841.1| flagellar biosynthetic protein FlhB [Parvibaculum lavamentivorans
           DS-1]
 gi|154156967|gb|ABS64184.1| flagellar biosynthetic protein FlhB [Parvibaculum lavamentivorans
           DS-1]
          Length = 359

 Score =  333 bits (855), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 111/353 (31%), Positives = 186/353 (52%), Gaps = 3/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++ D    KTE P+ +K+E+A  +G+   S+E S +  ++     +         S+  
Sbjct: 1   MADQDDS-EKTEEPTHRKLEEAHKKGDLVKSQEVSTWFVMIGGATAIALMAPSTASSLMG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L V LA      + D  H+  +  ++  SA   +I  L + +   +  +LIQ  PV   
Sbjct: 60  SLTVFLAQPETIPM-DAEHLRRIWLNVGSSAFMSMIGPLAVLVGAALVGHLIQHAPVFTA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
            ++KP   ++S +EG++R++   +L+N  K  +K+ +VG++  + +      +   ++  
Sbjct: 119 ENMKPKLSKISPKEGLQRLFGPKSLMNLAKGILKLTIVGSVSVLIIWPERDRLALMMTWE 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
              +L        K+   ++  +  +  LD  +   QW  K +MS QE+KDE KQ  G+P
Sbjct: 179 IAQLLPLVQMLALKMFAGVIAVMTVVAALDYLFERMQWMKKQRMSIQEVKDEYKQMEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + I   R R +MM A   AT+IITNPTHYA+AL+Y Q    APV+VAKG + +A
Sbjct: 239 TVKAKLRQIRAERGRKRMMAAVPTATVIITNPTHYAVALKYEQG-MGAPVVVAKGVDAVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++  EH +PI E P LAR+L   V I+  I P  YKAVA++I  +   K
Sbjct: 298 FRIREVGQEHEVPIIENPPLARALHATVDIDQEIQPEHYKAVAEVIGYVMRLK 350


>gi|116250471|ref|YP_766309.1| flagellar biosynthesis protein FlhB [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115255119|emb|CAK06193.1| putative flagellar biosynthetic protein [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 365

 Score =  333 bits (855), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 151/347 (43%), Positives = 235/347 (67%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP++KK  DA  +GN P SRE S+F++ILA  IYL+FF    +  +T  L 
Sbjct: 9   DDDKDSKTEAPTAKKQSDAAEKGNVPSSRELSIFATILATFIYLVFFLPESVGRMTEMLR 68

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
            +     Q K+E    ++ L   +  +++ LV P  +LFM+FG+ S + Q +P   L  +
Sbjct: 69  DIFEQPDQWKIETGPDVLALFVRIGWASAALVAPAFILFMVFGVASSVFQNLPTPVLERI 128

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P   R+S  +G  R++S+  LV F KS  K+++VG I+   L   YF  +D + ++P +
Sbjct: 129 RPQASRISPIKGWSRLFSVPGLVEFGKSLFKVVVVGVILFFVLRSEYFGSIDAMFSDPQT 188

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
           IL      +RK++I++L+  A + + D+ W+ H W+++LKM++ E+K+E KQ+ G+P +K
Sbjct: 189 ILVRMMAAMRKIIIVMLIATAIVAIADLFWTRHHWFTELKMTRHEVKEENKQAQGDPFVK 248

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
           +RQ+S+ R R R +M+    RAT++I NPTHYA+ALRY + ENDAPV++AKGQ+LIA K+
Sbjct: 249 SRQRSLMRDRARRRMIANVDRATLVIANPTHYAVALRYAREENDAPVVLAKGQDLIALKI 308

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           R+IA ++ IP+FE+P LARS+F QV I+S IP VFYKAVA+LI+++Y
Sbjct: 309 REIAEKNGIPVFEDPPLARSMFAQVSIDSVIPSVFYKAVAELIHRVY 355


>gi|218133682|ref|ZP_03462486.1| hypothetical protein BACPEC_01551 [Bacteroides pectinophilus ATCC
           43243]
 gi|217991057|gb|EEC57063.1| hypothetical protein BACPEC_01551 [Bacteroides pectinophilus ATCC
           43243]
          Length = 386

 Score =  333 bits (854), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 90/357 (25%), Positives = 176/357 (49%), Gaps = 5/357 (1%)

Query: 2   SENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSD 61
           +++     KTE P++KK+ DA  EG    S+E      +LA  + + F+       +   
Sbjct: 20  AKDGPGGEKTEVPTAKKLNDARKEGQVAKSKEIITALMLLALFVVIKFYIGNLGQQMIEC 79

Query: 62  LHVLLASATQRKLED-----ISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIP 116
                    +          +     +++    +   +++P + L ++  I    +Q+  
Sbjct: 80  FSEFYDLFGKIISNSEYGMRMVDATGVVSLGLTTVLNMIVPFIALAVVIAILGNALQQKW 139

Query: 117 VLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDF 176
           ++    ++P   ++S   G+KR++++  L    KS   I ++  +I  ++ +    +  F
Sbjct: 140 MVTTKPLQPKLSKISPISGLKRMFNVKQLFEVGKSVAMIAVMSYVIYTTVKDKLGVLYTF 199

Query: 177 ISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQS 236
            + + +  L      +  + I I      +  +D+ +  H++   +KM+KQE+KDE K +
Sbjct: 200 YNISLYEALEIVGDIIVDLGIKISAVFLVIGFVDLIYQRHKFKEDMKMTKQEVKDEFKNT 259

Query: 237 YGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQ 296
            G+P +K + +   +   R +MMEA  +A ++ITNPTH+A+AL+Y   +  APV++AKG 
Sbjct: 260 EGDPQVKGQIRRRMQQVSRRRMMEALPQADVVITNPTHFAVALKYEANKGQAPVVIAKGA 319

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           + +A  ++  A E+ I I E   LAR L+  V I + IPP  Y+AVA+++  +Y  K
Sbjct: 320 DYLAFDIKAKAKEYGIEIVENKPLARILYNNVEIGAQIPPELYQAVAEVLAFVYSLK 376


>gi|149908444|ref|ZP_01897107.1| flagellar biosynthesis protein [Moritella sp. PE36]
 gi|149808607|gb|EDM68542.1| flagellar biosynthesis protein [Moritella sp. PE36]
          Length = 376

 Score =  333 bits (854), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 88/353 (24%), Positives = 176/353 (49%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D    +TE  + KK+  A  +G    S+E +    + A     L F      ++  
Sbjct: 1   MAEKD-GQEQTEDATEKKLTQAREKGQVVRSKELATTFVLTATGAAFLAFGDALARALVI 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           ++  L     +  +     ++ +++         +   +++    GI   ++    V + 
Sbjct: 60  NMTSLF-QLEREDIFSPDALLEIVSVSIKPLFWPMFGIMIVGFFAGIIGNILMGGMVFSG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P   ++S + G+KR+     +V  +KS  K+ +V TI  + L   +  +++F    
Sbjct: 119 ESIRPKASKMSPKAGLKRMMGPQAMVELIKSIAKVAVVVTIALLVLKVQFLQIMEFSLQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            +  +  +   +  V I +   +  +  +D+ + Y +   +L+M+KQE+KDE+K   GNP
Sbjct: 179 LNISIIQSLNFLTDVFIWLCASLIIIVAIDVPYQYWKHAKELRMTKQEVKDEMKDVNGNP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + +     + +MM     A +IITNPTHY++AL+Y ++ N AP +VAKG + +A
Sbjct: 239 QLKGKIRQMQMEISQRRMMGDVPDADVIITNPTHYSVALKYEKSGNAAPKVVAKGVDQVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EH +PI E  +L R+++    I+  IP   + AVAQ++  +Y  +
Sbjct: 299 FRIREMAKEHKVPILESAALTRAIYHSTEIDDPIPEGLFIAVAQILAYVYQLE 351


>gi|222053619|ref|YP_002535981.1| flagellar biosynthetic protein FlhB [Geobacter sp. FRC-32]
 gi|221562908|gb|ACM18880.1| flagellar biosynthetic protein FlhB [Geobacter sp. FRC-32]
          Length = 354

 Score =  333 bits (854), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 106/353 (30%), Positives = 191/353 (54%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE D   +KTE P++KK+ +A  +GN P SR+ +   S+ + +I L          + S
Sbjct: 1   MSEED-KHSKTEQPTNKKVSEAKEKGNIPRSRDLTSTLSLTSGIIALYVTGGFMASKLKS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
               + AS + ++  +   I  L+  L L+ + ++ P LL+ ++  + + + Q     + 
Sbjct: 60  SSAEIFASLSTKEFTEAG-IYMLMLKLFLTMTLVLAPFLLIVIVASLAAEVSQGGISTSF 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +     +++   GIKR+++ + +V  +KSF+KII+VG +    + +   +++  +  +
Sbjct: 119 EKIGFDLDKLNPVHGIKRLFNKDAVVEMLKSFLKIIIVGYMAYKVMRDEVDSVIYLVDMD 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             +I         K++I     +  L VLD+ +   ++   LKM+KQE+KDE K + G+P
Sbjct: 179 IPAIAEFVSHISFKLVIHTCGVLFILAVLDLAFVKWRFIENLKMTKQEVKDENKDAEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK + K     + R +M      A +++TNPTH+A+AL+Y + +  APV++AKG + +A
Sbjct: 239 HIKGKIKQKQYDQARRRMRLIIPTADVVVTNPTHFAVALKYDRQKMAAPVVLAKGADFLA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +K+++IA E NI + E   LAR LF QV     IP   Y AVA+++  +Y  K
Sbjct: 299 QKIKEIARESNITLVENRPLARELFAQVKEGEEIPEALYAAVAEILAYVYKLK 351


>gi|291562038|emb|CBL40854.1| flagellar biosynthetic protein FlhB [butyrate-producing bacterium
           SS3/4]
          Length = 357

 Score =  333 bits (854), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 99/347 (28%), Positives = 184/347 (53%), Gaps = 2/347 (0%)

Query: 5   DAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHV 64
            +   KTE P++KK  DA  EGN   SR+ +    +      +  +       + + +  
Sbjct: 3   QSGQEKTEQPTAKKRRDARKEGNIFQSRDVATVVILAGIFFGIRIWLPFIYGQMKNYMTW 62

Query: 65  LLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVK 124
           ++  A +   + +S  +  +T       +  +P LLL ++ GI ++ +Q    ++   ++
Sbjct: 63  VIDGAARSSEDMLSASLVFVTLSVF--LKCALPLLLLALLLGIVAHGVQTRFNVSFKSIR 120

Query: 125 PSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSI 184
           P + R++   GIKR++S+ N V  +K+ +KI L+  ++   L ++   M   I  NP + 
Sbjct: 121 PKWNRLNPLSGIKRLFSMKNAVELVKNSIKITLLLVLLYNILKQDLQPMASMIDMNPAAS 180

Query: 185 LYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKN 244
             +    +  +LI + +    +   D  +   ++  +L+M+KQE+KDE KQ+ GNP IKN
Sbjct: 181 AAYMMKMIFDLLIRVCIAFMVIAFGDYLYQRWEYEKELRMTKQEVKDEYKQTEGNPEIKN 240

Query: 245 RQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMR 304
           R KS+ R     +MM+   +A +II NPTH A+AL+Y    ++APV++AKG + +A ++ 
Sbjct: 241 RIKSLQRQMASSRMMQKVPQADVIIRNPTHVAIALKYDPDHDNAPVVLAKGLDELALRIV 300

Query: 305 KIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
           K+  E+N+   E   LAR+++    ++  IP  FY AVA+++  +Y 
Sbjct: 301 KVGEENNVYTIENKPLARAMYNSCELDRPIPSEFYTAVAEILVYLYK 347


>gi|301165899|emb|CBW25472.1| flagellar biosynthetic protein [Bacteriovorax marinus SJ]
          Length = 361

 Score =  332 bits (853), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 98/354 (27%), Positives = 174/354 (49%), Gaps = 2/354 (0%)

Query: 1   MS-ENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVT 59
           M+ END+   KTE PS+ +IE+    G    S+E +    +   L+ L        Y V 
Sbjct: 2   MADENDSDAEKTEDPSAHRIEEFRKRGEVASSKELTSVLVLAGSLMTLGLSMVYM-YEVL 60

Query: 60  SDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLN 119
           S+    L             +  ++  L   + + V P  L+ +  G+ + + Q   + +
Sbjct: 61  SEFIEWLYHLDVSTAYTAKSMNTIVNKLVTVSLKSVAPIFLVTLSIGVAANMAQIGVLFS 120

Query: 120 LNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISA 179
            + ++    R++  +GIKR++S+ +LV  +K   K I +  I+   L +   T   F   
Sbjct: 121 PDVLEWKPDRINPLQGIKRLFSMKSLVEAIKGVFKFIFILGIVYFFLKDEMHTFGGFFHL 180

Query: 180 NPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
           +      +    + ++   I++ +  + + D  +    +  KL M+K+E K E KQ  GN
Sbjct: 181 DFFQSFLYGKGFLIRLGFAIVVGLIVIAIGDFAYQKFSYKKKLMMTKEEAKQEHKQQDGN 240

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLI 299
           P IK R +++ R   + ++M    +A +I+TNPTH ++AL+Y      +P ++AKG +++
Sbjct: 241 PEIKQRIRAVQREMSQRRVMSEVPKADVIVTNPTHISIALKYDPETMISPEVIAKGADVL 300

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A K+R+IA  H+IPI E   LAR L+K V     +P   YKAVA+++   Y  K
Sbjct: 301 ALKIREIAKGHDIPIVENVPLARGLYKTVKEGQGVPRNLYKAVAEVLAFTYKLK 354


>gi|300694355|ref|YP_003750328.1| flagellar export pore protein [Ralstonia solanacearum PSI07]
 gi|299076392|emb|CBJ35708.1| flagellar export pore protein [Ralstonia solanacearum PSI07]
          Length = 389

 Score =  332 bits (853), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 95/353 (26%), Positives = 173/353 (49%), Gaps = 3/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE D+   KTE+ S +++E A  EG+ P SRE   F  +      L       + + +S
Sbjct: 1   MSE-DSDLEKTESASPRRLEQAREEGDVPQSRELVSFVLLAVAAGGLWVMGESIVRTASS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L     R     +   +           +V+ GL+L ++    S L      ++ 
Sbjct: 60  FLARCLE--FHRYDYTRAQAQWQYVGAQFGPLAMVLAGLMLMLVLASLSPLALTRGAISF 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   R+    G+KR++S+  L+   +   K+ LVG +    +       ++    +
Sbjct: 118 KPLTPDISRLIGLHGLKRMFSVQGLLELPRLLAKLALVGGVGWWLILHYRDAFVELPRGD 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             + +           + +   +  +  +D+  +  Q+  K +M+K+E++ E ++S G+P
Sbjct: 178 LVAGMRDTMHVAGVAFLCMAGVMLLVAAVDVPLALWQYARKHRMTKEEVRKEHRESEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +++ R   + +MM    +A +I+TNPTHYA+ALRY + E  AP ++AKG +L+A
Sbjct: 238 QLKGRIRAMQRQAAQRRMMADVPKADVIVTNPTHYAVALRYSEQEGGAPRVLAKGADLVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++  EH IP+ E P LAR+L++   I   IP   Y AVA+++  +Y  +
Sbjct: 298 AKIRELGAEHRIPVLEAPPLARALYRHTEIGHQIPAALYAAVAEVLAYVYQLR 350


>gi|257095372|ref|YP_003169013.1| flagellar biosynthesis protein FlhB [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257047896|gb|ACV37084.1| flagellar biosynthetic protein FlhB [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 379

 Score =  332 bits (852), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 99/352 (28%), Positives = 168/352 (47%), Gaps = 3/352 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  +   +TE  S++++E A  EG  P SRE   F  ++       F     +  + +
Sbjct: 1   MAEE-SDLERTEPASARRLERAREEGQVPRSREVGAFLILIVAAAAFWFIGPWMVQRMAA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
                LA        +   ++  L  LS  A   V P  +  ++  + S         + 
Sbjct: 60  VFRRGLA-FDHGLTREPQLVLVRLADLSADALLSVAPLFVALLVAALLSPFFVGSWNFSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P   R+   +G+ R+ S + L   +K+  K +LVG +    L      +L   + +
Sbjct: 119 KALQPDLSRLDPLKGLSRLVSWSGLAELVKAVAKALLVGGVAVGVLWSERGDLLAMFAQS 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               L  A   +    + I+  +  +  +D+ +   Q++ KLKMS+QE+K E K+  GNP
Sbjct: 179 GQLGLVSAGHLLSFSFLAIVSAMLLIVAIDVPFQLWQYHDKLKMSRQEVKQESKELEGNP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R + + R   R +MM A   A +I+TNPTHYA+AL Y      AP ++AKG   +A
Sbjct: 239 EIKGRIRQLQREAARKRMMAAVPAADVIVTNPTHYAVALAYSSG-MRAPKVLAKGMGEVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
            K+R++  E+ IP+ E   LAR+L + V ++  IP   Y AVA+++  +Y  
Sbjct: 298 LKIRQVGAENGIPMIEAAPLARALHRHVELDREIPAGLYAAVAEVLAYVYQL 349


>gi|153001439|ref|YP_001367120.1| flagellar biosynthesis protein FlhB [Shewanella baltica OS185]
 gi|304409946|ref|ZP_07391565.1| flagellar biosynthetic protein FlhB [Shewanella baltica OS183]
 gi|307302341|ref|ZP_07582099.1| flagellar biosynthetic protein FlhB [Shewanella baltica BA175]
 gi|151366057|gb|ABS09057.1| flagellar biosynthetic protein FlhB [Shewanella baltica OS185]
 gi|304351355|gb|EFM15754.1| flagellar biosynthetic protein FlhB [Shewanella baltica OS183]
 gi|306914379|gb|EFN44800.1| flagellar biosynthetic protein FlhB [Shewanella baltica BA175]
          Length = 376

 Score =  332 bits (852), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 77/340 (22%), Positives = 161/340 (47%), Gaps = 1/340 (0%)

Query: 14  PSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLASATQRK 73
           P+ +++E A  +G    S+E    + +++              S+T     +  +  + +
Sbjct: 13  PTGRRLEQAREKGQIARSKELGTAAVLISAACGFYMLGPSLATSLTRVFETVF-TMDRAQ 71

Query: 74  LEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKRVSLR 133
           + D   +  +   ++   +  +   +LL ++      +       +   + P   ++S  
Sbjct: 72  IFDTEEMFNVWGVVASEIAWPMAKIMLLIVVVAFIGNVALGGMNFSTQAMMPKASKMSPA 131

Query: 134 EGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAFFTVR 193
            G KR++ +  LV   K   K  +V     + L+  +  ++   S +    +YHA   + 
Sbjct: 132 AGFKRMFGVQALVELTKGIAKFSVVAFSAYLLLSFYFNDIMLLSSDHLPGNVYHALDLLV 191

Query: 194 KVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSR 253
            + I++   I  + V+D+ +       +LKM+KQE+KDE K + G P +K+R + +    
Sbjct: 192 WMFILLCSSILLIVVIDVPFQIWNHNKQLKMTKQEVKDEYKDTEGKPEVKSRVRQMQHEL 251

Query: 254 IRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIP 313
            + +MM     A +I+ NP H+A+A++Y    + AP ++AKG + +A K+R+IA  H+I 
Sbjct: 252 AQRRMMAEVPNADVIVVNPEHFAVAIKYDVQRSAAPFVIAKGVDDVAFKIREIARAHDIA 311

Query: 314 IFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           I   P LAR+++    ++  IP   + AVAQ++  ++  +
Sbjct: 312 IVSAPPLARAIYHTTKLDQQIPEGLFTAVAQILAYVFQLR 351


>gi|329897646|ref|ZP_08272170.1| Flagellar biosynthesis protein FlhB [gamma proteobacterium
           IMCC3088]
 gi|328921095|gb|EGG28504.1| Flagellar biosynthesis protein FlhB [gamma proteobacterium
           IMCC3088]
          Length = 383

 Score =  332 bits (852), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 95/352 (26%), Positives = 176/352 (50%), Gaps = 1/352 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+END+   KTE P++K+I+ + ++G    S+E S+ ++++    ++  F    I  ++ 
Sbjct: 1   MAENDSTQEKTEEPTNKRIQKSRDDGQVARSQELSIAATVITVAGFMYLFGGAMIIKISE 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
                      + + D+S +   +    + A  +V P      +       +      + 
Sbjct: 61  QFAAAFV-FDPKHVFDVSGLTSRVGKGLMDALLVVAPLGAAAFVVSFLVSGVLGGYNFSW 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   +++   G+KR++ +  + +F K+  K +LVG +  + +      ++     N
Sbjct: 120 KAIAPKASKLNPLSGLKRMFGMKVVFDFFKTIGKFLLVGGLTYLLVDNYVGQLMFTSLMN 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               L      +    ++  L +  + ++D  +   ++  KLKM+KQE+K+E K + G P
Sbjct: 180 FEGGLALGGSIIVFSFLVATLALIIIAMIDAPYQLQEYNKKLKMTKQEVKEEAKDTDGRP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R     +M+EA + A ++ITNP H+A+AL Y  T +  P LVAKG + IA
Sbjct: 240 EVKQRIRQKQRELASMRMLEAIADADVVITNPEHFAVALAYDPTGDLPPKLVAKGSDFIA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
           +K+R+ A E  +P+F  P LARSLF    +N  IP   Y+AVAQ+I  I++ 
Sbjct: 300 EKIRERAKEEGVPLFTSPILARSLFFTTDLNGYIPEPLYEAVAQVIAFIFNI 351


>gi|118589950|ref|ZP_01547354.1| flagellar biosynthesis protein B [Stappia aggregata IAM 12614]
 gi|118437447|gb|EAV44084.1| flagellar biosynthesis protein B [Stappia aggregata IAM 12614]
          Length = 357

 Score =  332 bits (852), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 132/351 (37%), Positives = 202/351 (57%), Gaps = 1/351 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE D  D+KTE P+ KKI DA+ +GN P+SREA + ++ +A L+   F  +     +  
Sbjct: 1   MSEED-KDSKTEEPTEKKISDAIEKGNTPVSREAPVLATFIATLLIGSFVITSASRQLIQ 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  LL  +    L + +  + L   +S+     + P + L    G+ S  +Q  P +  
Sbjct: 60  MLTHLLDLSGGVDLGNSADALLLTHAVSIEVLVFLAPIVALLAASGLASAFLQNTPSIVF 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + +KP   ++SL +G  RI+    LV F+K+  K   V  I+      N   +++ +  +
Sbjct: 120 HRIKPDASKLSLAKGWSRIFGAQGLVEFLKAVFKFSTVSAIVYGQFRANEAELINAMFTD 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P ++         K++  + +    L  +DI WS   W   L+MSKQEIKDE KQ  G+P
Sbjct: 180 PSALPEAILQISMKLIAGVCIVTILLVTVDILWSRSHWRKNLRMSKQEIKDEHKQMEGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           I+K RQ+S+AR R R++MM A  +AT+I+ NPTH+A+ALRY   +N APV+VAKGQ+LIA
Sbjct: 240 IVKARQRSLARDRARNRMMSAVPQATLIVANPTHFAVALRYDGDQNPAPVVVAKGQDLIA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            K+R+IA  +NIP+ E+  LARSL+    +   IPP FY+AVA++I  +Y 
Sbjct: 300 LKIREIAEANNIPVIEDRQLARSLYAATEVERMIPPEFYRAVAEIICYVYS 350


>gi|209547917|ref|YP_002279834.1| flagellar biosynthesis protein FlhB [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533673|gb|ACI53608.1| flagellar biosynthetic protein FlhB [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 359

 Score =  332 bits (852), Expect = 5e-89,   Method: Composition-based stats.
 Identities = 150/350 (42%), Positives = 237/350 (67%), Gaps = 1/350 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++ D  D+KTEAP++KK  DA  +GN P SRE S+F++ILA  IYL+FF    +  +  
Sbjct: 1   MAD-DDKDSKTEAPTAKKQTDAAEKGNVPFSRELSIFATILATYIYLVFFLPDSVGHMAE 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  +     Q K+E    ++ L   L  + + L+ P  +LFM+FGI S + Q +P   L
Sbjct: 60  TLRDIFDQPDQWKIETGPDVLSLFVKLGWAIAALLAPAFILFMVFGIASSIFQNLPTPVL 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P   R+S  +G +R++S+  L+ F KS  K+++VG I+   L   YF+ +D + ++
Sbjct: 120 ERIRPQASRISPVKGWERLFSLPGLIEFGKSLFKVVVVGVILFFVLRSEYFSSIDAMFSD 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P +IL      +RK++I++L+  A + ++D+ W+ H W+++LKM++ EIK+E KQ+ G+P
Sbjct: 180 PQTILVRISTAMRKIIIVVLIATAIVAIVDVFWTRHHWFTELKMTRHEIKEENKQAQGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K RQ+S+ R R R +M+    RAT++I NPTHYA+ALRY + ENDAPV++AKGQ+LIA
Sbjct: 240 FVKGRQRSLMRDRARRRMISNVHRATLVIANPTHYAVALRYAREENDAPVVLAKGQDLIA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
            K+R+IA ++ IP+FE+P LARS+F QV +++ IP VFYKAVA+LI+++Y
Sbjct: 300 LKIREIAEKNGIPVFEDPPLARSMFAQVSVDTVIPSVFYKAVAELIHRVY 349


>gi|134300232|ref|YP_001113728.1| flagellar biosynthetic protein FlhB [Desulfotomaculum reducens
           MI-1]
 gi|134052932|gb|ABO50903.1| flagellar biosynthetic protein FlhB [Desulfotomaculum reducens
           MI-1]
          Length = 354

 Score =  332 bits (851), Expect = 6e-89,   Method: Composition-based stats.
 Identities = 91/349 (26%), Positives = 186/349 (53%), Gaps = 2/349 (0%)

Query: 5   DAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHV 64
           +    KTE  + +++++A  +G  P S + +    +L   ++ L +    I  + +    
Sbjct: 3   EGSQEKTEQATPRRLQEARRKGQVPKSADLNGAILLLITGLFALLYKDNLITHMQTYFFT 62

Query: 65  LLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVK 124
              +  +++ +D S++V +L    ++   +  P  +L M+  +G  L Q   +     +K
Sbjct: 63  YFNNFVKQQQQD-SYLVQILIDFMINVFVVFTPLFILLMVVALGVNLAQVGFLFAPEAIK 121

Query: 125 PSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSI 184
           P   +++   G+K ++S   +   +KS +KI +VG ++  ++      +L    + P ++
Sbjct: 122 PKLDKLNPINGLKNMFSGRAMFELVKSLLKITIVGWVVYAAVRGEMANLLAIFHSPPRTL 181

Query: 185 LYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKN 244
           L        KV++   +    + +LD+ +  + +  +++MSKQE+K+E KQ+ G+P IK 
Sbjct: 182 LNQVLTIALKVILWGAVVYLGIALLDLLYQRYAFQKQMRMSKQEVKEEYKQTEGDPQIKG 241

Query: 245 RQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMR 304
             +   R  + +   +   +AT+++TNPTHYA+AL+Y     DAPV+VAKG + +A+++R
Sbjct: 242 WLRRRQRQLLANLARKEVPQATVVVTNPTHYAVALKYE-QPMDAPVVVAKGTDHMARQIR 300

Query: 305 KIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +IA ++ +P+ E   +AR L+  V I  AIP   ++AVA+++  +Y  K
Sbjct: 301 EIARKNEVPVIENVEVARFLYANVEIGHAIPMEMFQAVAEILAMVYRMK 349


>gi|34496481|ref|NP_900696.1| flagellar biosynthetic protein flhB [Chromobacterium violaceum ATCC
           12472]
 gi|34102335|gb|AAQ58701.1| flagellar biosynthetic protein flhB [Chromobacterium violaceum ATCC
           12472]
          Length = 388

 Score =  332 bits (851), Expect = 6e-89,   Method: Composition-based stats.
 Identities = 86/353 (24%), Positives = 175/353 (49%), Gaps = 3/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   +TE  S+K++  A  +GN P S+E S F+  +  +  L+       +++  
Sbjct: 1   MAE-DSDLERTEPASAKRLSMAREDGNIPRSKELSTFAVTMTGVALLMAMGGQLGHALGE 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L  +  Q  +++    +         A   + P      +  + + ++     +  
Sbjct: 60  IMRHLF-TFDQATVQNTEPALIRFKESLFQALGALAPFFGGLALAALLAPMLVGGWNMTF 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P+F +++   GIKR++S+N     +K+ +K +L+G I T  +      ++  ++  
Sbjct: 119 KALEPNFGKLNPLPGIKRLFSLNAATEGLKAILKSLLIGGIATWYIWRERGEIIGLLAMP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             + +      + +   ++   +  L  LD+ +    +Y KL+M+K+E+K E K++ G+P
Sbjct: 179 LEAGILKMTDLMIRTFFIVTSALILLVALDVPYQLWSYYKKLRMTKEEVKQEYKEAEGSP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R   R +MM+   +A +I+TNPTH+A+AL+Y      AP +VAKG  ++A
Sbjct: 239 EVKGRIRQMQREAARKRMMQEVPKANVIVTNPTHFAVALKYD-DTMRAPQVVAKGSLILA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +K+     E  +PI   P  AR+L+    +   IP   Y A AQ++  ++  +
Sbjct: 298 EKIIDTGKESRVPIMRSPRFARALYFHAELGQDIPAQLYAAAAQVLAYVFQLR 350


>gi|190890352|ref|YP_001976894.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CIAT
           652]
 gi|190695631|gb|ACE89716.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CIAT
           652]
          Length = 373

 Score =  332 bits (851), Expect = 6e-89,   Method: Composition-based stats.
 Identities = 149/347 (42%), Positives = 233/347 (67%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP++KK  DA  +GN P SRE S+F++ILA  IYL+FF    +  ++  L 
Sbjct: 17  DDDKDSKTEAPTAKKQTDAAEKGNVPFSRELSIFATILATFIYLVFFLPENVGRMSETLR 76

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
            +     Q K+E    I+ L   L  +++ L+ P  +L M+FGI S + Q +P   L  +
Sbjct: 77  DIFEQPDQWKIETGPDILALFVRLGWASAALLAPAFILLMVFGIASSIFQNLPTPVLERI 136

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P   R+S  +G  R++S+  L+ F KS  K+++VG I+   L   YF  +D + ++P +
Sbjct: 137 RPQASRISPVKGWSRLFSLPGLIEFGKSLFKVVVVGVILFFVLRSEYFGSIDAMFSDPQT 196

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
           IL      +RK++I++L+  A + + D  W+ H W+++LKM++ E+K+E KQ+ G+P +K
Sbjct: 197 ILVRMMTAMRKIIIVMLIATAIVAIADFFWTRHHWFTELKMTRHEVKEENKQAQGDPFVK 256

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
           +RQ+S+ R R R +M+    RAT++I NPTHYA+ALRY + ENDAPV++AKGQ+LIA K+
Sbjct: 257 SRQRSLMRDRARRRMIANVHRATLVIANPTHYAVALRYAREENDAPVVLAKGQDLIALKI 316

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           R+IA ++ IP+FE+P LARS+F QV ++S IP VFYKAVA+LI+++Y
Sbjct: 317 REIAEQNGIPVFEDPPLARSMFAQVSVDSVIPSVFYKAVAELIHRVY 363


>gi|86750881|ref|YP_487377.1| flagellar biosynthesis protein FlhB [Rhodopseudomonas palustris
           HaA2]
 gi|86573909|gb|ABD08466.1| flagellar biosynthetic protein FlhB [Rhodopseudomonas palustris
           HaA2]
          Length = 358

 Score =  332 bits (851), Expect = 6e-89,   Method: Composition-based stats.
 Identities = 113/353 (32%), Positives = 190/353 (53%), Gaps = 3/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS+ D+   K E P+ K+++DAL +G+   S+E + + +I    + L  F       +T 
Sbjct: 1   MSD-DSDQEKQEEPTQKRLDDALEKGDVAKSQEVNTWFAIAGATLLLSSFSGSIGSGITG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L+  +    ++ +  +    + L +  S L +P L L  +  IGS LIQ   V + 
Sbjct: 60  PMRTLIEKSWMLPVDGVGLLALTKSLLLMLISVLGVP-LGLLALVAIGSNLIQHRLVFST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +KP F ++S  EG KR++    L NF+K   K+I +G ++   L      +   +  +
Sbjct: 119 EGLKPKFSKLSPLEGAKRLFGKQALANFLKGLFKVIALGVVMVAVLYPERDRLDALLQMD 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             S+L        K++  +   +A +   D  + YH W  + KMS QE+KDE KQS G+P
Sbjct: 179 VVSLLGVTVSLTLKLMGTVAAVLAFVAAGDFFFQYHTWRERQKMSLQEVKDEYKQSEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R + I   R++ +MM A   A+++ITNPTH+++AL+Y +    AP+ VAKG + IA
Sbjct: 239 HIKGRIRQIRYQRMKKRMMAAVPGASVVITNPTHFSVALKYERG-MQAPICVAKGADAIA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++A  +++PI E   LAR+LF  V ++  IP   Y AVA++I  + + +
Sbjct: 298 FKIREVAKANDVPIVENVPLARALFATVEVDEEIPVEHYHAVAEVIGYVMNLR 350


>gi|220929449|ref|YP_002506358.1| flagellar biosynthetic protein FlhB [Clostridium cellulolyticum
           H10]
 gi|219999777|gb|ACL76378.1| flagellar biosynthetic protein FlhB [Clostridium cellulolyticum
           H10]
          Length = 381

 Score =  331 bits (850), Expect = 7e-89,   Method: Composition-based stats.
 Identities = 100/349 (28%), Positives = 179/349 (51%), Gaps = 1/349 (0%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
              +KTE  + KK  DA  +G    SRE +    ++  ++ +  F       +T  +   
Sbjct: 27  GAGDKTEKATPKKKSDARKKGQVFQSREMTASLILIITIVAMRIFGGTIYSQLTQYIKKT 86

Query: 66  LAS-ATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVK 124
                T +   D + +  L     +  ++ V+P LL+ ++  +     Q   +  +  +K
Sbjct: 87  FNEYLTVKDAIDFNILANLFIDALMVLAKTVLPLLLMALLAALIVNYAQVGILFTMETLK 146

Query: 125 PSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSI 184
               R++   G KRI+S+ ++V  +KS +KII+V  +    L      +L  +  +  ++
Sbjct: 147 IKGDRINPLSGFKRIFSLRSVVELLKSIIKIIIVSWVAYSYLKSKTEQVLSLMDTDLMNV 206

Query: 185 LYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKN 244
           L         V + I + +  L   D  +  + +   LKM+KQE+K+E KQ  G+P IK+
Sbjct: 207 LIFICDASFTVALRICMAMVILGFADYLYQRYDYEKNLKMTKQEVKEEYKQMEGSPEIKS 266

Query: 245 RQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMR 304
           + K   R     +MM+   +A ++ITNPTH+A+AL+Y   ++ AP +VAKGQ+ IA +++
Sbjct: 267 KIKQKQRQMSMKRMMQDIPKADVVITNPTHFAVALKYDTEKSSAPFVVAKGQDYIALRIK 326

Query: 305 KIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +IA ++ + I E   LAR+L+  V I  AIPP  Y+AVA+++  +Y+ K
Sbjct: 327 QIASDNKVQIVENKPLARTLYSTVDIGQAIPPDLYQAVAEILAFVYNLK 375


>gi|312135835|ref|YP_004003173.1| flagellar biosynthetic protein flhb [Caldicellulosiruptor
           owensensis OL]
 gi|311775886|gb|ADQ05373.1| flagellar biosynthetic protein FlhB [Caldicellulosiruptor
           owensensis OL]
          Length = 366

 Score =  331 bits (850), Expect = 7e-89,   Method: Composition-based stats.
 Identities = 101/344 (29%), Positives = 185/344 (53%), Gaps = 1/344 (0%)

Query: 10  KTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLASA 69
           KTE  + +K ++A   G    SRE +   ++L  +++L F +S     + +       + 
Sbjct: 16  KTEKATPRKRQEARKRGMVAKSREVTSAFALLMSILFLKFGYSLITQPLQAFSTYFFGNL 75

Query: 70  TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKR 129
               +E++     LL  +  ++ ++V+P  L  M         Q   ++    +K SF++
Sbjct: 76  D-YNIENVRDASRLLGLIVTTSLKIVLPFCLAVMFVATIVEWAQGSFLITAESLKISFQK 134

Query: 130 VSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAF 189
           ++  EG KRI+SIN++V  +KS +K++++G             +L+    N  +I+  +F
Sbjct: 135 INPIEGFKRIFSINSVVELIKSILKVLVIGYTGYSYTKSFAKKLLEMYEMNVLTIVKFSF 194

Query: 190 FTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKSI 249
            +   +++ + +    + ++D  +   Q+  KL M+K+E+K+E KQ+ GNP IK+R +  
Sbjct: 195 DSAVNLILWMSVMFFGIAIIDFTFQRWQYEKKLMMTKEEVKEEFKQTEGNPQIKSRIRER 254

Query: 250 ARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYE 309
            R     +M +   RA ++ITNPTHYA+AL Y   + DAP ++AKG++ IA K+++ A +
Sbjct: 255 QRRISLQRMFQQLPRADVVITNPTHYAVALLYEPEKFDAPRVIAKGKDYIALKIKQEAMK 314

Query: 310 HNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +NI I E   LAR+L+    I   IPP  Y+AVA+++  +Y  K
Sbjct: 315 YNIEIVENKELARALYNICEIGDFIPPELYQAVAEVLAYVYSLK 358


>gi|262273550|ref|ZP_06051364.1| flagellar biosynthesis protein FlhB [Grimontia hollisae CIP 101886]
 gi|262222528|gb|EEY73839.1| flagellar biosynthesis protein FlhB [Grimontia hollisae CIP 101886]
          Length = 375

 Score =  331 bits (850), Expect = 8e-89,   Method: Composition-based stats.
 Identities = 102/352 (28%), Positives = 184/352 (52%), Gaps = 2/352 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS++ +  +KTE PS +KI  A  EGN P SRE      ++A  + LL  FS  I+    
Sbjct: 1   MSDS-SAQDKTERPSEQKIRKAREEGNLPRSRELVTALMMVASAL-LLSAFSSAIHHTIV 58

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  +  +  +  +     +  LL   ++ A++ + P   L M+  IG+ L++    ++ 
Sbjct: 59  SVSEMTLNIDKDTIFSPDKMGELLWQSAILATQALAPLFALIMLVSIGANLLRGGWNIST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   +++   GIKRI+S N+LV  +KS +K+  +G  +   +      ++      
Sbjct: 119 KAMMPKLSKLNPLSGIKRIFSANSLVELIKSILKVTFIGGALYWLINHYLNEIIALQHTR 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             + +      +   L +  L +  + VL++ +S +++  KLKM+KQE+K+E K + G P
Sbjct: 179 LSAAIPAFLDLLWTGLFVYGLVLLFIAVLEMPYSSYEYIKKLKMTKQEVKEEHKNTEGRP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R + + R   +    +    A +IITNPTHYA+AL+Y  ++ +AP ++AKG +  A
Sbjct: 239 EIKARIRQLQRQMSQRAFAKTVPTADVIITNPTHYAVALKYDLSKANAPFVIAKGVDQAA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
            ++R+IA +H +P+ E P LAR+++        IP   Y AVA ++  ++  
Sbjct: 299 LQIRQIAQQHGLPVVEVPPLARAVYYSTNEWQEIPAQLYVAVAHVLNYVFQL 350


>gi|150020741|ref|YP_001306095.1| flagellar biosynthetic protein FlhB [Thermosipho melanesiensis
           BI429]
 gi|149793262|gb|ABR30710.1| flagellar biosynthetic protein FlhB [Thermosipho melanesiensis
           BI429]
          Length = 377

 Score =  331 bits (850), Expect = 9e-89,   Method: Composition-based stats.
 Identities = 99/345 (28%), Positives = 186/345 (53%), Gaps = 1/345 (0%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
           +KTE  + ++ + A  EG  PISRE +   + LA ++   F     I  + S +    A 
Sbjct: 32  DKTEKATPRRRQKAREEGQVPISRELTSGFTFLAAVLGFAFLGRGIILGLESAV-AFFAE 90

Query: 69  ATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFK 128
                  +I+ +     +        ++  + + M+ GI    +Q   +     +K  F 
Sbjct: 91  LPSYDTININDLGIYAFNAFKGLIIDLVIFVGIIMVTGIAVGSLQTKFLFTFKSLKLDFS 150

Query: 129 RVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHA 188
           +++   G+KR++S+ +L   +KS +K+++VG +  + +  N+  ML  I  +        
Sbjct: 151 KINPINGLKRMFSLRSLFELLKSILKLVIVGYVGYLVIKSNWNKMLLAIDKSVKDGSLLI 210

Query: 189 FFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKS 248
           +    ++LI   + +  +++ D  +S +++   ++M+KQE+K+E K+  GNP IK +Q+ 
Sbjct: 211 WDITFELLIKCGIALFIVSIADYFFSRYEYEKNIRMTKQEVKEEFKEVEGNPEIKRKQRE 270

Query: 249 IARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAY 308
           I      H+MM+    AT++ITNPTH+A+A++Y   E + P++VAKG + +A+K++K+A 
Sbjct: 271 IMMQYSMHRMMQEVPEATVVITNPTHFAVAIKYEVDEMEVPIVVAKGMDNLAEKIKKVAR 330

Query: 309 EHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           E+N+PI   P LAR L+  V +   IP  FY+AVA+++  +Y  K
Sbjct: 331 ENNVPILRNPKLARELYFNVDVGDEIPEKFYRAVAEVLAYVYSLK 375


>gi|167645349|ref|YP_001683012.1| flagellar biosynthesis protein FlhB [Caulobacter sp. K31]
 gi|167347779|gb|ABZ70514.1| flagellar biosynthetic protein FlhB [Caulobacter sp. K31]
          Length = 360

 Score =  331 bits (849), Expect = 9e-89,   Method: Composition-based stats.
 Identities = 101/353 (28%), Positives = 193/353 (54%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++    +KTE P++KK+ DA  +G+ P S + S  +S+      ++         + +
Sbjct: 1   MADDQDEASKTEEPTAKKLSDARAKGDVPKSADISQLASLSGAFGVVVIAGGWLTRDLVN 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L    A A    +E    +  +     ++A   ++  +++  + G  + + Q   +L+ 
Sbjct: 61  QLTPFFAHAGTMDVE--GGVNAIAKTAVMAALPALVLVMVVSGLLGAAANVAQSGFILSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + +KP  +++ + +G+KR++ ++  V F KS VK ++ G I    +  +   + + +  +
Sbjct: 119 DKIKPDLQKLDIIKGLKRVFGMDGFVQFAKSAVKFLVTGLIAWYVVKPDAAQIPNLVGMD 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             +I+  +     K+  M+L+F+      D  W   ++  +++MS Q+IKDE KQS G+P
Sbjct: 179 VGAIIPLSMKLCTKLFWMVLIFLMATAGFDWFWQRLRFNKRMRMSLQDIKDEHKQSEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K +QK +   R R +MM A  +AT++I NPTHYA+AL+Y Q EN AP+ VAKG + +A
Sbjct: 239 HVKGKQKQLRMQRSRQRMMAAVPKATVVIMNPTHYAVALKYEQGENAAPICVAKGVDDLA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R +A E  + I E+P LAR+L+  + ++  IP   ++AVA++I  +   K
Sbjct: 299 LRIRAVAEEAGVYILEDPPLARALYAAMDVDEQIPAEHFEAVAKVIGFVMSNK 351


>gi|54297699|ref|YP_124068.1| flagellar biosynthesis protein FlhB [Legionella pneumophila str.
           Paris]
 gi|53751484|emb|CAH12902.1| Flagellar biosynthetic protein FlhB [Legionella pneumophila str.
           Paris]
          Length = 382

 Score =  331 bits (849), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 98/353 (27%), Positives = 185/353 (52%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++ +    KTE PSSK+++++  +G    S++ +    +L   +    F       + S
Sbjct: 1   MADEEQSQEKTEQPSSKRLKESRKKGQVARSKDFNATVILLFTGLGFFIFGKQLSLQIAS 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +        +  L   ++ +  L  L+ S    V+P LL+  +  + + L+    V + 
Sbjct: 61  IMQQAFD-FDRDILVTGNNSLENLFQLTKSGLWSVVPLLLVIFILSLLAPLLMGGWVFSG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F R+++ +G KR+ S+   V  +K+F+K +LV +   + L      +L+   A 
Sbjct: 120 QSIQPKFSRLNVLKGFKRMISLKGFVEMLKAFLKFVLVASASILVLRSQVPLLLELGKAP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               +      + K  ++I   +  +  +D+ +  ++    +KM+KQE+KDE K++ G P
Sbjct: 180 LEIAITSGVMILLKSFVLISASLILIAAIDVPFQLYEHSKSIKMTKQELKDEYKETEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K+  +   +   R +MM    +A +I+TNPTHYA+AL Y +    APV++AKG+NL+A
Sbjct: 240 EVKSAIRRAQQETARRRMMSEVPKADVILTNPTHYAVALSYQKKGKKAPVVIAKGKNLVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++ K+A EH IPI   P+LAR+++    +N+ IP   Y AVAQ++  I+  +
Sbjct: 300 FQISKVAKEHKIPIISVPALARAIYFSTKLNAEIPRGLYVAVAQVLAYIFQLR 352


>gi|332981452|ref|YP_004462893.1| flagellar biosynthetic protein FlhB [Mahella australiensis 50-1
           BON]
 gi|332699130|gb|AEE96071.1| flagellar biosynthetic protein FlhB [Mahella australiensis 50-1
           BON]
          Length = 361

 Score =  331 bits (849), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 95/347 (27%), Positives = 174/347 (50%), Gaps = 1/347 (0%)

Query: 7   PDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLL 66
            D KTE P+ K+  +A  +G    S E ++ + +LA  + +   F   +  +T+    + 
Sbjct: 12  DDEKTEQPTPKRRREAREKGQVFKSAEINMVAVLLASFLVIKAIFPSLLQILTAYERQIY 71

Query: 67  ASATQRK-LEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
             A     +    ++  L  +  +   + +   +    + GI   + Q   V +   +  
Sbjct: 72  TMAGSADSIYTSENLSTLFINTIIQIGKGLWIFIFGICIIGIAVNIAQVGFVFSAKPLAM 131

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
               ++   G KRI+S   +   +KS +KI ++G +    +  +    L         ++
Sbjct: 132 DLGHLNPAAGFKRIFSKRAVNELVKSILKIAIIGYVAYTEIRNDINIFLAMSREGTSVMI 191

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
           Y     V    I +   +AT+ VLD  +   ++   L+MSKQE+K E K++ G+P IK R
Sbjct: 192 YDMVSIVLNAAIKLTAVMATVAVLDYIFQRREYERNLRMSKQEVKQEFKETEGDPQIKAR 251

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
            + I R     +MM+   +A ++ITNPTH+A+ALRY    + APV++AKG + +A+++++
Sbjct: 252 IRQIQRQLAMMRMMQQVPKADVVITNPTHFAVALRYDAETDQAPVILAKGVDYMAQRIKE 311

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
           +A +  +PI E   LAR+L+  V I   IPP FY+AVA+++  +Y+ 
Sbjct: 312 VARQSRVPIVENRELARNLYYAVDIGQIIPPQFYEAVAEVLAYVYNM 358


>gi|90415339|ref|ZP_01223273.1| flagellar biosynthetic protein FlhB [marine gamma proteobacterium
           HTCC2207]
 gi|90332662|gb|EAS47832.1| flagellar biosynthetic protein FlhB [marine gamma proteobacterium
           HTCC2207]
          Length = 382

 Score =  331 bits (849), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 95/352 (26%), Positives = 186/352 (52%), Gaps = 1/352 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS+ D+ + + E P++K++E    +G    S+E  + + ++    +L  F S  I  +T 
Sbjct: 1   MSDKDSSEEREEEPTAKRLEKGREDGQVARSQELGVAAMMIGVAFFLYLFGSYIIADLTK 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
                  +  ++ + D S +V      ++++  +V+P  +L ++  I S  I    + +L
Sbjct: 61  VFASGF-TFDRKAVFDTSLLVPAFGIQAVNSFIVVVPIFVLAVIIAIASAGIMGGYIFSL 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   +++   G+KR++ +  +V+  K+  K  L+  ++ + ++ N+  +      +
Sbjct: 120 KSLAPKASKINPMAGLKRMFGMKAVVDLSKALSKFALIALVLYLVVSANFPMLTKLGFMD 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               +  A   +    +++ L +     +DI +  H +  ++KM+KQE+K+E+K + G P
Sbjct: 180 LEPAMAEAGRIIAFGTVLVTLTLIVAAAIDIPYQLHTFNKQMKMTKQEVKEEMKDTEGRP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + +   R      MM A + A ++I NP H+A+AL Y  ++N AP++VAKG +L+A
Sbjct: 240 EVKAQIRRKQREIATGMMMSAIADADVVIVNPEHFAVALSYDPSKNGAPIMVAKGADLLA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
           K +R+ A E  IP+F  P LARS+F    IN ++P   Y AVAQ+I  I++ 
Sbjct: 300 KAIRERAKEEGIPLFSSPVLARSIFYTTEINQSVPESLYYAVAQVIAYIFNL 351


>gi|86356301|ref|YP_468193.1| flagellar biosynthesis protein FlhB [Rhizobium etli CFN 42]
 gi|86280403|gb|ABC89466.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CFN
           42]
          Length = 373

 Score =  331 bits (849), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 150/347 (43%), Positives = 235/347 (67%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP++KK  DA  +GN P SRE S+F++ILA  IYL+FF    +  ++  L 
Sbjct: 17  DDDKDSKTEAPTAKKQTDAAEKGNVPFSRELSIFATILATYIYLVFFLPDSVGRMSETLR 76

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
            +     Q K+E    ++ L   L  + + L+ P  +LFM+FGI S + Q +P   L  +
Sbjct: 77  DIFEQPDQWKIETGPDVLSLFVRLGWAIAALLAPAFILFMVFGIASSVFQNLPTPVLERI 136

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P   R+S  +G  R++S+  L+ F KS  K+++VG I+   L   YF+ +D + ++P +
Sbjct: 137 RPQASRISPAKGWGRLFSLPGLIEFGKSLFKVVVVGLILFFVLRSEYFSSIDAMFSDPQT 196

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
           IL      +RK++I++L+  A + + D+ W+ H W+++LKM++ EIK+E KQ+ G+P +K
Sbjct: 197 ILVRISTAMRKIVIVVLIATAIVAIADVFWTRHHWFTELKMTRHEIKEENKQAQGDPFVK 256

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
           +RQ+S+ R R R +M+    RAT++I NPTHYA+ALRY + ENDAPV++AKGQ+LIA K+
Sbjct: 257 SRQRSLMRDRARRRMIANVHRATLVIANPTHYAVALRYAREENDAPVVLAKGQDLIALKI 316

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           R+IA ++ IP+FE+P LARS+F QV ++S IP VFYKAVA+LI+++Y
Sbjct: 317 REIAEQNGIPVFEDPPLARSMFAQVSVDSVIPSVFYKAVAELIHRVY 363


>gi|326791523|ref|YP_004309344.1| flagellar biosynthetic protein FlhB [Clostridium lentocellum DSM
           5427]
 gi|326542287|gb|ADZ84146.1| flagellar biosynthetic protein FlhB [Clostridium lentocellum DSM
           5427]
          Length = 372

 Score =  331 bits (848), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 99/348 (28%), Positives = 175/348 (50%), Gaps = 1/348 (0%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
             + +TE  + KK EDA  +G    S E +    I+      L      +  + + +   
Sbjct: 16  ESEGRTEKATPKKKEDARKKGQVAKSAELNTAVLIVGFCAVSLLLGGYMLSGIQTSIITS 75

Query: 66  LASATQRKLE-DISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVK 124
           +   ++   E   ++++ +          + +P  +   + G     IQ    ++   +K
Sbjct: 76  MNRLSEVFNEVTSNYMLVVFRSAIFDILWICLPLWICLFIIGFIVSYIQVGYKVSFEPMK 135

Query: 125 PSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSI 184
             F +++   GIKRI S + +V+ + S  K+I++G I+   +       + F       I
Sbjct: 136 VKFSKMNPINGIKRIISKDMIVSLILSAAKVIVLGAIVYNIILSKIPIFMRFYELTIEQI 195

Query: 185 LYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKN 244
           L     TV ++   +      L VLD  +  ++    +KM+KQEIK+E K + G+P IK+
Sbjct: 196 LNTIAMTVVQIGFFVGGAFLVLAVLDYVYQRYKHADSIKMTKQEIKEEYKNAEGDPQIKS 255

Query: 245 RQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMR 304
           + K   R     +MM+A   A +IITNPTH+A+A++Y +++  APV+VAKG + +A+K++
Sbjct: 256 KIKQKMREGSMRRMMQAIPEADVIITNPTHFAIAIKYDESKGTAPVVVAKGVDYVAQKIK 315

Query: 305 KIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
           + A EH+I I E   LAR+L+  V +N  IPP  Y AVA+++  IY+ 
Sbjct: 316 EKAKEHHIEIVENKPLARALYYTVDLNKEIPPELYGAVAEVLAFIYNL 363


>gi|91976176|ref|YP_568835.1| flagellar biosynthesis protein FlhB [Rhodopseudomonas palustris
           BisB5]
 gi|91682632|gb|ABE38934.1| flagellar biosynthetic protein FlhB [Rhodopseudomonas palustris
           BisB5]
          Length = 357

 Score =  331 bits (848), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 112/353 (31%), Positives = 187/353 (52%), Gaps = 3/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS+ D  + K + P+ K+++DAL  G+   S+E + +  I    + L  F       VT 
Sbjct: 1   MSD-DNDEEKQQEPTQKRLDDALKRGDVAKSQEVNTWFVIAGATLLLSSFSGSIGTGVTG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +  L+  +   K++    +    + L +  S L +P  LL ++  IGS LIQ   V + 
Sbjct: 60  PMRALIEKSWMLKVDGAGLLALTKSLLLMLVSVLGVPLFLLMLVA-IGSNLIQHRLVFST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   ++S  EG KR++    L NF+K   K+I +G ++   L      +   +  +
Sbjct: 119 EGLTPKLSKLSPLEGAKRLFGKQALANFLKGLFKVIALGVVMVAVLYPERDRLDALLQMD 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             S+L        K++  +   +A +   D  + Y  W+ + KMS QE+KDE KQS G+P
Sbjct: 179 VVSLLGVTVGLTLKLMGSVAAVLAFVAAGDYFFQYRTWHERQKMSLQEVKDEYKQSEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R + I   R++ +MM A   A+++ITNPTH+++AL+Y +    AP+ VAKG + IA
Sbjct: 239 HIKGRIRQIRYQRMKKRMMAAVPSASVVITNPTHFSVALKYERG-MQAPICVAKGADAIA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++A  +N+PI E   LAR+L+  V ++  IP   Y AVA++I  + + K
Sbjct: 298 FKIREVAKANNVPIVENVPLARALYATVEVDGEIPIEHYHAVAEVIGYVMNLK 350


>gi|54294673|ref|YP_127088.1| flagellar biosynthesis protein FlhB [Legionella pneumophila str.
           Lens]
 gi|53754505|emb|CAH15989.1| Flagellar biosynthetic protein FlhB [Legionella pneumophila str.
           Lens]
          Length = 382

 Score =  331 bits (848), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 98/353 (27%), Positives = 185/353 (52%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++ +    KTE PSSK+++++  +G    S++ +    +L   +    F       + S
Sbjct: 1   MADEEQSQEKTEQPSSKRLKESRKKGQVARSKDFNATVILLFTGLGFFIFGKQLSLQIAS 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +        +  L   ++ +  L  L+ S    V+P LL+  +  + + L+    V + 
Sbjct: 61  IMQQAFD-FDRDILVTGNNSLENLFQLTKSGLWSVVPLLLVIFILSLLAPLLMGGWVFSG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F R+++ +G KR+ S+   V  +K+F+K +LV +   + L      +L+   A 
Sbjct: 120 QSIQPKFSRLNVLKGFKRMISLKGFVEMLKAFLKFVLVASASILVLRSQVPLLLELGKAP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               +      + K  ++I   +  +  +D+ +  ++    +KM+KQE+KDE K++ G P
Sbjct: 180 LEIAITSGVMILLKSFVLISASLILIAAIDVPFQLYEHSKSIKMTKQELKDEYKETEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K+  +   +   R +MM    +A +I+TNPTHYA+AL Y +    APV++AKG+NL+A
Sbjct: 240 EVKSAIRRAQQEAARRRMMSEVPKADVILTNPTHYAVALSYQKKGKKAPVVIAKGKNLVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++ K+A EH IPI   P+LAR+++    +N+ IP   Y AVAQ++  I+  +
Sbjct: 300 FQISKVAKEHKIPIISVPALARAIYFSTKLNAEIPRGLYVAVAQVLAYIFQLR 352


>gi|327193023|gb|EGE59935.1| flagellar biosynthesis transmembrane protein [Rhizobium etli
           CNPAF512]
          Length = 373

 Score =  331 bits (848), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 149/347 (42%), Positives = 233/347 (67%)

Query: 4   NDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLH 63
           +D  D+KTEAP++KK  DA  +GN P SRE S+F++ILA  IYL+FF    +  ++  L 
Sbjct: 17  DDDKDSKTEAPTAKKQTDAAEKGNVPFSRELSIFATILATFIYLVFFLPENVGRMSETLR 76

Query: 64  VLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
            +     Q K+E    I+ L   L  +++ L+ P  +L M+FGI S + Q +P   L  +
Sbjct: 77  DIFEQPDQWKIETGPDILALFVRLGWASAALLAPAFILLMVFGIASSIFQNLPTPVLERI 136

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           +P   R+S  +G  R++S+  L+ F KS  K+++VG I+   L   YF  +D + ++P +
Sbjct: 137 RPQASRISPMKGWSRLFSLPGLIEFGKSLFKVVVVGVILFFVLRSEYFGSIDAMFSDPQT 196

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
           IL      +RK++I++L+  A + + D  W+ H W+++LKM++ E+K+E KQ+ G+P +K
Sbjct: 197 ILVRMMTAMRKIIIVMLIATAIVAIADFFWTRHHWFTELKMTRHEVKEENKQAQGDPFVK 256

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
           +RQ+S+ R R R +M+    RAT++I NPTHYA+ALRY + ENDAPV++AKGQ+LIA K+
Sbjct: 257 SRQRSLMRDRARRRMIANVHRATLVIANPTHYAVALRYAREENDAPVVLAKGQDLIALKI 316

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           R+IA ++ IP+FE+P LARS+F QV ++S IP VFYKAVA+LI+++Y
Sbjct: 317 REIAEQNGIPVFEDPPLARSMFAQVSVDSVIPSVFYKAVAELIHRVY 363


>gi|299069778|emb|CBJ41057.1| flagellar export pore protein [Ralstonia solanacearum CMR15]
          Length = 387

 Score =  331 bits (848), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 94/353 (26%), Positives = 172/353 (48%), Gaps = 3/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE D+   KTE  S++++E A  EG+ P SRE   F  +      L       + +  S
Sbjct: 1   MSE-DSDLEKTEPASARRLEQAREEGDVPQSRELVSFVLLATGAGGLWVMGESIVRTAAS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L     R     +   +            V+ GL+L ++    S L      ++ 
Sbjct: 60  FLARCLE--FHRYDYTRAQEQWHYVGAQFGPLATVLAGLVLMLVLAALSPLALTRGAISF 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             V P   R+    G+KR++S+  L+   +   K++L+G +    +       ++    +
Sbjct: 118 KPVTPDITRLLGMHGLKRMFSVQGLLELPRLLAKLVLLGGVGWWLILHYRDDFVELPRQD 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             + +           + +   +  +  +D+  +  Q+  K +M+K+E++ E ++S G+P
Sbjct: 178 LIAGMRDTMHVAGVAFLCMAGVMLLVAAVDVPLALWQYARKHRMTKEEVRKEHRESEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +++ R   + +MM    +A +I+TNPTHYA+ALRY + E  AP ++AKG +++A
Sbjct: 238 QLKGRIRAMQRQAAQRRMMADVPKADVIVTNPTHYAVALRYSEQEGGAPRVLAKGADMVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++  EH IP+ E P LAR+L++   I   IP   Y AVA+++  +Y  +
Sbjct: 298 AKIRELGAEHKIPMLEAPPLARALYRHTEIGHQIPAALYAAVAEVLAYVYQLR 350


>gi|317051542|ref|YP_004112658.1| flagellar biosynthetic protein FlhB [Desulfurispirillum indicum S5]
 gi|316946626|gb|ADU66102.1| flagellar biosynthetic protein FlhB [Desulfurispirillum indicum S5]
          Length = 354

 Score =  331 bits (848), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 104/349 (29%), Positives = 184/349 (52%), Gaps = 1/349 (0%)

Query: 5   DAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHV 64
           ++   KTE P+ KK+E A  EGN   S++ S  + + A ++ L F     +    + +  
Sbjct: 4   ESDQEKTEEPTPKKLEKAREEGNVAKSKDMSDTAVLFAGVMTLYFLHERMLEGFFAIMRN 63

Query: 65  LLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVK 124
            L   T+     I+ +      + L    ++ P  L   +F +   + Q   + +   V 
Sbjct: 64  YLD-LTRNTFPTINEMPSFGITILLQMLHILWPLFLALTLFALAINIGQIGLLWSSKAVA 122

Query: 125 PSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSI 184
           P + +++  +GI + +S+ NL+   KS +K+ + G +      + + ++L  +   P  I
Sbjct: 123 PKWSKLNPIKGIAQKFSLKNLIEVTKSLLKVSVFGPVAYFIAKDEFGSILMMMHLTPIEI 182

Query: 185 LYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKN 244
              A   + K+ I I+L +  ++ +D  +  +Q + KLKMSKQE+K+E KQ  GNP +K 
Sbjct: 183 FATALMIIFKIWITIILIMLIVSAVDFYFQKYQHHEKLKMSKQEVKEERKQMDGNPEVKQ 242

Query: 245 RQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMR 304
           R +S+ R     +MM    ++ ++ITNP   A+AL+Y      AP LVAKGQ L+A+++R
Sbjct: 243 RIRSLQREMAMKRMMGDVPKSDVVITNPLFLAVALKYDTEVKAAPYLVAKGQELVAQRIR 302

Query: 305 KIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            +A EH+IPI ++P LAR L+  +     I    Y+AVA+++ +IY +K
Sbjct: 303 DLALEHDIPIQQDPLLARQLYDSLEPGDEITHELYQAVAEILAEIYRQK 351


>gi|148359330|ref|YP_001250537.1| hypothetical protein LPC_1227 [Legionella pneumophila str. Corby]
 gi|296107377|ref|YP_003619077.1| flagellar biosynthetic protein FlhB [Legionella pneumophila 2300/99
           Alcoy]
 gi|148281103|gb|ABQ55191.1| hypothetical protein LPC_1227 [Legionella pneumophila str. Corby]
 gi|295649278|gb|ADG25125.1| flagellar biosynthetic protein FlhB [Legionella pneumophila 2300/99
           Alcoy]
          Length = 382

 Score =  331 bits (848), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 98/353 (27%), Positives = 186/353 (52%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++ +    KTE PSSK+++++  +G    S++ +    +L   +    F       + S
Sbjct: 1   MADEEQSQEKTEQPSSKRLKESRKKGQVARSKDFNATVILLFTGLGFFIFGKQLSLQIAS 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +        +  L   ++ +  L  L+ S    V+P LL+  +  + + L+    V + 
Sbjct: 61  IMQQAFD-FDRDILVTGNNSLENLFQLTKSGLWSVVPLLLVIFILSLLAPLLMGGWVFSG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F R+++ +G+KR+ S+   V  +K+F+K +LV +   + L      +L+   A 
Sbjct: 120 QSIQPKFSRLNVLKGLKRMISLKGFVEMLKAFLKFVLVASASILVLRSQVPLLLELGKAP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               +      + K  ++I   +  +  +D+ +  ++    +KM+KQE+KDE K++ G P
Sbjct: 180 LEIAITSGVMILLKSFVLISASLILIAAIDVPFQLYEHSKSIKMTKQELKDEYKETEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K+  +   +   R +MM    +A +I+TNPTHYA+AL Y +    APV++AKG+NL+A
Sbjct: 240 EVKSAIRRAQQETARRRMMSEVPKADVILTNPTHYAVALSYQKKGKKAPVVIAKGKNLVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++ K+A EH IPI   P+LAR+++    +N+ IP   Y AVAQ++  I+  +
Sbjct: 300 FQISKVAKEHKIPIISVPALARAIYFSTKLNAEIPRGLYVAVAQVLAYIFQLR 352


>gi|37525818|ref|NP_929162.1| flagellar biosynthesis protein FlhB [Photorhabdus luminescens
           subsp. laumondii TTO1]
 gi|36785247|emb|CAE14188.1| Flagellar biosynthetic protein FlhB [Photorhabdus luminescens
           subsp. laumondii TTO1]
          Length = 383

 Score =  331 bits (848), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 102/353 (28%), Positives = 175/353 (49%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   KTE P+  K E A  EG    SRE S    + + L  L        + ++ 
Sbjct: 1   MAE-DSDLEKTEEPTPHKREKARKEGQIVRSRELSSILMLTSGLSLLWMSGQSMTHELSL 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +     S     + +   +V  +  L   A   ++P     ++  + +  +    V + 
Sbjct: 60  MVFEGF-SFDHSMVSNDKQMVQQIGRLLQQAVLALLPVFAGLVLVALSAPALLGGLVFST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +K   K+++   G+KRI+S+N L    K+ +K   VG    + L  N+  ML  I+  
Sbjct: 119 KSIKFDPKKLNPISGLKRIFSMNALAELFKALLKAGFVGIGAALFLWMNWPAMLRLIAQP 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P   L  A   +     +++  +  +   D+ +  +    KL+M++QEIKDE K+  G+P
Sbjct: 179 PLLALDDAMQMLIFAGYVVVFMLIPMVAFDVVYQIYSHLKKLRMTRQEIKDEFKEQEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +   R+  R +MM    +A +I+TNPTHYA+AL+Y +    AP ++AKG  +IA
Sbjct: 239 HVKARIRQQQRAAARQRMMADVPKADVIVTNPTHYAVALKYDEKAMSAPKILAKGAGIIA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++++I  E+ IP+ E P LAR+L++   I   IP   Y AVA+++  +Y  K
Sbjct: 299 LRIKEIGTENRIPLLEVPPLARALYRHGEIGGQIPATLYAAVAEVLAWVYQLK 351


>gi|239817109|ref|YP_002946019.1| flagellar biosynthetic protein FlhB [Variovorax paradoxus S110]
 gi|239803686|gb|ACS20753.1| flagellar biosynthetic protein FlhB [Variovorax paradoxus S110]
          Length = 382

 Score =  330 bits (847), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 92/353 (26%), Positives = 179/353 (50%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  +   KTE  S +++E A  +G+   SRE + F  +   +  L         ++  
Sbjct: 1   MAEE-SDLEKTEPASPQRLEKAREQGDVARSRELATFVLLGTAVAGLWLTADSLGATLRG 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L    +    D SH++     +   A   ++P   + ++  + + L+    +L+ 
Sbjct: 60  ALAQGL-HFDRAAAFDPSHMLARAGLMGQQALLALVPLFGMMLVAAVAAPLMLGGWLLSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F ++    G+ R++S   L    K+  K +L+G +  + + +N   +   ++ +
Sbjct: 119 KALAPKFSKLDPVAGVGRMFSAQALSELFKALAKSLLIGGVAWLVIMDNVDEVSALMAQS 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             + L      V     +I   +  + ++D+ +    ++ KL+MS+++++ E K+S G+P
Sbjct: 179 ERAALPQMIVLVAHNCALIASALFLVALVDVPYQLWSYHRKLRMSREDLRQEHKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK + +   +   R +MM    +A I++TNPTH+A+AL+Y+  +  AP +VAKG +L+A
Sbjct: 239 HIKAQIRRQQQQMARRRMMSEVPKADIVVTNPTHFAVALKYVDHDMRAPRVVAKGSDLMA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+IA E+N+ I E P L R+LFK   +   IP   Y AVA+++  +Y  K
Sbjct: 299 ARIREIARENNVAILEAPPLTRALFKHTRLGDEIPAGLYTAVAEVLAWVYQLK 351


>gi|170741402|ref|YP_001770057.1| flagellar biosynthesis protein FlhB [Methylobacterium sp. 4-46]
 gi|168195676|gb|ACA17623.1| flagellar biosynthetic protein FlhB [Methylobacterium sp. 4-46]
          Length = 354

 Score =  330 bits (847), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 115/350 (32%), Positives = 208/350 (59%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++    ++KTE+P+ +++ +A+ +G+ P+SREAS+ +S++  LI L  F      ++  
Sbjct: 1   MADETDQESKTESPTERRVREAIEKGDVPVSREASVLASVIGLLIALTLFVRGQAATLAR 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           +   L+       LE+      LL  ++++A R ++P L +  + G+ + ++Q +P    
Sbjct: 61  EFVPLIDQPRGFTLENARDATLLLQSVAIAAGRFLLPVLAILAVCGLAASMLQNLPRFVG 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + ++P + RVS   G  RI+  +  V F+KS  K + +  +  + L      +L+ ++ +
Sbjct: 121 DRIQPKWSRVSPASGWSRIFGRSGQVEFLKSLFKFLTITVVSLLLLRSERHKVLNAMTVD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P  +         +++  + +    L   D+ W+  +W   L+MS+QE KDE KQ  G+P
Sbjct: 181 PSQVPELILSMAIRLVSAVSIATIVLVAADLIWARLRWQRSLRMSRQETKDEHKQIEGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           ++K R +S+A+ R R +M+ A  RAT++I NPTH+A+ALRY + EN AP++VAKGQ+LIA
Sbjct: 241 LVKARLRSLAQDRTRKRMLAAVPRATVVIANPTHFAVALRYERDENPAPLVVAKGQDLIA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
            K+R+IA  + IP+ E+  LARSL+  V ++  IP  FY+AVAQ+++ ++
Sbjct: 301 LKIREIAEANGIPVIEDKPLARSLYDSVQVDQLIPAEFYRAVAQILFYVF 350


>gi|306820134|ref|ZP_07453782.1| flagellar biosynthetic protein FlhB [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
 gi|304551912|gb|EFM39855.1| flagellar biosynthetic protein FlhB [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
          Length = 379

 Score =  330 bits (846), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 109/345 (31%), Positives = 182/345 (52%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE  + KK ED   +GN   SRE +  +S+ A +  +  F    +  +    +     
Sbjct: 27  EKTEEATPKKKEDTRKKGNVLQSRELTGAASLFAAVFAINTFSKEILKVIVDAWNYYTGM 86

Query: 69  ATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFK 128
               +L +      L T L +   + ++  ++  ++        Q   +     ++P  +
Sbjct: 87  LNSFELTNQMQAYKLFTTLLIFCVKAMLFIIIPVVLVAFLVQKAQVGNIFTAETIRPKLE 146

Query: 129 RVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHA 188
           R+S+  G KR++S+ + V  +KS +KI+LVG +    + +N   ++   S N     Y  
Sbjct: 147 RISILSGFKRMFSMQSTVTLIKSLLKIMLVGYVGYAYIKDNMPLVMKSFSLNDKQFSYML 206

Query: 189 FFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKS 248
           F     + + ++  I  L + D  +  H +   ++MSKQEIKDE KQS G+P IK++ K 
Sbjct: 207 FHFSINMALRMVYVIIALGIFDYVYQRHSYNKNIRMSKQEIKDEYKQSEGDPQIKSKIKE 266

Query: 249 IARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAY 308
             R     +MM+   +A +IITNPTH+A+AL+Y + + DAP +VAKGQ+ IAKK+R+ A 
Sbjct: 267 RQRQSAMRRMMQDLPKADVIITNPTHFAVALKYDEDKYDAPYVVAKGQDFIAKKIREKAK 326

Query: 309 EHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           E +IPI E   LAR+L+ ++ I S I P  Y+AVA+++  I+  K
Sbjct: 327 ELDIPIVENKPLARALYSEIDIGSVITPQLYEAVAEVLAYIFSLK 371


>gi|299131771|ref|ZP_07024966.1| flagellar biosynthetic protein FlhB [Afipia sp. 1NLS2]
 gi|298591908|gb|EFI52108.1| flagellar biosynthetic protein FlhB [Afipia sp. 1NLS2]
          Length = 356

 Score =  330 bits (846), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 114/353 (32%), Positives = 191/353 (54%), Gaps = 3/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E    ++KT+ P++K++EDA   G+   S E + +  I      +  F       +T 
Sbjct: 1   MAEE-GDEDKTQDPTAKRLEDAHKRGDVAKSIEVNTWFMIAGATFIMSSFSGSIANKLTV 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  LL  A + K +  S ++ L+  L       +     L ++  +GS+LIQ  PV ++
Sbjct: 60  PLKNLLEHAGRMKTDGPS-LLLLVGRLETVMLTALGIPFALLIVAAVGSHLIQHRPVWSV 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + + P F ++S   G KR++      NF K   K+I++G ++ + +   +      +  +
Sbjct: 119 DPITPKFSKLSPMSGAKRLFGKQAAANFAKGLFKVIVLGVVMAMVMWPEHERADVMVRID 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P  +L        K++  ++  +A +  LD  + Y  W+ + KMS QE+KDE KQS G+P
Sbjct: 179 PSLMLDLTRSMALKLMGTVVAMLAIVATLDYLFQYRSWFERQKMSLQEVKDEYKQSEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R +++  +R+R +MM A   A+++ITNPTHYA+AL+Y +    AP+ VAKG +LIA
Sbjct: 239 HIKGRIRALRVARMRKRMMAAVPTASVVITNPTHYAVALKYERG-MPAPICVAKGVDLIA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++A  H+IP+ E   LAR+L   V I+  IP   Y AVA++I  +   K
Sbjct: 298 FKIREVAAAHDIPVVENVPLARALHASVEIDDEIPVEHYHAVAEVIGYVMKLK 350


>gi|229827381|ref|ZP_04453450.1| hypothetical protein GCWU000182_02769 [Abiotrophia defectiva ATCC
           49176]
 gi|229788319|gb|EEP24433.1| hypothetical protein GCWU000182_02769 [Abiotrophia defectiva ATCC
           49176]
          Length = 387

 Score =  330 bits (846), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 94/350 (26%), Positives = 168/350 (48%), Gaps = 2/350 (0%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
              +KTE  + KK+EDA  EG    S +      +L     L  F +             
Sbjct: 31  EGGDKTEKATPKKLEDARKEGRVARSSDLINGLMLLLMFFVLRIFGNFMAKGFLESFVKY 90

Query: 66  L--ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHV 123
               +    ++ D+   V L   +        +P L+   +      ++Q    +    +
Sbjct: 91  YNKTADISMEIFDVKQAVNLGNEIVFDIVIACLPVLIGSFLVAFAGNVVQIGWKVTTKPL 150

Query: 124 KPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHS 183
           KP   R++   G+KR++S   +V  +KS +K++ +  +    + + +  +L+        
Sbjct: 151 KPKLDRLNPIGGLKRMFSQEKVVELIKSILKVLAIAIVAYNEVKDRWLFILNLYDFEFMQ 210

Query: 184 ILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIK 243
            + + F  V  V + I +    + + D G+   +    L+MSKQE+KDE+KQS G+P +K
Sbjct: 211 AIVNIFDIVLDVGVKISVLFVIIGIADFGYQKWKHLHDLRMSKQEVKDEMKQSEGDPQVK 270

Query: 244 NRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKM 303
            R +   R   R +MM+   +A ++ITNPTH+A+A++Y + + +AP ++AKG + +A  +
Sbjct: 271 GRIRQKMREGARRRMMQELPKADVVITNPTHFAVAIKYDKEKAEAPYVLAKGADYVAATI 330

Query: 304 RKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           ++ A EH I I E   LAR L+  V I   IPP  Y+ VA+++  +Y  K
Sbjct: 331 KEAAKEHKIEIVENKPLARMLYYNVEIGEQIPPELYQMVAEVLAYVYSVK 380


>gi|312621587|ref|YP_004023200.1| flagellar biosynthetic protein flhb [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312202054|gb|ADQ45381.1| flagellar biosynthetic protein FlhB [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 366

 Score =  330 bits (846), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 103/344 (29%), Positives = 188/344 (54%), Gaps = 1/344 (0%)

Query: 10  KTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLASA 69
           KTE  + +K ++A   G    SRE +   ++L  +++L F +S  I  +        ++ 
Sbjct: 16  KTEKATPRKRQEARKRGMVAKSREVTSAFALLISVLFLKFGYSLIIVPLQQGSKYFFSNL 75

Query: 70  TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKR 129
               LEDIS    LL+ +  ++ ++V+P  +  M         Q   ++    +K SF++
Sbjct: 76  -NYSLEDISDASKLLSFIITTSLKIVLPFCVTIMFVAAIVEWAQSSFLITGQSLKMSFQK 134

Query: 130 VSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAF 189
           ++  EG KRI+SIN++V  +KS +K++++G             +L+    N  +I+  +F
Sbjct: 135 INPIEGFKRIFSINSVVELIKSVLKVLIIGYTGYCYTQTFAKKLLEMYEMNVFTIVRFSF 194

Query: 190 FTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKSI 249
            +   +++ + +    + V+D  +   Q+  KL M+K+E+K+E KQ+ GNP IK++ +  
Sbjct: 195 DSAINLILWMAVMFFGIAVIDFIFQRQQYEKKLMMTKEEVKEEFKQTEGNPQIKSKIRER 254

Query: 250 ARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYE 309
            R     +M +   +A ++ITNPTHYA+AL Y   + DAP ++AKG++ IA+K+++ A +
Sbjct: 255 QRRISLQRMFQQLPKADVVITNPTHYAVALLYEPEKFDAPRVIAKGKDYIAQKIKQEAIK 314

Query: 310 HNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           H I I E   LAR+L+    +   IPP  Y+AVA+++  +Y  K
Sbjct: 315 HRIEIVENRELARALYNMCEVGDFIPPELYQAVAEVLAYVYSLK 358


>gi|312792666|ref|YP_004025589.1| flagellar biosynthetic protein flhb [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312179806|gb|ADQ39976.1| flagellar biosynthetic protein FlhB [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 366

 Score =  330 bits (846), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 101/344 (29%), Positives = 187/344 (54%), Gaps = 1/344 (0%)

Query: 10  KTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLASA 69
           KTE  + +K ++A   G    SRE +   ++L  +++L F +S  +  +        ++ 
Sbjct: 16  KTEKATPRKRQEARKRGMVAKSREVTSAFALLISVLFLKFAYSSIVEPLQQGSKYFFSNL 75

Query: 70  TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKR 129
               LED+     LL+ +  ++ ++++P  L  M+        Q   ++    +K SF++
Sbjct: 76  -NYNLEDVRDASRLLSFIITTSLKVILPFCLTIMLVAAIVEWAQSSFLITGQSLKMSFQK 134

Query: 130 VSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAF 189
           ++  EG KRI+SIN++V  +KS +K++++G             +L+    N  +I+  +F
Sbjct: 135 INPIEGFKRIFSINSVVELIKSILKVLIIGYTGYSYTQSFAKKLLEMYEMNVLTIVKFSF 194

Query: 190 FTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKSI 249
            +   +++ + +    + V+D  +   Q+  KL M+K+E+K+E KQ+ GNP IK++ +  
Sbjct: 195 DSAINLILWMSVMFFGIAVIDFIFQRQQYEKKLMMTKEEVKEEFKQTEGNPQIKSKIRER 254

Query: 250 ARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYE 309
            R     +M +   +A ++ITNPTHYA+AL Y   + DAP ++AKG++ IA K+++ A +
Sbjct: 255 QRRISLQRMFQQLPKADVVITNPTHYAVALLYEPEKFDAPRVIAKGKDYIALKIKQEAIK 314

Query: 310 HNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           H I I E   LAR+L+    I   IPP  Y+AVA+++  +Y  K
Sbjct: 315 HRIEIVENRELARALYNMCEIGDFIPPELYQAVAEVLAYVYSLK 358


>gi|225849160|ref|YP_002729324.1| flagellar biosynthetic protein FlhB [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225644259|gb|ACN99309.1| flagellar biosynthetic protein FlhB [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 352

 Score =  330 bits (846), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 91/344 (26%), Positives = 177/344 (51%), Gaps = 2/344 (0%)

Query: 10  KTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLASA 69
           KTE  + K+ + A  EG    S + ++  S+    + ++F+       +        ++ 
Sbjct: 7   KTEKATPKRRQKAREEGQVLKSTDVAVALSLFVVFLVMIFYIPFLYKYLLGYFKYTFSNP 66

Query: 70  TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKR 129
                E+       +       + L++P + +  + GI + + Q   +  L  + P   +
Sbjct: 67  FYLIPEESGK--NFIWFTFKVLAILILPFVSILFIVGIVANVAQFGFLFTLKPLTPKLSK 124

Query: 130 VSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAF 189
           ++   G++R++S++ L   +KS +K+ L   +    ++      L +++AN +S +Y   
Sbjct: 125 INPISGLQRLFSLSTLFELVKSILKLSLALFVSYFLVSYLLDGFLVYMTANINSQIYILA 184

Query: 190 FTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKSI 249
            T+  +++        + + D  +  +++   LKM+K E+K+E K   GNPI+K   +  
Sbjct: 185 KTIIILIMAFTFLSIPIAIADFFYRRYEYEENLKMTKDEVKEERKSYEGNPIVKKEIRKR 244

Query: 250 ARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYE 309
            R     +M+    +A ++ITNP HYA+AL+Y + +  AP ++AKGQ+LIA K++++A E
Sbjct: 245 MRQLALKRMIAEVPKADVVITNPDHYAVALKYEKGKMKAPQVIAKGQDLIALKIKEVAKE 304

Query: 310 HNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           HN+ I E+P LARSL+    +   IP  FY+AVA+++  IY +K
Sbjct: 305 HNVKIVEDPPLARSLYSSCEVGDYIPEDFYEAVAKILAVIYKQK 348


>gi|52842013|ref|YP_095812.1| flagellar biosynthesis protein FlhB [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52629124|gb|AAU27865.1| flagellar biosynthetic protein FlhB [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 383

 Score =  329 bits (845), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 98/353 (27%), Positives = 186/353 (52%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++ +    KTE PSSK+++++  +G    S++ +    +L   +    F       + S
Sbjct: 2   MADEEQSQEKTEQPSSKRLKESRKKGQVARSKDFNATVILLFTGLGFFIFGKQLSLQIAS 61

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +        +  L   ++ +  L  L+ S    V+P LL+  +  + + L+    V + 
Sbjct: 62  IMQQAFD-FDRDILVTGNNSLENLFQLTKSGLWSVVPLLLVIFILSLLAPLLMGGWVFSG 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P F R+++ +G+KR+ S+   V  +K+F+K +LV +   + L      +L+   A 
Sbjct: 121 QSIQPKFSRLNVLKGLKRMISLKGFVEMLKAFLKFVLVASASILVLRSQVPLLLELGKAP 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               +      + K  ++I   +  +  +D+ +  ++    +KM+KQE+KDE K++ G P
Sbjct: 181 LEIAITSGVMILLKSFVLISASLILIAAIDVPFQLYEHSKSIKMTKQELKDEYKETEGKP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K+  +   +   R +MM    +A +I+TNPTHYA+AL Y +    APV++AKG+NL+A
Sbjct: 241 EVKSAIRRAQQETARRRMMSEVPKADVILTNPTHYAVALSYQKKGKKAPVVIAKGKNLVA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++ K+A EH IPI   P+LAR+++    +N+ IP   Y AVAQ++  I+  +
Sbjct: 301 FQISKVAKEHKIPIISVPALARAIYFSTKLNAEIPRGLYVAVAQVLAYIFQLR 353


>gi|157363487|ref|YP_001470254.1| flagellar biosynthetic protein FlhB [Thermotoga lettingae TMO]
 gi|157314091|gb|ABV33190.1| flagellar biosynthetic protein FlhB [Thermotoga lettingae TMO]
          Length = 376

 Score =  329 bits (845), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 93/345 (26%), Positives = 176/345 (51%), Gaps = 3/345 (0%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
            KTE P+ ++   A  EG    S E ++  + L  +  + F F   I  + +   +  + 
Sbjct: 35  EKTEKPTPRRRRKAREEGQVATSNELNMAVTFLVAVFVMRFIFQRLIMFLENGSILFFSL 94

Query: 69  ATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFK 128
                L ++S     +         L++   L  ++  I +  +Q   +L+   +K   K
Sbjct: 95  EENDFLNNLSG---RIYQSFKDTIFLLVLLFLSLIISVIFAGAMQTKFLLSFKPLKMDLK 151

Query: 129 RVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHA 188
           R++  EG KR +S+ +L   +KS +K+++VG +    +  N+     +        L   
Sbjct: 152 RINPVEGFKRFFSMRSLFELLKSILKMVIVGFVAYSVIRSNWILFRFYSDMETVDSLKLI 211

Query: 189 FFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKS 248
           F    +V++   + +  L ++D  +   ++   ++M+KQEIK+E ++  G+P ++ RQ+ 
Sbjct: 212 FNLTYEVMLKCAIALFILAIVDYFYQRWEFEKSIRMTKQEIKEEYREIEGSPEVRRRQRE 271

Query: 249 IARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAY 308
           I     R +M++    A ++ITNP+H A+A+ Y   E +APV++AKG + IA+K+ +IA 
Sbjct: 272 IMARLARGRMLQQVPEADVVITNPSHIAVAIEYKSEEMEAPVVLAKGADEIAQKIIQIAK 331

Query: 309 EHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           E+NIP+   P +AR L+K   I   IPP  Y+AVA+++  +Y  +
Sbjct: 332 ENNIPVVRNPQVARELYKTTDIGEQIPPNMYRAVAEILAYVYSLR 376


>gi|118475475|ref|YP_891544.1| flagellar biosynthesis protein FlhB [Campylobacter fetus subsp.
           fetus 82-40]
 gi|118414701|gb|ABK83121.1| flagellar biosynthetic protein FlhB [Campylobacter fetus subsp.
           fetus 82-40]
          Length = 357

 Score =  329 bits (845), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 99/350 (28%), Positives = 178/350 (50%), Gaps = 5/350 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+       K E P+ KK+EDA N+GN   S++ S F ++L     L+         + +
Sbjct: 1   MA---DDQEKIEEPTGKKLEDARNKGNVAKSQDVSGFVTLLVGFAVLVGLMGFMGERLVN 57

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
                          ++     +  H  L    +++P  +  M+ GI S ++Q   +  +
Sbjct: 58  LYLYYQGLIGVEITREL--FFKITIHSMLQTFLIILPIAICIMIAGIISNIMQFGFLFTV 115

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P+F ++   +GI  ++S+  L++ +K  +K+  V  +      +    +   I  +
Sbjct: 116 EPIMPNFSKIDPIKGIANLFSLKKLIDAVKIILKVSAVFGVAFYFFLQFVKELPHTIFFS 175

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             + L      +  +  ++LL    + + D+    +Q++  L+MSKQE+KDE KQ  G+P
Sbjct: 176 MFNQLLWLKEKMLILAGVMLLLFLIIAIADVFIVRYQYFKGLRMSKQEVKDEFKQMEGDP 235

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + +     R +MM+    A ++ITNPTHYA+ALRY + +  APV++AKG + +A
Sbjct: 236 KVKGRIRQLQMQAARKRMMQNIPTADVVITNPTHYAVALRYDKEKEKAPVVLAKGVDHLA 295

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
            ++RKIA E+ I I E P LAR L+K   I+  IP   ++AVA+++  +Y
Sbjct: 296 LRIRKIATENGIQIVENPPLARELYKLCDIDDQIPGNLFQAVAEVLSFVY 345


>gi|225850260|ref|YP_002730494.1| flagellar biosynthetic protein FlhB [Persephonella marina EX-H1]
 gi|225645107|gb|ACO03293.1| flagellar biosynthetic protein FlhB [Persephonella marina EX-H1]
          Length = 349

 Score =  329 bits (845), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 89/353 (25%), Positives = 175/353 (49%), Gaps = 6/353 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++ +   KTE  + ++ + A  EG    S++  + +S+L   + +  +       +T 
Sbjct: 1   MAKDPS---KTEKATPRRRQKAREEGQVARSQDIPIAASLLIVAVMMFAYIPFSYNILTE 57

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
             H   ++               +       + LV+P  L+ +  G+ S ++Q   +L+ 
Sbjct: 58  YFHHTFSNPFHLI---PDLNRGFIYESVKVLAILVLPFFLILLAIGVFSNVVQFGFLLSG 114

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   R++   G+ RI+S+  L   +++ +K++    +    L +      +     
Sbjct: 115 KALVPKIDRLNPVSGLGRIFSMKTLFELVRNLLKLLFASVVAYFLLMKIISESFNMSYLP 174

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            +  +Y  F  +  +++   +    + ++D  +   +    +KMSK EIK+E K   GNP
Sbjct: 175 LNHEIYFLFKYIIMLILAFAVISIPIAIIDFIYRKWEHEENIKMSKHEIKEERKMYEGNP 234

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K   +   R     +MM    +A ++ITNP HYA+AL+Y + +  AP ++AKG+N IA
Sbjct: 235 HVKAAIRKKQREIAMMRMMAELPKADVVITNPEHYAVALKYEKGKMAAPKVIAKGKNHIA 294

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +K+++IA +++IP+ E+P LARSL+    I   IP   Y A+A+++ KIY +K
Sbjct: 295 QKIKEIAKKYDIPVVEDPPLARSLYSSCEIGDMIPENLYVAIAKILAKIYRRK 347


>gi|170722841|ref|YP_001750529.1| flagellar biosynthesis protein FlhB [Pseudomonas putida W619]
 gi|169760844|gb|ACA74160.1| flagellar biosynthetic protein FlhB [Pseudomonas putida W619]
          Length = 380

 Score =  329 bits (844), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 105/354 (29%), Positives = 181/354 (51%), Gaps = 2/354 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+++  +KTE P+ K+  DA  +G    S+E +  +  LA    LL F      ++  
Sbjct: 1   MAESESGQDKTEDPTDKRKRDAREKGEIARSKELNTVAVTLAGAGGLLAFGGHLAETLLE 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            + +   S T+  + D   +   L      A   V P L+L  +    + +     + + 
Sbjct: 61  MMRLNF-SLTREVIVDEGAMGAFLLASGKMAIWAVQPVLILLFVVAFIAPIALGGFLFSG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + ++P F R++   GIKR++S+N L   +K+  K I++  +  + L  +   +L   +  
Sbjct: 120 SLLQPKFSRMNPLAGIKRMFSMNALTELLKAVAKFIVILVVALVVLANDRQALLAIANEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V    + +   +  +   D+ +   Q + KLKM+KQE+KDE K S G P
Sbjct: 180 LDQAIIHSVQVVGWSALWMSAGLLLIAAADVPFQLWQTHKKLKMTKQEVKDEYKDSEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEND-APVLVAKGQNLI 299
            +K R + + R   + +MM A   A +IITNPTHYA+AL+Y   +   AP+L+AKG + I
Sbjct: 240 EVKQRIRQLQREVSQRRMMAAVPDADVIITNPTHYAVALQYDPEKGGVAPLLLAKGTDFI 299

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A K+R+I  EH + I E P+LAR+++    I   IP   Y AVAQ++  ++  +
Sbjct: 300 ALKIREIGVEHKVQILESPALARAIYYSTEIEQEIPAGLYLAVAQVLAYVFQIR 353


>gi|226944866|ref|YP_002799939.1| flagellar biosynthetic protein [Azotobacter vinelandii DJ]
 gi|226719793|gb|ACO78964.1| flagellar biosynthetic protein [Azotobacter vinelandii DJ]
          Length = 402

 Score =  329 bits (844), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 98/353 (27%), Positives = 173/353 (49%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++  +   KTEA S +++E A  EG    SRE + F  +LA +  L          +  
Sbjct: 17  MADESSDQEKTEAASPRRLEKAREEGQVARSRELTTFLLLLAGIAALWSMGGLLHERLAE 76

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L    + +  D + ++     L       ++P  LL  +  + +  +    +++ 
Sbjct: 77  VMEQALL-FERAQAFDSARMLARFWELGEGTLFTLLPLFLLMAVVALVAPSLLGGLLVSA 135

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P   R++  +G+KR++S   L    K+  K ILVG I    L +    ++      
Sbjct: 136 KALQPQLARLNPLKGLKRVFSTQALAELGKAVAKSILVGWIAVFFLRKYIDELMALSGMP 195

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               L  A   +     MI+L +  +  LD+ +       KL+MSK+E++ E K+S G+P
Sbjct: 196 IREALADAMRLMALASAMIVLGLILVVALDVPYQLWSHARKLRMSKEELRQEHKESEGDP 255

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +S  ++  R +MM     A +I+TNPTHYA+AL Y   +  AP +VAKG + +A
Sbjct: 256 HVKGRIRSQQQAMARSRMMSKVPTADVIVTNPTHYAVALSYRDGQMGAPRVVAKGADALA 315

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++  EH +P+ E   LAR+L+  V ++  IP   Y AVA+++   Y  +
Sbjct: 316 ARIRELGGEHAVPLLEAAPLARALYYHVDLDREIPVELYTAVAEVLAWAYRLR 368


>gi|222530120|ref|YP_002574002.1| flagellar biosynthetic protein FlhB [Caldicellulosiruptor bescii
           DSM 6725]
 gi|222456967|gb|ACM61229.1| flagellar biosynthetic protein FlhB [Caldicellulosiruptor bescii
           DSM 6725]
          Length = 366

 Score =  329 bits (844), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 103/344 (29%), Positives = 189/344 (54%), Gaps = 1/344 (0%)

Query: 10  KTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLASA 69
           KTE  + +K ++A   G    SRE +   ++L  +++L F +S  I  +        ++ 
Sbjct: 16  KTEKATPRKRQEARKRGMVAKSREVTSAFALLISVLFLKFGYSLIIVPLQQGSKYFFSNL 75

Query: 70  TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKR 129
               LEDIS    LL+ +  ++ ++V+P  +  M   +     Q   ++    +K SF++
Sbjct: 76  -NYSLEDISDASKLLSFIITTSLKIVLPFCVTIMFVAVIVEWAQSSFLITGQSLKMSFQK 134

Query: 130 VSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAF 189
           ++  EG KRI+SIN++V  +KS +K++++G             +L+    N  +I+  +F
Sbjct: 135 INPIEGFKRIFSINSVVELIKSVLKVLIIGYTGYFYTQTFAKKLLEMYEMNVFTIVRFSF 194

Query: 190 FTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKSI 249
            +   +++ + +    + V+D  +   Q+  KL M+K+E+K+E KQ+ GNP IK++ +  
Sbjct: 195 GSAINLILWMAVMFFGIAVIDFIFQRQQYEKKLMMTKEEVKEEFKQTEGNPQIKSKIREK 254

Query: 250 ARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYE 309
            R     +M +   +A ++ITNPTHYA+AL Y   + DAP ++AKG++ IA+K+++ A +
Sbjct: 255 QRRISLQRMFQQLPKADVVITNPTHYAVALLYEPEKFDAPRVIAKGKDYIAQKIKQEAIK 314

Query: 310 HNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           H I I E   LAR+L+    +   IPP  Y+AVA+++  +Y  K
Sbjct: 315 HRIEIVENRELARALYNMCEVGDFIPPELYQAVAEVLAYVYSLK 358


>gi|160902843|ref|YP_001568424.1| flagellar biosynthetic protein FlhB [Petrotoga mobilis SJ95]
 gi|160360487|gb|ABX32101.1| flagellar biosynthetic protein FlhB [Petrotoga mobilis SJ95]
          Length = 363

 Score =  329 bits (844), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 98/344 (28%), Positives = 185/344 (53%), Gaps = 3/344 (0%)

Query: 9   NKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLAS 68
           +KTE P+ +++E A  EGN P S E ++  S L+  ++L   F P +  +    +  L+ 
Sbjct: 21  DKTEDPTPRRLEKAREEGNIPQSNEFNMAVSFLSISLFLWIIFEPLLNDIFKVFYDYLSL 80

Query: 69  ATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFK 128
                    + ++       ++    +I   ++ ++      +IQ   +     +K    
Sbjct: 81  DLD---YSPTDLLGYEITAHMNLYIKLILFFVVAVVVSTLLGMIQTKFLFTFKSLKLDLS 137

Query: 129 RVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHA 188
           +++  +G KR++S+ ++V  +K+ +K+ ++G +    +  N+F +L              
Sbjct: 138 KINPIKGFKRLFSLRSVVELIKALLKLTILGLLTYNIIKSNWFKILSLAGEETGFSFNVI 197

Query: 189 FFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKS 248
           F  V  +L  + + +  L++ D  +  +++  +LKMSK E+K E K+  GNP IK RQ+ 
Sbjct: 198 FDLVINILFQLGIVLLLLSLFDFWYQRYEYKKELKMSKYEVKQERKEIEGNPEIKQRQRE 257

Query: 249 IARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAY 308
           + R+  R +MM+    A ++ITNPTHYA+A+ Y   E  AP++VAKG++ +A K+R+IA+
Sbjct: 258 LMRNLARSRMMQKVPEADVVITNPTHYAVAIEYKAEEMQAPIVVAKGKDEVAFKIREIAF 317

Query: 309 EHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
           +H IPI E P+LAR ++++V +N  IP   Y  VA+++  +Y  
Sbjct: 318 KHGIPILERPALAREIYEKVELNEEIPEDLYTLVAEVLAYVYKL 361


>gi|266621912|ref|ZP_06114847.1| flagellar biosynthetic protein FlhB [Clostridium hathewayi DSM
           13479]
 gi|288866385|gb|EFC98683.1| flagellar biosynthetic protein FlhB [Clostridium hathewayi DSM
           13479]
          Length = 355

 Score =  329 bits (844), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 89/346 (25%), Positives = 163/346 (47%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
           D KTE  + K+ +D   +GN   S +     S+L     L         ++ + + +  +
Sbjct: 6   DEKTEKATPKRRQDERKKGNVFQSSDVIAVCSLLVLFNSLNALAPMIYRTLKASMELFFS 65

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
            A   +      +   L        +  +P L + +   + +   Q     + + +K   
Sbjct: 66  YAASTEPLTAEDLPDKLLKAMFLFGQAALPLLFIGVAVAVVTTFFQTRLSFSADVMKFKM 125

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
            R+SL +G KR++SI ++V  +K+ +KI ++  +I   +          +     +   +
Sbjct: 126 DRISLLKGFKRMFSIRSVVELLKAMIKITILAWVIYSYIKGRIHEFARLMDGTVQAAFVY 185

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
              T   ++  +      L   D  + + ++   L+MSKQEIKDE KQ+ G+P IK R +
Sbjct: 186 VGDTAVSLVNTVGAAFIFLAAFDYLYQWWEYEKNLRMSKQEIKDEYKQTEGDPQIKGRIR 245

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              R     +MM+   +A +II NPTH+A+AL Y    N APV++AKG + +A K+ ++ 
Sbjct: 246 EKQRQMASMRMMQNVPKADVIIRNPTHFAVALGYDSNTNRAPVVLAKGADHLALKIVEVG 305

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
             + + I E+  LAR L+  V ++  IP  FY+ VA+++  +Y  K
Sbjct: 306 EANGVYIMEDKPLARGLYASVEVDMEIPEEFYQTVAKVLAFVYKLK 351


>gi|329849682|ref|ZP_08264528.1| flagellar biosynthetic protein FlhB [Asticcacaulis biprosthecum
           C19]
 gi|328841593|gb|EGF91163.1| flagellar biosynthetic protein FlhB [Asticcacaulis biprosthecum
           C19]
          Length = 358

 Score =  329 bits (843), Expect = 5e-88,   Method: Composition-based stats.
 Identities = 106/354 (29%), Positives = 186/354 (52%), Gaps = 1/354 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E    ++KTE  S+KK+  A  +G+   S +     S++     +  +       +  
Sbjct: 1   MAEEPDSEDKTEEASAKKLSQAREKGDVAKSADLPQALSLIGACAVIALYGPSLSSDLVD 60

Query: 61  DLHVLLASATQRKLE-DISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLN 119
           DL   LA   Q     +    V ++  +  +   +VI  + + ++ GIG +++Q   +  
Sbjct: 61  DLIPFLAHPQQLLGSLEGDGGVTIMREMVFAFLPIVIIVMGVTLLLGIGGHVMQTGLMFT 120

Query: 120 LNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISA 179
              +KPS  +++   G KR++  + L+ F K+ VK+I+ G I+   L    + ++    A
Sbjct: 121 TEKLKPSLTKLNPMSGFKRLFGFDALIQFAKTVVKLIITGAIVWQVLKGKLYEIMALAKA 180

Query: 180 NPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
           +P  IL +A      + I + +F+      D  W   ++  ++KMSKQE K+E KQ  G+
Sbjct: 181 SPLLILPYAMDVFVALAIAVCIFLFIEGAADYMWQRFRFMQRMKMSKQEQKEEYKQMEGD 240

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLI 299
           P IK + + I   + R +MM     AT++ITNPTHYA+AL++   +  AP+ VAKG + +
Sbjct: 241 PHIKAKLRQIRMEKSRRRMMSNVKDATVVITNPTHYAVALQFEMGQMQAPLCVAKGVDTL 300

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A K+R+ A +HN+PI E+  LAR+L+  + ++  IP   + AVAQ+I  +  KK
Sbjct: 301 ALKIREEAGKHNVPIVEDVPLARALYAAIDVDETIPEEHFAAVAQVISFVLAKK 354


>gi|229918645|ref|YP_002887291.1| flagellar biosynthesis protein FlhB [Exiguobacterium sp. AT1b]
 gi|229470074|gb|ACQ71846.1| flagellar biosynthetic protein FlhB [Exiguobacterium sp. AT1b]
          Length = 364

 Score =  329 bits (843), Expect = 5e-88,   Method: Composition-based stats.
 Identities = 95/346 (27%), Positives = 177/346 (51%), Gaps = 1/346 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE  + +K ED+  +G    S + +   ++ A  + L FF       + + +  LL 
Sbjct: 17  GEKTEKATPRKREDSRKKGQVAKSADLTGAFALFAMFLMLSFFGPVIGQQLLTLISDLL- 75

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
           S           +  ++  L L    ++ P  ++ ++FGI    +Q   + +L  ++P  
Sbjct: 76  SPEYLLFNVTGGMSDMVVDLMLRVGLILAPFFIVAVVFGILINYLQIGTLFSLEAIQPKL 135

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
           +R+   +G+KRI S+  +V F+KS  K++++ T     L +N   +           +  
Sbjct: 136 ERIDPIKGVKRIVSMKAVVEFLKSLFKLLIILTTAVAVLWKNQKELSRMAVEQVRESIVA 195

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
                 ++ + + + +  L  LD  +    +   ++MSKQ+IKDE K + G+P+IK++ K
Sbjct: 196 LASITIELGLWVSVALLALAFLDFFYQRFDFEKSIRMSKQDIKDEYKNTEGDPLIKSKIK 255

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              R     +MM+    A ++ITNPTHYA+ +RY  T++ AP++VAKG + +A  +R +A
Sbjct: 256 QQQREMAMRRMMQEIPNADVVITNPTHYAVVIRYDDTKDFAPLVVAKGVDRVAFHIRDVA 315

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            EH++ I E   LAR+L+ Q+ I   +   FY+A+A+++  +Y  K
Sbjct: 316 KEHDVAIVENKPLARALYAQIDIGEVVDESFYQAIAEVLAFVYQMK 361


>gi|328545474|ref|YP_004305583.1| flagellar biosynthetic protein FlhB [polymorphum gilvum
           SL003B-26A1]
 gi|326415215|gb|ADZ72278.1| Flagellar biosynthetic protein FlhB [Polymorphum gilvum
           SL003B-26A1]
          Length = 358

 Score =  329 bits (843), Expect = 5e-88,   Method: Composition-based stats.
 Identities = 128/354 (36%), Positives = 208/354 (58%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS+    + KTE P+ KKI DA+ +GN P S+EAS+ ++ LA L+   F    G   + S
Sbjct: 1   MSDQPDKETKTEEPTEKKIRDAIEKGNTPTSKEASVLATFLAILLIGSFATVTGARRLVS 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  L+  A    L + +  + L   L+L A R + P +    + G+ +   Q  P +  
Sbjct: 61  GLSGLIDDAGGFTLGNGADALLLTHALALEAGRFLAPIVATLAVAGLAAAWFQNAPRIVG 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + +KP   R+SL +G +R++ I   V F K+ +K   +  I  + L  N   +++ + ++
Sbjct: 121 HRIKPDPSRLSLLKGWQRLFGIQGAVEFGKALLKFGAISLIALLLLRANEAGLVNAMFSD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P ++         ++L  I +    L   D+ W+   W   L+M++QEIKDE KQ+ G+P
Sbjct: 181 PSALPETILHLAMRLLSGICIATIVLVAFDLVWARVHWRQNLRMTRQEIKDEHKQTEGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           ++K RQ+S+AR R R++MM A  +AT++I NPTH+A+ALRY + E  AP++VAKGQ+LIA
Sbjct: 241 LVKARQRSLARDRARNRMMAAVPKATLVIANPTHFAVALRYDRDETAAPIVVAKGQDLIA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKKI 354
            K+R+IA +++IP+ E   LARSL+    I+  IPP FY+ VA++I  +Y +K+
Sbjct: 301 LKIRQIAEDNDIPVIENRELARSLYASTEIDRMIPPQFYRMVAEVICYVYSRKM 354


>gi|255099431|ref|ZP_05328408.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile QCD-63q42]
          Length = 516

 Score =  329 bits (843), Expect = 5e-88,   Method: Composition-based stats.
 Identities = 101/348 (29%), Positives = 185/348 (53%), Gaps = 1/348 (0%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
              +KTE  + KK  +   +GN   SRE  +  ++LA  + +   FS  + ++ S L+  
Sbjct: 162 GSADKTEEATPKKKGEQRKKGNIAKSRELPVAMTLLAFTLLVPTLFSYVVDTLKSSLNYF 221

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           L+      + + S++  L+    +   ++ +P  + F++ GI + L Q   +     +KP
Sbjct: 222 LSLDFYMNI-NYSNLEKLVIAGLMDFFKIFLPIAIPFLVLGIIANLFQVGILFTGETLKP 280

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
           +  +++   G K ++S+ +L   +K    I ++  I      +NY  +L   +    +++
Sbjct: 281 NLSKLNPISGFKNMFSMRSLSTLIKDTAIISILAYIGYTFFQDNYLDILKLGNIYLPTLM 340

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
           Y     V  +L  I + +  + V D  +  +    +L+M+KQE+KDE K S G+P +K +
Sbjct: 341 YTVKDLVYSILSKICVAMIAIAVADYVYQRYSHKKQLRMTKQEVKDEYKNSEGDPEVKAK 400

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
            K   R     + M+A   AT+I+TNPTH ++A+RY + ++ APV+VAKG + +A K+R+
Sbjct: 401 IKQKQRQISSQRTMQAVPSATVIVTNPTHLSIAVRYEKGKDQAPVVVAKGADYLAFKIRE 460

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           IA  ++IPI E   +AR L+KQV I+  IP   Y+A A+++  +Y  K
Sbjct: 461 IAKGNDIPIIENKPIARLLYKQVEIDQEIPEDMYQAFAEILVAVYKIK 508


>gi|87119470|ref|ZP_01075367.1| flagellar biosynthetic protein FlhB [Marinomonas sp. MED121]
 gi|86164946|gb|EAQ66214.1| flagellar biosynthetic protein FlhB [Marinomonas sp. MED121]
          Length = 380

 Score =  329 bits (843), Expect = 6e-88,   Method: Composition-based stats.
 Identities = 109/353 (30%), Positives = 180/353 (50%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+    KTE  SSKK+++A N+GN P S++ S    +L     L    S     +++
Sbjct: 1   MAENEDGAEKTEDASSKKLDEARNKGNLPRSKDLSSALLLLIAAASLYATGSLLAQDMSN 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
                    ++  + D + +V  L+  S+S    ++  +++  + GI   +       + 
Sbjct: 61  VFQFNFV-LSRADMFDTAKMVIHLSDSSISMMDSLLVMMIVLAIAGIVGSVALGGFNFSW 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   +++   GIKR++S+N+LV  +KS  K+ LV  +    L      ML     +
Sbjct: 120 EPLIPKLSKMNPISGIKRMFSVNSLVELLKSIAKVSLVLVVAFFVLKIYLPEMLLVPFQS 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               L HA   V    I + L +  +  +D+ +       KLKM+KQE KDE K + G+P
Sbjct: 180 LELALGHAINVVIWAFIYVSLAVLLIAAVDVPYQAWSHKDKLKMTKQETKDEYKNAEGDP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R +   R     +MME    A +IITNPTH+++AL+Y      AP L+AKG + +A
Sbjct: 240 QIKARIRQAQRQASMRRMMEDVPNADVIITNPTHFSVALKYEAGVKGAPKLLAKGNDFVA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+I   HNIP+ + P+LARS++    I   IP   +++VAQ++  +Y  K
Sbjct: 300 LKIREIGTFHNIPVVQSPALARSIYHYTEIGEEIPTGLFQSVAQILAYVYQLK 352


>gi|294339803|emb|CAZ88166.1| Flagellar biosynthetic protein FlhB [Thiomonas sp. 3As]
          Length = 373

 Score =  329 bits (843), Expect = 6e-88,   Method: Composition-based stats.
 Identities = 95/353 (26%), Positives = 175/353 (49%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   K    S K+ + A  +G    SR+ +  S +L  +  +++      Y +  
Sbjct: 1   MAE-DSAQEKELPASQKRKQQAREKGQVARSRDLTS-SLLLLGMAAVVYTAGGWFYDMGR 58

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           +L     + +    +D + ++     + +    ++ P L L  +      +     V + 
Sbjct: 59  ELLQTGLTVSASASQDPAAMLQAAGRVLVLGLIVLAPVLALTFVASAAGGVAMGGWVFST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R+   +GI R++SI  L    K+ +K I++  I  I +      +L  +   
Sbjct: 119 EALAPDFSRLDPVKGIGRMFSITGLGELGKALLKAIVIAVIAGIVIWNERGELLGLLQVE 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P            +  + +      +  +D+ W   Q   KLKMS+Q+++DE+++S GNP
Sbjct: 179 PQLAQMQLGQITARAFLWMASGTLLVAAVDVPWQLFQMNKKLKMSRQDLQDEMRESEGNP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK + + + R R R +MM A  +A +++TNPTHYA+AL Y + +N APV++A G + +A
Sbjct: 239 QIKQKMRELQRERARKRMMAAVPKADVVVTNPTHYAVALAYKEGKNRAPVVLALGADRVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EHN+P+ E P LAR+L+    +   IP   Y AVA L+  ++  +
Sbjct: 299 ARIREVAAEHNVPVIEAPPLARALYHHAELEQEIPVALYNAVALLLAYVFQLR 351


>gi|319787087|ref|YP_004146562.1| flagellar biosynthetic protein FlhB [Pseudoxanthomonas suwonensis
           11-1]
 gi|317465599|gb|ADV27331.1| flagellar biosynthetic protein FlhB [Pseudoxanthomonas suwonensis
           11-1]
          Length = 379

 Score =  328 bits (842), Expect = 6e-88,   Method: Composition-based stats.
 Identities = 90/353 (25%), Positives = 168/353 (47%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+EN+    KTE P+ ++ E A+ +GN P SRE S    +    +  +           S
Sbjct: 1   MAENEDGQEKTEQPTGRRREKAIKQGNLPRSRELSNA-VLFGSGVVAMMAGGSMFARGAS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
                  +     LE    +   +  L L    +++P + + +     +  +        
Sbjct: 60  GWFRQALTPDLVMLESPGELFGYMGILLLRLVLVMLPLIGVALAACFVAPGLMGGFHFTT 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             ++P  +R++   G+KRI+S   LV   KS +++ L+     + L   +  +      +
Sbjct: 120 ESLQPKPERLNPLAGLKRIFSSEGLVEVAKSLLRVALLVIACGLVLVHGFDVLKAMPGQS 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
                        ++L    + +  L + D  +    W  KLKM++QE+++E+K++ GNP
Sbjct: 180 LEDAASTGLHFAGRLLGAAAVALVLLALADAPYQKWNWTRKLKMTRQEVREEMKETDGNP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + + +     + +MMEA   A +++ NPTHYA+AL+Y      AP +VAKG + +A
Sbjct: 240 QVKGKIRQMQFQMSQRRMMEAVPTADVVVVNPTHYAVALKYEGGTMRAPKVVAKGVDEMA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A +H I     P LAR+L+++  I+  IP   Y AVAQ++  +Y  +
Sbjct: 300 MRIREVADQHRIATVSAPPLARALYREGEIDKEIPVRLYAAVAQVLSYVYQLR 352


>gi|320177760|gb|EFW52748.1| Flagellar biosynthesis protein FlhB [Shigella boydii ATCC 9905]
          Length = 383

 Score =  328 bits (842), Expect = 7e-88,   Method: Composition-based stats.
 Identities = 95/335 (28%), Positives = 177/335 (52%), Gaps = 1/335 (0%)

Query: 19  IEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLASATQRKLEDIS 78
           +E A  EG  P SRE +    +L  +  + F        ++  L   L       + D +
Sbjct: 18  LEKAREEGQIPRSRELTSLLILLVGVCVIWFGGVSLARRLSGMLSAGL-HFDHSIINDPN 76

Query: 79  HIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKRVSLREGIKR 138
            I+  +  L   A   ++P +   ++  + S ++    V +   ++P F +++   GIKR
Sbjct: 77  LILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSGKSLQPKFSKLNPLPGIKR 136

Query: 139 IYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAFFTVRKVLIM 198
           ++S       +K+ +K ILVG++    L  ++  M+  ++ +P + + +A   V    ++
Sbjct: 137 MFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPITAMGNAMDLVGLCALL 196

Query: 199 ILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKM 258
           ++L +  +   D+ +       KL+MS+Q+I+DE KQS G+P +K R + + R+  R +M
Sbjct: 197 VVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVKGRIRQMQRAAARRRM 256

Query: 259 MEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEP 318
           M    +A +I+ NPTHY++AL+Y + +  AP +VAKG  L+A ++R+I  E+N+P  E P
Sbjct: 257 MADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRIREIGAENNVPTLEAP 316

Query: 319 SLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            LAR+L++   I   IP   Y AVA+++  ++  K
Sbjct: 317 PLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLK 351


>gi|26991041|ref|NP_746466.1| flagellar biosynthesis protein FlhB [Pseudomonas putida KT2440]
 gi|24986073|gb|AAN69930.1|AE016632_1 flagellar biosynthetic protein FlhB [Pseudomonas putida KT2440]
          Length = 380

 Score =  328 bits (842), Expect = 7e-88,   Method: Composition-based stats.
 Identities = 101/354 (28%), Positives = 183/354 (51%), Gaps = 2/354 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+++  +KTE P+ K+  DA  +G    S+E +  +  LA    LL F      ++ +
Sbjct: 1   MAESESGQDKTEDPTEKRKRDAREKGEVARSKELNTVAVTLAGAGGLLAFGGHVAETLLA 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            + +   S T+  + D   +   L      A   V P L+L  +    + +     + + 
Sbjct: 61  LMRMNF-SLTRDIIVDERAMGAFLLASGKMAIWAVQPVLILLFVVSFVAPIALSGFLFSG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + ++P F R++   GIKR++S+  L   +K+  K  ++  +  + L+ +   +L   +  
Sbjct: 120 SLLQPKFSRMNPLSGIKRMFSMQALTELLKALAKFFVILVVAVVVLSGDRQALLSIANEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V    + +   +  +   D+ +  +Q + K+KM+KQE++DE K S G P
Sbjct: 180 LEQAIIHSLQVVGWSALWMSAGLLLIAAADVPFQLYQTHKKMKMTKQEVRDEYKDSEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEND-APVLVAKGQNLI 299
            +K R + + R   + +MM A   A +IITNPTHYA+AL+Y   +   AP+L+AKG + +
Sbjct: 240 EVKQRIRQLQREVSQRRMMAAVPDADVIITNPTHYAVALQYDPEKGGAAPLLLAKGSDFM 299

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A K+R+I  EHNI I E P+LAR+++    +   IP   Y AVAQ++  ++  +
Sbjct: 300 ALKIREIGVEHNIQILESPALARAIYYSTELEQEIPAGLYLAVAQVLAYVFQIR 353


>gi|325273555|ref|ZP_08139785.1| flagellar biosynthesis protein FlhB [Pseudomonas sp. TJI-51]
 gi|324101315|gb|EGB98931.1| flagellar biosynthesis protein FlhB [Pseudomonas sp. TJI-51]
          Length = 380

 Score =  328 bits (842), Expect = 7e-88,   Method: Composition-based stats.
 Identities = 101/354 (28%), Positives = 183/354 (51%), Gaps = 2/354 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+++  +KTE P+ K+  D+  +G    S+E +  +  LA    LL F      ++ +
Sbjct: 1   MAESESGQDKTEDPTEKRKRDSREKGEVARSKELNTVAVTLAGAGGLLAFGGHLAETLLA 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            + +   S T+  + D   +   L      A   V P L+L  +    + +     + + 
Sbjct: 61  LMRMNF-SLTRDIIVDERAMGAFLLASGKMAIWAVQPVLILLFVISFVAPIALSGFLFSG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + ++P F R++   GIKR++S++ L   +K+  K  ++  +  + L  +   +L   +  
Sbjct: 120 SLLQPKFSRMNPLSGIKRMFSMHALTELLKALAKFFVILVVAVVVLINDRQALLSIANEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V    + +   +  +   D+ +  +Q + KLKM+KQE++DE K S G P
Sbjct: 180 LEQAIIHSLQVVGWSALWMSAGLLLIAAADVPFQLYQTHKKLKMTKQEVRDEYKDSEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEND-APVLVAKGQNLI 299
            +K R + + R   + +MM A  +A +IITNPTHYA+AL+Y   +   AP+L+AKG + I
Sbjct: 240 EVKQRIRQLQREVSQRRMMAAVPQADVIITNPTHYAVALQYDPEKGGVAPLLLAKGTDFI 299

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A K+R+I  EH + I E P+LAR+++    I   IP   Y AVAQ++  ++  +
Sbjct: 300 ALKIREIGVEHKVQILESPALARAIYYSTEIEQEIPAGLYLAVAQVLAYVFQIR 353


>gi|209963536|ref|YP_002296451.1| flagellar biosynthetic protein FlhB [Rhodospirillum centenum SW]
 gi|209957002|gb|ACI97638.1| flagellar biosynthetic protein FlhB [Rhodospirillum centenum SW]
          Length = 373

 Score =  328 bits (841), Expect = 8e-88,   Method: Composition-based stats.
 Identities = 109/349 (31%), Positives = 185/349 (53%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE      KTE P+ +K+++A  +G+ P+SRE S    +LA +I +    S     +T 
Sbjct: 1   MSERPEDSQKTEEPTQRKLDEARRKGDVPVSREVSSMMLVLAGVILVGGLGSWMGGHLTD 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           DL  L+ +     L+  +    LL  L+     +++P   + +   + + + Q   V   
Sbjct: 61  DLLPLVENPGDFPLQAPADAFRLLAWLAGEIGLVLLPAAAILLAAVLLAAVGQNGIVFTT 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +KP  +R+S   G++R+ S+  LV F+K   K+  VG  + + L      M      +
Sbjct: 121 ERLKPKLERISPIAGLRRLVSLRTLVEFLKGLAKVAAVGAALLVVLEPELHRMEALALTD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             ++       + ++L+  L+    + +LD+ W    W  + +M+ QE+K+E +Q+ G+P
Sbjct: 181 VAALPELLTSVLTRLLVATLIASIAIALLDLVWQQFSWRRQQRMTLQELKEEFRQAEGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R   + R R R +M     RAT++ITNPTH+A+ALRY  +E  APV +AKG +L+A
Sbjct: 241 HVKARISQLRRERARQRMFSDIPRATVVITNPTHFAVALRYDLSEAPAPVCLAKGMDLVA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKI 349
           +++R+ A  H +PI E P LAR+L K V I   + P  Y AVA++I  +
Sbjct: 301 RRIREAAMGHKVPIVENPPLARALHKSVEIGEEVQPEHYMAVAEVISYV 349


>gi|255021385|ref|ZP_05293433.1| Flagellar biosynthesis protein FlhB [Acidithiobacillus caldus ATCC
           51756]
 gi|254969248|gb|EET26762.1| Flagellar biosynthesis protein FlhB [Acidithiobacillus caldus ATCC
           51756]
          Length = 375

 Score =  328 bits (841), Expect = 8e-88,   Method: Composition-based stats.
 Identities = 108/354 (30%), Positives = 189/354 (53%), Gaps = 2/354 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  +   +TEA + KK EDA  +G  P SRE S  + +L     L    S      T 
Sbjct: 1   MAEEQS-QERTEAATPKKREDARKKGQVPRSRELSTSALLLLSASLLYGLGSEIQTMATD 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L   T   + +   ++  L  ++  A   V+P  L  M+  + + +       + 
Sbjct: 60  FLRAGLR-LTPAVMSNHQDLLRHLVQMAGLALSDVLPLWLALMLVVVLASIALGGWNFST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P+F  +   EGI+R++S    +  +K+ +K ++VG I    +      +L  I  +
Sbjct: 119 KTLIPNFSHLDPIEGIQRLFSRRGFLELVKAALKTLVVGGIGVTVIWAQRGELLGLIQIS 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P S +         V +++ +    + + D+ +    +  KLKMS+Q+IKDE+K+  GNP
Sbjct: 179 PKSAMVSLLSMSGLVFLIMAVGTLLIVLFDVPFQLWSFNEKLKMSRQDIKDEMKEMDGNP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK + +S+ R   R +MM A   A++++TNPTHYA+ALRY+++EN APV++AKG   +A
Sbjct: 239 QIKTKVRSMQREMARRRMMAAIPSASVVVTNPTHYAVALRYVESENRAPVVLAKGAGNVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKKI 354
            ++R++A EH +P+ E P LAR+L+  V +   IP + Y+AVA+++  ++  ++
Sbjct: 299 LRIRELAQEHGVPLVEAPPLARALYHHVELEQEIPALLYRAVAEVLAYLHQLRL 352


>gi|313497812|gb|ADR59178.1| FlhB [Pseudomonas putida BIRD-1]
          Length = 380

 Score =  328 bits (841), Expect = 8e-88,   Method: Composition-based stats.
 Identities = 101/354 (28%), Positives = 183/354 (51%), Gaps = 2/354 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+++  +KTE P+ K+  DA  +G    S+E +  +  LA    LL F      ++ +
Sbjct: 1   MAESESGQDKTEDPTEKRKRDAREKGEVARSKELNTVAVTLAGAGGLLAFGGHVAETLLA 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            + +   S T+  + D   +   L      A   V P L+L  +    + +     + + 
Sbjct: 61  LMRMNF-SLTRDIIVDERAMGAFLLASGKMAIWAVQPVLILLFVISFVAPIALSGFLFSG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + ++P F R++   GIKR++S+  L   +K+  K  ++  +  + L+ +   +L   +  
Sbjct: 120 SLLQPKFSRMNPLSGIKRMFSMQALTELLKALAKFFVILVVAVVVLSGDRQALLSIANEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V    + +   +  +   D+ +  +Q + K+KM+KQE++DE K S G P
Sbjct: 180 LEQAIIHSLQVVGWSALWMSAGLLLIAAADVPFQLYQTHKKMKMTKQEVRDEYKDSEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEND-APVLVAKGQNLI 299
            +K R + + R   + +MM A   A +IITNPTHYA+AL+Y   +   AP+L+AKG + +
Sbjct: 240 EVKQRIRQLQREVSQRRMMAAVPDADVIITNPTHYAVALQYDPEKGGAAPLLLAKGSDFM 299

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A K+R+I  EHNI I E P+LAR+++    +   IP   Y AVAQ++  ++  +
Sbjct: 300 ALKIREIGVEHNIQILESPALARAIYYSTELEQEIPAGLYLAVAQVLAYVFQIR 353


>gi|307546924|ref|YP_003899403.1| flagellar biosynthesis protein FlhB [Halomonas elongata DSM 2581]
 gi|307218948|emb|CBV44218.1| flagellar biosynthesis protein FlhB [Halomonas elongata DSM 2581]
          Length = 388

 Score =  328 bits (841), Expect = 9e-88,   Method: Composition-based stats.
 Identities = 95/354 (26%), Positives = 177/354 (50%), Gaps = 2/354 (0%)

Query: 1   MSENDAP-DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVT 59
           M+++ +  + KTE  + +++E A  EG    SRE + F  +LA ++ L          + 
Sbjct: 1   MADDSSSDEEKTEDATPRRLEKAREEGQVARSRELATFMLLLAGVLGLASLGGTLYDQIG 60

Query: 60  SDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLN 119
             +        +R+  + S ++     L       ++P  LL  +  + +  +    +++
Sbjct: 61  GVMEQAFL-FDRRQAMETSPMLAEALMLGRHTLISLLPLFLLLTVVALVAPALLGGWLIS 119

Query: 120 LNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISA 179
              +KP   +++  +G+KRI+    LV   K+  K +LVG++    L  +    +  +S 
Sbjct: 120 AKSLKPQASKLNPLKGLKRIFGTQALVELAKAIAKSVLVGSVGMAYLYLHRGEFMALMSQ 179

Query: 180 NPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
             H  L  A     +   +++L +  + ++D+ +       +L+M+K E+K E K+S G+
Sbjct: 180 PIHQALARAMGMAAEACGLMVLTLLVVILIDVPYQLWSHAKQLRMTKDEVKREHKESEGD 239

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLI 299
           P +K R +   ++  R +MM     A +IITNPTHYA+AL Y QT   AP +VAKG + +
Sbjct: 240 PQVKGRIRQQQQAMARGRMMSQVPEADVIITNPTHYAVALVYEQTGMAAPRVVAKGADAV 299

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A ++R++  E  +P+ E   LARSL+  V + + IP   Y AVA+++   +  K
Sbjct: 300 AARIRELGEEAGVPLLEAAPLARSLYHHVDLEAEIPAALYTAVAEVLAWAFGLK 353


>gi|126697834|ref|YP_001086731.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile 630]
 gi|115249271|emb|CAJ67084.1| Bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile]
          Length = 604

 Score =  328 bits (841), Expect = 9e-88,   Method: Composition-based stats.
 Identities = 101/348 (29%), Positives = 185/348 (53%), Gaps = 1/348 (0%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
              +KTE  + KK  +   +GN   SRE  +  ++LA  + +   FS  + ++ S L+  
Sbjct: 250 GSADKTEEATPKKKGEQRKKGNIAKSRELPVAMTLLAFTLLVPTLFSYVVDTLKSSLNYF 309

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           L+      + + S++  L+    +   ++ +P  + F++ GI + L Q   +     +KP
Sbjct: 310 LSLDFYMNI-NYSNLEKLVIAGLMDFFKIFLPIAIPFLVLGIIANLFQVGILFTGETLKP 368

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
           +  +++   G K ++S+ +L   +K    I ++  I      +NY  +L   +    +++
Sbjct: 369 NLSKLNPISGFKNMFSMRSLSTLIKDTAIISILAYIGYTFFQDNYLDILKLGNIYLPTLM 428

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
           Y     V  +L  I + +  + V D  +  +    +L+M+KQE+KDE K S G+P +K +
Sbjct: 429 YTVKDLVYSILSKICVAMIAIAVADYVYQRYSHKKQLRMTKQEVKDEYKNSEGDPEVKAK 488

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
            K   R     + M+A   AT+I+TNPTH ++A+RY + ++ APV+VAKG + +A K+R+
Sbjct: 489 IKQKQRQISSQRTMQAVPSATVIVTNPTHLSIAVRYEKGKDQAPVVVAKGADYLAFKIRE 548

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           IA  ++IPI E   +AR L+KQV I+  IP   Y+A A+++  +Y  K
Sbjct: 549 IAKGNDIPIIENKPIARLLYKQVEIDQEIPEDMYQAFAEILVAVYKIK 596


>gi|150395473|ref|YP_001325940.1| flagellar biosynthesis protein FlhB [Sinorhizobium medicae WSM419]
 gi|150026988|gb|ABR59105.1| flagellar biosynthetic protein FlhB [Sinorhizobium medicae WSM419]
          Length = 360

 Score =  328 bits (841), Expect = 9e-88,   Method: Composition-based stats.
 Identities = 155/350 (44%), Positives = 245/350 (70%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+++   D+KTEAPS KKI DA ++GN P SRE + F+S LA  I+++FF + G  +V  
Sbjct: 1   MADDQDKDSKTEAPSEKKISDATDKGNVPFSREVTAFASTLAIYIFVVFFLADGAANVAE 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  +       +L+  +  V L++H+ L ++ L++P  +L ++FG+GS + Q +P   L
Sbjct: 61  ALKDIFEQPEAWRLDTATDAVALISHVVLKSATLLMPIFILLILFGVGSSIFQNLPRPVL 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + ++P + RVS   G KRIY +  LV F KS  K+I+V  ++ + L  +YF  LD + ++
Sbjct: 121 DRIQPKWNRVSPVAGFKRIYGVPGLVEFGKSLFKVIVVSIVVVLVLWNDYFATLDMMFSD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P  I       +++++I++L   ATL ++D+ W+ H WY++LKM+KQE+KDE+KQS G+P
Sbjct: 181 PVMIFTTMTSDLKQIIIVVLFATATLAIVDLFWTRHHWYTELKMTKQEVKDELKQSQGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           I+K+R +S+ R R R +M+ +  RAT+II NPTHYA+ALRY++ E+DAPV+VA G++L+A
Sbjct: 241 IVKSRLRSLQRDRARKRMISSVPRATLIIANPTHYAVALRYVREESDAPVVVAMGKDLVA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
            K+R+IA ++ IP+FE+P LARS+F QV ++S IPPVFYKAVA+LI+++Y
Sbjct: 301 LKIREIAEKNGIPVFEDPPLARSMFAQVSVDSVIPPVFYKAVAELIHRVY 350


>gi|17549613|ref|NP_522953.1| flagellar biosynthetic FlhB transmembrane protein [Ralstonia
           solanacearum GMI1000]
 gi|17431867|emb|CAD18545.1| probable flagellar biosynthetic flhb transmembrane protein
           [Ralstonia solanacearum GMI1000]
          Length = 387

 Score =  328 bits (841), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 94/353 (26%), Positives = 175/353 (49%), Gaps = 3/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE D+   KTE  S++++E A  EG+ P SRE   F  +    + L       + + +S
Sbjct: 1   MSE-DSDLEKTEPASARRLEQAREEGDVPQSRELVSFVLLATGALGLWVMGESIVRTASS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L     R     +   +           +V+ GL+L ++    S L      ++ 
Sbjct: 60  FLARCLE--FHRYDYTRAQEQWQYVGAQFGPLAMVLAGLILMLVLAALSPLALTRGAVSF 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   R+    G+KR++S+  L+   +   K++LVG +    +       ++    +
Sbjct: 118 KPLTPDITRLIGMHGLKRMFSVQGLLELPRLLAKLVLVGGVGWWLILHYRDDFVELPRQD 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             + +           + +   +  +  +D+  +  Q+  K +M+K+E++ E ++S G+P
Sbjct: 178 LVAGMRDTMHVAGVAFLCMAGVMLLVAAVDVPLALWQYARKHRMTKEEVRKEHRESEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +++ R   + +MM    +A +I+TNPTHYA+ALRY + E  AP ++AKG +++A
Sbjct: 238 QLKGRIRAMQRQAAQRRMMADVPKADVIVTNPTHYAVALRYSEQEGGAPRVLAKGADMVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++  EH IP+ E P LAR+L++   I   IP   Y AVA+++  +Y  +
Sbjct: 298 AKIRELGAEHKIPMLEAPPLARALYRHTEIGHQIPAALYAAVAEVLAYVYQLR 350


>gi|310659024|ref|YP_003936745.1| flagellar export pore protein [Clostridium sticklandii DSM 519]
 gi|308825802|emb|CBH21840.1| flagellar export pore protein [Clostridium sticklandii]
          Length = 363

 Score =  327 bits (840), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 105/346 (30%), Positives = 185/346 (53%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
           + KTE  S KK +D+  +G    SRE +  ++++A ++ L +       ++T   +    
Sbjct: 15  EEKTEKASPKKKQDSRKKGQVMQSREINTAAALMASVLALKYSGGFMFRTITEATYFFRD 74

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
                 L +      +L ++ +  ++ V+  + +  +    +  IQ   +     +K   
Sbjct: 75  LLYTDILNESIGGYKILIYMIMYVTKAVVIVIGVGFVAAFITSKIQVGNLFTTETLKIKP 134

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
           +R++  EG KR++S+ + V  +KS +KI +VG +    L +N   +L      P    Y 
Sbjct: 135 ERLNPIEGFKRMFSMRSFVELVKSLLKIGVVGFVGYSYLAKNIGLVLKSQQLKPIQFSYM 194

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
            F     + I +   I  + +LD  +  + +   LKMSKQEIK+E KQS G+P IK++ K
Sbjct: 195 IFELSINLAIRMTFAITVIAILDFFYQRYDYEKNLKMSKQEIKEEYKQSEGDPQIKSKIK 254

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              R     +MM+   +A +IITNPTH+A+A++Y + + +AP +VAKG+NLIA+ +++ A
Sbjct: 255 EKQRQAAMRRMMQEIPKADVIITNPTHFAVAIKYDEDKFEAPYVVAKGKNLIAQNIKQKA 314

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            E NIP+ E   LA++L+K+V I   I P  Y+AVA+++  +Y  K
Sbjct: 315 REVNIPVVENKPLAQALYKEVEIGQMISPQLYEAVAEILAYVYSLK 360


>gi|147678408|ref|YP_001212623.1| flagellar biosynthesis pathway, component FlhB [Pelotomaculum
           thermopropionicum SI]
 gi|146274505|dbj|BAF60254.1| flagellar biosynthesis pathway, component FlhB [Pelotomaculum
           thermopropionicum SI]
          Length = 357

 Score =  327 bits (840), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 91/353 (25%), Positives = 178/353 (50%), Gaps = 3/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+       +TE  + ++I++A  +G    S + +    + A +  L          +  
Sbjct: 1   MAG--GTQERTEQATPRRIQEARRKGQVARSTDLTGALCLAAMVALLYAVKDEFFLDLQR 58

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L    +      +        +L    L +++L+ P + + ++  + S L+Q   + + 
Sbjct: 59  YLGWYFSQVAGF-IASEEVPGAVLYDTVLFSAKLMAPFIAVPVVTAVVSNLVQVGFLFST 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P    ++   G++RI+S  +LV  +KS  K  ++G I    +  N   +L   +  
Sbjct: 118 EALNPKLSVLNPATGLQRIFSSRSLVELVKSVFKFTVIGIITYYLIKANLADLLLVFNRP 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P  I       + KV     +    L++LD  +  +++   L MS+QE+K+E +Q+ G+P
Sbjct: 178 PGGIYREVAGFILKVAGWAAVAYLILSLLDYIYQRYEYKKSLMMSRQELKEEFRQTEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           +IK+RQ+ + R+   ++++    +AT+++TNPT  A+ALRY Q +  AP +VAKG   IA
Sbjct: 238 LIKSRQREMRRAISLNRIISEVPKATVVVTNPTSLAVALRYEQGQMPAPKVVAKGAGRIA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++++IA EH++PI E   +AR ++  V ++  IP   Y+AVA+++  +Y  K
Sbjct: 298 GRIKEIAREHDVPIVENKEIARFIYYNVELDQVIPFEIYQAVAEILALVYRLK 350


>gi|95929867|ref|ZP_01312608.1| flagellar biosynthetic protein FlhB [Desulfuromonas acetoxidans DSM
           684]
 gi|95134163|gb|EAT15821.1| flagellar biosynthetic protein FlhB [Desulfuromonas acetoxidans DSM
           684]
          Length = 353

 Score =  327 bits (840), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 95/353 (26%), Positives = 180/353 (50%), Gaps = 3/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E  +   +TE  +SK+ ED   +G    S+E +  + +   L+   F+       ++ 
Sbjct: 1   MAEE-SGQERTEEATSKRREDFRKKGQVAQSKEVNTAALLSLSLLLWYFYGGSFWSQLSW 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +      +    +     +V +L  +    + L+ P  L+ ++ G  +  +Q   +   
Sbjct: 60  LVSHFWEQSGSLAV-TPQSVVQILLFVLQKTAVLLSPLFLMVLVVGFFASFLQIGWLFTG 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   ++   +G  R  S  +LV  +KS  K+ LVG +   ++   +   L  +  +
Sbjct: 119 KPLMPDLTKLDPIKGAGRFVSKRSLVELVKSLAKVALVGYVAYKTVYSEFDNALYLVDMD 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               LY+       VL+     +  L +LD  +   +   K+KM+KQE K+E K+S G+P
Sbjct: 179 VIETLYYVGRVAMAVLMKSCGIMILLALLDFMFVRWEMEEKMKMTKQEQKEEFKESEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K + +SI +   R +MM    +A ++ITNPTH ++A++Y Q E DAPV++AKG + +A
Sbjct: 239 HLKAKVRSIQQQMARRRMMAEVPKADVVITNPTHLSVAIKYEQGEMDAPVIIAKGADNLA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R+IA E+++P+ E   +AR+L+K V +   +P   ++AVA+++  +Y  K
Sbjct: 299 MKIREIARENSVPLVENVDVARALYK-VEVGEVVPEQMFQAVAEILAYVYSLK 350


>gi|322382375|ref|ZP_08056282.1| flagellar biosynthesis protein FlhB [Paenibacillus larvae subsp.
           larvae B-3650]
 gi|321153728|gb|EFX46103.1| flagellar biosynthesis protein FlhB [Paenibacillus larvae subsp.
           larvae B-3650]
          Length = 378

 Score =  327 bits (840), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 99/347 (28%), Positives = 179/347 (51%), Gaps = 1/347 (0%)

Query: 7   PDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLL 66
              KTE  + KK E+A  +G    S E      +    + LL F       +   +   L
Sbjct: 29  SGEKTEKATPKKREEAKKKGQVAKSMEIPASLILFFTFLGLLLFSGFMKDRLLGLVTYTL 88

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
                  +  ++++  +  HL   A  L+ P  ++ ++    +   Q   +     +K  
Sbjct: 89  EHDLVMNV-TLNNVQMMFLHLIGEAFLLLAPIFIISVVIAFFANYAQIGFLFTGEPLKMK 147

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
           F +++  EG KRI+S+  +++F+KS +K+I++  I+ +++      ++         +L 
Sbjct: 148 FNKINPIEGAKRIFSLRAIIDFLKSTIKMIVIAAIVWMTIWGEKDKLISLGHVPLQDMLP 207

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
           +      ++ + I   +  +  LD  +   ++   L+MSKQEIKDE K+S G+P+IK + 
Sbjct: 208 YIGSLTVQLGLKIGGVLIAIAALDYMYQKFEYEKSLRMSKQEIKDEFKKSEGDPLIKGKI 267

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           +   R     +MM+   +A +IITNPTH+A+ALRY   E +AP ++AKG +LIA K++++
Sbjct: 268 RERQRRMAMQRMMQEVPKADVIITNPTHFAVALRYDAAEMEAPAVIAKGTDLIALKIKEV 327

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A E+ + I E   LAR+L+ QV I  AIP   ++AVA+++  +Y  K
Sbjct: 328 AKENGVTIMENKPLARALYAQVEIGQAIPADLFQAVAEVLAYVYKAK 374


>gi|239628943|ref|ZP_04671974.1| flagellar export protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239519089|gb|EEQ58955.1| flagellar export protein [Clostridiales bacterium 1_7_47FAA]
          Length = 353

 Score =  327 bits (840), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 88/345 (25%), Positives = 167/345 (48%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
           D KTE  + K+ +D   +GN   S + +   S+L     L         +    +++ + 
Sbjct: 4   DEKTEKATPKRRQDERKKGNVFQSNDVAAVCSMLVLFHSLKALAPHMYRNFRDAMYMFMG 63

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
            A             +L    L      +P L + ++  +     Q     +++ +K   
Sbjct: 64  MAADSDSFHQEAGREMLVKAMLLFLESALPLLFIGVLTAVAVTFFQTRMAFSMDVLKFKM 123

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
           +R+S  +G KR++SI ++V  +K+ +KI ++G ++ + L      +   +       L  
Sbjct: 124 ERISPLKGFKRMFSIRSVVELIKALIKITILGWVVYVFLKGRMEELSRLMEGTVEGALIF 183

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
              TV  ++  + +    L  +D  + + ++   L+MSKQEIK+E KQ+ G+P IK + +
Sbjct: 184 TGNTVISLVDTVGVAFIFLASMDYLYQWWEYEKNLRMSKQEIKEEYKQTEGDPQIKGKIR 243

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              R     +MM+   +A +I+ NPTHYA+AL Y    N APV++AKG + +A K+ ++ 
Sbjct: 244 EKQRQMASMRMMQNVPKADVIVRNPTHYAVALGYDADRNRAPVVLAKGADHLALKIVEVG 303

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
             + + I E+  LAR L+  V ++  IP  +Y+ VA+++  +Y  
Sbjct: 304 EANGVYILEDRPLARGLYASVEVDMEIPEEYYQTVAKILAFVYKL 348


>gi|167034909|ref|YP_001670140.1| flagellar biosynthesis protein FlhB [Pseudomonas putida GB-1]
 gi|166861397|gb|ABY99804.1| flagellar biosynthetic protein FlhB [Pseudomonas putida GB-1]
          Length = 380

 Score =  327 bits (839), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 102/354 (28%), Positives = 185/354 (52%), Gaps = 2/354 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+++  +KTE P+ K+  DA  +G    S+E +  +  LA    LL F      ++ S
Sbjct: 1   MAESESGQDKTEDPTEKRKRDAREKGEIARSKELNTVAVTLAGAGGLLAFGGHLAETLLS 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            + +   S T+  + D   +   L      A   V P L+L  +    + +     + + 
Sbjct: 61  MMRMNF-SLTREVIVDERAMGAFLLASGKMAIWAVQPVLILLFVISFVAPIALSGFLFSG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + ++P F R++   GIKR++S+N+L   +K+  K  ++  +  + L+ +   +L   +  
Sbjct: 120 SLLQPKFSRMNPLSGIKRMFSMNSLTELLKALAKFFVILIVAVVVLSNDRQALLSIANEP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + H+   V    + +   +  +   D+ +  +Q + K+KM+KQE++DE K S G P
Sbjct: 180 LEQAIIHSLQVVGWSALWMSAGLLLIAAADVPFQLYQTHKKMKMTKQEVRDEYKDSEGKP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEND-APVLVAKGQNLI 299
            +K R + + R   + +MM A  +A +IITNPTHYA+AL+Y   +   AP+L+AKG + +
Sbjct: 240 EVKQRIRQLQREVSQRRMMAAVPQADVIITNPTHYAVALQYDPEKGGAAPLLLAKGSDFM 299

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A K+R+I  EH I I E P+LAR+++    +   IP   Y AVAQ++  ++  +
Sbjct: 300 ALKIREIGVEHKIQILESPALARAIYYSTEVEQEIPAGLYLAVAQVLAYVFQIR 353


>gi|254973928|ref|ZP_05270400.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile QCD-66c26]
 gi|255091314|ref|ZP_05320792.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile CIP 107932]
 gi|255312972|ref|ZP_05354555.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile QCD-76w55]
 gi|255515731|ref|ZP_05383407.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile QCD-97b34]
 gi|255648825|ref|ZP_05395727.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile QCD-37x79]
 gi|260682043|ref|YP_003213328.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile CD196]
 gi|260685641|ref|YP_003216774.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile R20291]
 gi|306518939|ref|ZP_07405286.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile QCD-32g58]
 gi|260208206|emb|CBA60557.1| flagellar export protein [Clostridium difficile CD196]
 gi|260211657|emb|CBE01921.1| flagellar export protein [Clostridium difficile R20291]
          Length = 604

 Score =  327 bits (839), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 102/348 (29%), Positives = 184/348 (52%), Gaps = 1/348 (0%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
              +KTE  + KK  +   +GN   S+E  +  ++LA  + +   FS  + ++ S L+  
Sbjct: 250 GSTDKTEEATPKKKGEQRKKGNIAKSKELPVAMTLLAFTLLVPTLFSYVVDTLKSSLNYF 309

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           L+      + + S I  L+    +   ++ +P  + F++ GI + L Q   +     +KP
Sbjct: 310 LSLDFYMNI-NYSSIEKLVIAGLMDFFKIFLPIAIPFLVLGIVANLFQVGILFTGETLKP 368

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
           +  +++   G K ++S+ +L   +K    I ++  I      +NY  +L   +    +++
Sbjct: 369 NLSKLNPVSGFKNMFSMRSLSTLIKDTAIISILAYIGYTFFQDNYLDILKLGNIYLPTLM 428

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
           Y     V  +L  I + +  + V D  +  +    +L+M+KQE+KDE K S G+P IK +
Sbjct: 429 YTVKDLVYSILSKICVAMIVIAVADYVYQRYSHKKQLRMTKQEVKDEYKNSEGDPEIKAK 488

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
            K   R     + M+A   AT+I+TNPTH ++A+RY + ++ APV+VAKG + +A K+R+
Sbjct: 489 IKQKQRQISSQRTMQAVPSATVIVTNPTHLSIAVRYEKGKDQAPVVVAKGADYLAFKIRE 548

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           IA  ++IPI E   +AR L+KQV I+  IP   Y+A A+++  +Y  K
Sbjct: 549 IAKGNDIPIIENKPIARLLYKQVEIDQEIPEDMYQAFAEILVAVYKIK 596


>gi|225569959|ref|ZP_03778984.1| hypothetical protein CLOHYLEM_06054 [Clostridium hylemonae DSM
           15053]
 gi|225161429|gb|EEG74048.1| hypothetical protein CLOHYLEM_06054 [Clostridium hylemonae DSM
           15053]
          Length = 353

 Score =  327 bits (839), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 101/352 (28%), Positives = 183/352 (51%), Gaps = 4/352 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+     D+KTE  + KK  D   EGN   S +      +      L   F     +  +
Sbjct: 1   MA----ADSKTEKATPKKRRDERKEGNIFQSSDVVNVVFVFLSFYILKLIFPGIYETSGN 56

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   ++ A          +         +A+R V+P   + M+ GI  + IQ   +   
Sbjct: 57  FMKRFISLAGSITDLSGQSVGKYGMEFLSAAARTVLPFACICMVTGIVMHGIQTRFLFTS 116

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
            + +P   R+S  +GIKRI+++ N +  +K+ +K+I++  II   L ++   ++  +  +
Sbjct: 117 KNFRPKLNRISPLQGIKRIFALKNAIELVKNLLKVIVLVAIIYTLLKQDAVNVIRTMDMS 176

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             +   + F  +  +++ + +  A +  LD  + +  +  K+KMSKQE+K+E KQ+ GNP
Sbjct: 177 ISASAAYTFDMIISMILRVSMVFAVIAFLDYLFQWWDYERKIKMSKQEVKEEFKQTEGNP 236

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R + I + R R +MM+A   A +II NPTH+A+AL Y   +N+APV+VAKG + +A
Sbjct: 237 EIKGRIRDIQKQRARSRMMQAVPNADVIIRNPTHFAVALSYDTEKNNAPVVVAKGVDELA 296

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
            ++ +   E+++ + E+  LARSL+ +  +N  IP  +Y AVA+++  +Y  
Sbjct: 297 LRIVRTGEENHVAVIEDRPLARSLYAETELNREIPSEYYGAVAEILVYVYKL 348


>gi|78044903|ref|YP_359855.1| flagellar biosynthetic protein FlhB [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|77997018|gb|ABB15917.1| flagellar biosynthetic protein FlhB [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 353

 Score =  327 bits (839), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 101/353 (28%), Positives = 178/353 (50%), Gaps = 3/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++      +TEAP+ +++ +A   G    S+E +     L   + LL            
Sbjct: 1   MADEQRDQ-RTEAPTPRRLAEARRRGQVFKSQELNFAVMFLIFFLLLLVLGGYFYQQFYL 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
               +  +         S +  LL +    + ++V+P LLL M+ GI   L+Q   +   
Sbjct: 60  LSRNVFRNMFIEL--TPSAVRGLLLYYFGWSFKIVLPFLLLGMLAGIALNLVQVGFIFTT 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +KPS++R++   G  RI+S  N V  +K+F+K   +  +I + +  N   +   I   
Sbjct: 118 EPLKPSWERINPLSGFSRIFSRRNWVELLKNFLKFGFLALVIYLRIKSNLPLIFQKIGQA 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P       F  ++K+ +  LL +     +D  +   ++Y  LKM+KQE+K+E +Q+ G+P
Sbjct: 178 PAEYFNGYFSLIKKIALDTLLVLFLFGAVDYWYQRREYYQSLKMTKQELKEEYRQTEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           +IK R +   R    +++     +AT+++TNP H A+AL+Y + +  AP +VAKG   +A
Sbjct: 238 LIKARLRERQRQIALNQIAREVPQATVVVTNPVHIAVALKYERGKMAAPKVVAKGAGFLA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +K+++IA  HN+ I E   +AR L+K   +   IP   Y AVA++I  +Y KK
Sbjct: 298 EKIKEIARAHNVEIVENVEVARFLYKNCEVGEEIPEELYNAVAEIIAWVYRKK 350


>gi|268678882|ref|YP_003303313.1| flagellar biosynthetic protein FlhB [Sulfurospirillum deleyianum
           DSM 6946]
 gi|268616913|gb|ACZ11278.1| flagellar biosynthetic protein FlhB [Sulfurospirillum deleyianum
           DSM 6946]
          Length = 353

 Score =  327 bits (839), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 106/351 (30%), Positives = 182/351 (51%), Gaps = 5/351 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+       KTE  +SKKIEDA  EGN P S++ S F +++  L   L + S     +  
Sbjct: 1   MA---DDQEKTEEATSKKIEDARKEGNVPKSQDMSAFVTLVVALGAFLAWLSFIESRIIY 57

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
             H   +       ++++  + L++        +VIP  L   + GI + ++Q   +   
Sbjct: 58  LYHYYQSLIGTEITKEVTFQISLISLR--EVVFMVIPLALAVAIAGILANVMQTGFLFTT 115

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P+F ++   +G K ++S+  L+  +K+ +K+ +V  I    L      +   I   
Sbjct: 116 KPLMPNFGKLDPIKGFKNLFSLKKLIETVKTLLKVSVVMGISYFFLWSFTKELPTVIYFP 175

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               +      +  +  +IL+ +  L + D+      ++ +L+MSKQE+KDE KQ  G+P
Sbjct: 176 LPDQMAWLKEKMLILAAVILIILLVLALADLMLVRFNYFKELRMSKQEVKDEYKQMEGDP 235

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK + + I     R +MM+    A ++ITNPTHYA+A+RY Q +  AP ++AKG +L+A
Sbjct: 236 KIKAKIRQIQMQMTRKRMMQEIPGADVVITNPTHYAVAIRYHQDKEAAPKVIAKGTDLVA 295

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            ++++IA  H+I I E P LAR L+K+  I   IP   YKAVA+++  +Y 
Sbjct: 296 LRIKEIALNHHIQIVENPPLARELYKKCNIGELIPENLYKAVAEVLAFVYK 346


>gi|329888173|ref|ZP_08266771.1| flagellar biosynthetic protein FlhB [Brevundimonas diminuta ATCC
           11568]
 gi|328846729|gb|EGF96291.1| flagellar biosynthetic protein FlhB [Brevundimonas diminuta ATCC
           11568]
          Length = 358

 Score =  327 bits (838), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 103/355 (29%), Positives = 190/355 (53%), Gaps = 2/355 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++   P++KTE  + +K+E+A  +G+   S + +   S+      LL         +  
Sbjct: 1   MADGPDPESKTEDATPRKLEEARKKGDVAKSPDVAAALSLAGAAGVLLAGGGWFSTRIAE 60

Query: 61  DLHVLLASAT-QRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLN 119
            L   LA         +    V +  H   +A+  +   +   ++ G+G  L Q   +  
Sbjct: 61  ALTPFLAQPHAMIGGLEAGGGVEIGMHAVWAAAPFLAALMFAVILGGVGGNLAQSGLIFT 120

Query: 120 LNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISA 179
            + VKP + +V+  EG KRI+  + LV F+K+F+K++ +G +    L  +   + +  + 
Sbjct: 121 ADKVKPKWSKVNPLEGFKRIFGPDGLVQFLKTFIKLVAIGAVCWWVLKPHARELENLAAM 180

Query: 180 NPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
           +P  IL  A      +++  L+F++     D  W   ++  +++M+K+E+K++ KQS G+
Sbjct: 181 SPAMILPFARDLALALMLSALVFLSLTAGADYLWQRMRFAKRMRMTKEELKEDFKQSDGD 240

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTE-NDAPVLVAKGQNL 298
           P +K + + I   R R +MM+A   AT+IITNPTHY++ALRY   + + APV VAKG + 
Sbjct: 241 PHVKAKLRQIRMQRGRQRMMQAVPDATVIITNPTHYSVALRYEPDKGDGAPVCVAKGVDA 300

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +A ++R++A EH +PI E   LAR+L+  V ++  IP   ++A A++I  +  ++
Sbjct: 301 LALRIREVAREHKVPIVENVPLARALYAAVEVDGVIPREHFEAAAKVIGFVMQQR 355


>gi|160880828|ref|YP_001559796.1| flagellar biosynthetic protein FlhB [Clostridium phytofermentans
           ISDg]
 gi|160429494|gb|ABX43057.1| flagellar biosynthetic protein FlhB [Clostridium phytofermentans
           ISDg]
          Length = 373

 Score =  327 bits (838), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 94/355 (26%), Positives = 179/355 (50%), Gaps = 3/355 (0%)

Query: 2   SENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSD 61
           ++      KTE  ++KK+EDA  EG    S++    S +LA  + +  F           
Sbjct: 18  AKEGPGGEKTEEATTKKLEDARKEGQVARSQDLITASGLLALFMVIKLFSGYIAGGFLDA 77

Query: 62  LHVLLASATQRKLEDISHIVF--LLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLN 119
                        E++++ +   L+  + ++   + +P  +  ++      + Q    L 
Sbjct: 78  FSKSYKEIETLAKEEMTYQIGSKLMNQMGINILLICLPVFITGVVVAFVVNIFQVKWKLT 137

Query: 120 LNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISA 179
              ++P F +++   G K++ S++ ++  +KS +K+ ++  I+  +L +    +      
Sbjct: 138 GKPLQPKFNKINPLSGFKKMLSMDKIMELVKSIIKVGIIIYIVYNALKDELGKLYLLYEM 197

Query: 180 NPHSI-LYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYG 238
               + + +    V  + I I +    + + D  +   ++   ++M+KQEIKDE KQS G
Sbjct: 198 GNLEVVIAYIGSIVLDLGIKISVLFIVVGLADFIYQKIKFKKDMRMTKQEIKDEFKQSEG 257

Query: 239 NPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL 298
           +P IK++ K   R   + +MM+    A ++ITNPTH+A AL+Y +  ++AP+L+AKG +L
Sbjct: 258 DPQIKSKIKQKMRQASQRRMMQRLPEADVVITNPTHFACALKYDKEVSEAPILIAKGADL 317

Query: 299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           +A K+++IA E+ IPI E   LAR L+  V I S IP   Y+ VA+++  +Y  K
Sbjct: 318 LAAKIKEIAKENEIPIVENKPLARMLYYNVDIESEIPGELYQMVAEVLAYVYSLK 372


>gi|90423033|ref|YP_531403.1| flagellar biosynthesis protein FlhB [Rhodopseudomonas palustris
           BisB18]
 gi|90105047|gb|ABD87084.1| flagellar biosynthetic protein FlhB [Rhodopseudomonas palustris
           BisB18]
          Length = 358

 Score =  327 bits (838), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 108/353 (30%), Positives = 188/353 (53%), Gaps = 3/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS++D+   KT+ P+ K+++DAL  G+   S+E + +  I    + L  F       + +
Sbjct: 1   MSDDDSS-EKTQDPTQKRLDDALERGDVAKSQEVNTWFMIAGATLVLSSFSGSVGSGLQN 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  L+ ++   + +    +    + L  + + + +P L+L +   +   ++Q   V + 
Sbjct: 60  PLRNLIENSWMIRTDGAGLMALTQSLLYAAIAAMGVPFLMLIIAA-LAGNMLQHRLVFSA 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +KP F ++S   G KR++      NF+K   K+I +G ++   L    + +   I  +
Sbjct: 119 EGLKPKFSKISPLAGAKRLFGKQAAANFLKGLFKVIALGAVMVAILWPERYRLDAMIRLD 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             +I+        K++  ++  +A + + D  + Y  WY K KMS QE+K+E KQS G+P
Sbjct: 179 IGAIMGLTIALTLKLMAAVVAMLAAVAIADFFFQYRTWYEKQKMSLQEVKEEHKQSEGDP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R + I   R+R +MM A  +A+++ITNPTHY++AL Y      AP+ VAKG + IA
Sbjct: 239 HIKGRIRQIRHQRMRKRMMAAVPQASVVITNPTHYSVALSYENG-MSAPICVAKGVDSIA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++A  H++PI E   LAR+L+  V I+  IP   Y AVA++I  +   K
Sbjct: 298 FKIREVAKAHDVPIIENVPLARALYATVKIDEEIPVEHYHAVAEIIGYVMGLK 350


>gi|325920558|ref|ZP_08182480.1| flagellar biosynthetic protein FlhB [Xanthomonas gardneri ATCC
           19865]
 gi|325548951|gb|EGD19883.1| flagellar biosynthetic protein FlhB [Xanthomonas gardneri ATCC
           19865]
          Length = 376

 Score =  327 bits (838), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 93/353 (26%), Positives = 180/353 (50%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE++    +TE P+ K++ +A  +GN P SRE S  +   A +  L+   + GI    S
Sbjct: 1   MSESEDGGERTELPTEKRLREAREQGNIPQSRELSTAAVFGAGVFGLMAL-ARGIGDGAS 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
                  S   +  E+   +      L L    +++P + + +  G+   L+      + 
Sbjct: 60  VWMKTALSPDPKMRENPMALFGHFGDLLLQLLWVMVPLIGICLAAGLAGPLLMSGLHFSG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   +++   GIKR++  N+L   +KS ++++ VG   ++ +++    +   ++  
Sbjct: 120 KAIMPDLNKLNPANGIKRMWGSNSLAELVKSVLRLLFVGLAASLCISKGLHGLRSLVNQP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + +     + +L      +  L  +D  +    W  KLKM+++EIK E+K+S G+P
Sbjct: 180 LEQAVGNGLDFTKSLLFYTAGALVLLAAIDAPYQKWNWMRKLKMTREEIKREMKESEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + +     + +MMEA  +A +++ NPTHYA+AL+Y   +  AP++VAKG + +A
Sbjct: 240 EVKGRIRQMQMQMSQRQMMEAVPKADVVLMNPTHYAVALKYEGGKMRAPIVVAKGVDEMA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++  +H + I   P LAR+L+++  I   IP   Y  VAQ++  +Y  +
Sbjct: 300 FRIREVCEQHRVSIVTAPPLARALYREAQIGKEIPVRLYSVVAQVLSYVYQLR 352


>gi|15895417|ref|NP_348766.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           acetobutylicum ATCC 824]
 gi|15025140|gb|AAK80106.1|AE007715_11 FliR/FlhB fusion protein [Clostridium acetobutylicum ATCC 824]
 gi|325509563|gb|ADZ21199.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           acetobutylicum EA 2018]
          Length = 610

 Score =  326 bits (837), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 87/346 (25%), Positives = 175/346 (50%), Gaps = 1/346 (0%)

Query: 7   PDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLL 66
             +KTE  + K+  +A  +G    S+E  L ++++A    +          +   +    
Sbjct: 261 DSDKTEEATPKRKSEARKKGQVARSKEVPLAATLVAITFIISLGGQTFFNGLGVMMQTFF 320

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
            S     L ++  +  ++  + L+A + +    +  M+ GI + + Q   +     +KP 
Sbjct: 321 QSYIHSNLTEL-DLRRIIIFVILNAGKFIFMFGVPVMVVGIVANIAQTGWITTTEPIKPD 379

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
            K+++   G KRI+S+  +VN +K  V + ++  +    L  NY  + +  +     I  
Sbjct: 380 LKKLNPISGFKRIFSMTTIVNLLKDLVVVAVLSVVGYKFLMSNYGDIANLNNLMVQYIPQ 439

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
                V  +  ++ L +  +   D  ++ +++   +KM+K E+K+E KQ+ G+P IK ++
Sbjct: 440 AYLSYVISIFRIVALIMIVIAGFDFVYNRYKYKKDMKMTKHEVKEEFKQAEGDPEIKGKR 499

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           +   R  +   M+     AT++ITNPTH ++A++Y +  + AP +VAKG +  A ++++I
Sbjct: 500 RQRMREIVTRTMLSKVPDATVVITNPTHISVAIKYERGVDKAPTVVAKGADRTALRIKEI 559

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
           A E+N+PI E   LAR +FK+V ++  IP   Y+ VA+++  +Y  
Sbjct: 560 AKENNVPIMENKPLARLIFKKVEVDEQIPAEMYQTVAEILALVYKL 605


>gi|325917832|ref|ZP_08180011.1| flagellar biosynthetic protein FlhB [Xanthomonas vesicatoria ATCC
           35937]
 gi|325535943|gb|EGD07760.1| flagellar biosynthetic protein FlhB [Xanthomonas vesicatoria ATCC
           35937]
          Length = 376

 Score =  326 bits (837), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 93/353 (26%), Positives = 177/353 (50%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE+D    +TE P+ K++ +A  +GN P SRE S  +   A +  L+            
Sbjct: 1   MSESDDGGERTELPTEKRLREAREQGNFPQSRELSTAAVFGAGVFGLMALAGGIGDGAAV 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L S   R  E    +      L L    +++P + + ++ G+   L+      + 
Sbjct: 61  WMKTAL-SPDPRMREHPMALFGHFGDLLLQLLWVMLPLIGVCLLAGLAGPLMMSGLHFSS 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   +++   GIKR++  N+L   +KS ++++ VG    + ++++   +   ++  
Sbjct: 120 KAIMPDLTKLNPMNGIKRMWGSNSLAELVKSVLRLLFVGLAAWLCISKSLPGLRALVNQP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + +     + +L      +  L  +D  +    W  KLKM+++EIK E+K+S G+P
Sbjct: 180 LEQAVGNGLDFTKSLLFYTAGALVLLAAIDAPYQKWNWLRKLKMTREEIKREMKESEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + +     + +MMEA  +A +++ NPTHYA+AL+Y   +  AP++VAKG + +A
Sbjct: 240 EVKGRIRQMQMQMSQRQMMEAVPKADVVLMNPTHYAVALKYEGGKMRAPIVVAKGVDEMA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+   +H + I   P LAR+L+++  I   IP   Y  VAQ++  +Y  +
Sbjct: 300 FRIRETCEQHRVAIVTAPPLARALYREAQIGKEIPVRLYSVVAQVLSYVYQLR 352


>gi|157692318|ref|YP_001486780.1| flagellar biosynthesis protein FlhB [Bacillus pumilus SAFR-032]
 gi|157681076|gb|ABV62220.1| flagellar biosynthesis protein FlhB [Bacillus pumilus SAFR-032]
          Length = 362

 Score =  326 bits (837), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 110/346 (31%), Positives = 181/346 (52%), Gaps = 1/346 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE  + KK +D+  +G    S + +   S L   +   F        + + +    +
Sbjct: 14  GEKTEKATPKKRQDSRKKGQVAKSTDVNTAISFLLIFLSFFFIGPFMKERIIALIERFYS 73

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
           +    K+   S+I  L   L      L++P L + M+ GI S  +Q   + +   +KP  
Sbjct: 74  TTMLMKVST-SNIHQLFVELLQETGLLLMPILGVGMLAGIISNYLQVGFLFSTEVIKPKL 132

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
           +++   +G KRIYSI  LV  +KS +KI L+G    I+L  ++  +L          L+ 
Sbjct: 133 EKLDPIKGFKRIYSIRALVELLKSILKIGLIGFATFIALWMHFDEILRLPLLTAEETLHF 192

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
                  + +     +  L  LD  +    +   L+MSKQ+IKDE K+S G+P+IK++ K
Sbjct: 193 VASMTLIMGLYAAGALMVLAGLDYMYQKFDYEKNLRMSKQDIKDEYKKSEGDPLIKSKIK 252

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              R     +MM+   +A +IITNPTHYA+AL+Y + + DAP +VAKG +++A K+R IA
Sbjct: 253 QRQREMAMRRMMQEVPKADVIITNPTHYAIALKYDEEKMDAPFVVAKGTDILALKIRTIA 312

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            EH+I   E   LAR+L+ QV I+ A+P  ++KA+A+++  +Y  K
Sbjct: 313 KEHDIMTVENRPLARALYDQVDIDQAVPEEYFKAIAEILAYVYKTK 358


>gi|260893861|ref|YP_003239958.1| flagellar biosynthetic protein FlhB [Ammonifex degensii KC4]
 gi|260866002|gb|ACX53108.1| flagellar biosynthetic protein FlhB [Ammonifex degensii KC4]
          Length = 356

 Score =  326 bits (837), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 91/347 (26%), Positives = 178/347 (51%), Gaps = 3/347 (0%)

Query: 7   PDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLL 66
              KTE  + +++E+A  +G    S E S   + LA +          + ++T  +H  L
Sbjct: 7   GQEKTEPATPRRLEEARRKGQVARSAELSGALACLALVFVCYLLKEQALLTLTRGMHHSL 66

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
           +  T       +     L         L+ P  L  ++  IG  L Q   V + + + P 
Sbjct: 67  SFLTGDL--TPASAAVALGFWGRILLELLAPFFLTALVLAIGVNLAQVGFVFSPSVLLPK 124

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
             R+S+  G+ RI+S+  LV   K+F K+++VG+I    + +    +   +   P +   
Sbjct: 125 LDRISITRGLGRIFSLQGLVELGKAFFKLVIVGSIAVFVIRQEIPRLFLLLETPPLAGFT 184

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
                + ++ +++ L    L +LD  +  +++  +L M+K E+K+E+KQ+ G+P++K   
Sbjct: 185 LVAGILLRLGVVVGLAYLALGLLDFFYQRNRYRKELMMTKAELKEELKQTEGDPLVKGWI 244

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           +   R    +++ +   +AT+++TNP H A+AL+Y     +AP +VAKG   +A+K+++I
Sbjct: 245 RRRLRQVSLNRIRQEVPKATVVVTNPLHIAVALKYEP-PMNAPKVVAKGAGFLAQKIKEI 303

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A  + +P+ E P +A+ L+++V +   IPP  Y+AVA++I  +Y  +
Sbjct: 304 ARANGVPVVENPPVAQFLYRRVEVGQEIPPALYQAVAEIIALVYRLR 350


>gi|315121857|ref|YP_004062346.1| flagellar biosynthesis protein FlhB [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495259|gb|ADR51858.1| flagellar biosynthesis protein FlhB [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 354

 Score =  326 bits (837), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 261/352 (74%), Positives = 312/352 (88%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSEND P+NKTE+PSSKKIEDAL++GNAP+SRE  LFSS LACLIYLLFF SPGI+ +T 
Sbjct: 1   MSENDNPENKTESPSSKKIEDALSKGNAPVSREVYLFSSTLACLIYLLFFVSPGIHDLTY 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           D  + LAS TQ KL+ +SH+VFLL  L  S S+L+IPGLLLFM+FG+GSYLIQRIP  NL
Sbjct: 61  DFRMFLASVTQWKLDSVSHLVFLLVTLGFSTSKLLIPGLLLFMIFGVGSYLIQRIPSFNL 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           N+++PS KR+SLREGIKRIYS NNLVNF KS  KI++VGT+I ISL +N+ TML+ I++N
Sbjct: 121 NNIRPSLKRISLREGIKRIYSTNNLVNFTKSSFKIVIVGTLIAISLKDNHLTMLESITSN 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P  IL+H FFT+RK+LI+ILLFIA LT++DIGW+Y+QWYSKLKMSKQE+KDEIKQSYGNP
Sbjct: 181 PQIILHHIFFTIRKILIIILLFIAILTIIDIGWTYYQWYSKLKMSKQEVKDEIKQSYGNP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           +IK+RQKSIARSRIRHKM+EATSRAT++ITNPTHYALALRY+ TEND P+++AKGQNLIA
Sbjct: 241 MIKSRQKSIARSRIRHKMIEATSRATLVITNPTHYALALRYVPTENDVPIMIAKGQNLIA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
            K+RKIA E NIPIFE+P LARSLF+QVPINS+IPPVFYKA+AQLI+KIY K
Sbjct: 301 SKIRKIASEKNIPIFEDPLLARSLFRQVPINSSIPPVFYKAIAQLIHKIYSK 352


>gi|255305289|ref|ZP_05349461.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile ATCC 43255]
          Length = 604

 Score =  326 bits (836), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 102/348 (29%), Positives = 183/348 (52%), Gaps = 1/348 (0%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
              +KTE  + KK  +   +GN   S+E  +  ++LA  + +   FS  + ++ S L+  
Sbjct: 250 GSTDKTEEATPKKKGEQRKKGNIAKSKELPVAMTLLAFTLLVPTLFSYVVDTLKSSLNYF 309

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           L+      + + S I  L+    +   ++ +P  + F++ GI + L Q   +     +KP
Sbjct: 310 LSLDFYMNI-NYSSIEKLVITGLMDFFKIFLPIAIPFLVLGIVANLFQVGILFTGETLKP 368

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
           +  +++   G K ++S+ +L   +K    I ++  I      +NY  +L   +    +++
Sbjct: 369 NLSKLNPISGFKNMFSMRSLSTLIKDTAIISILAYIGYTFFQDNYLDILKLGNIYLPTLM 428

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
           Y     V  +L  I + +  + V D  +  +    +L+M+KQE+KDE K S G+P IK +
Sbjct: 429 YTVKDLVYSILSKICVAMIVIAVADYVYQRYSHKKQLRMTKQEVKDEYKNSEGDPEIKAK 488

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
            K   R     + M+A   AT+I+TNPTH ++A+RY + ++ APV+VAKG + +A K+R+
Sbjct: 489 IKQKQRQISSQRTMQAVPSATVIVTNPTHLSIAVRYEKGKDQAPVVVAKGADYLAFKIRE 548

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           IA  + IPI E   +AR L+KQV I+  IP   Y+A A+++  +Y  K
Sbjct: 549 IAKGNEIPIIENKPIARLLYKQVEIDQEIPEDMYQAFAEILVAVYKIK 596


>gi|194014696|ref|ZP_03053313.1| flagellar biosynthetic protein FlhB [Bacillus pumilus ATCC 7061]
 gi|194013722|gb|EDW23287.1| flagellar biosynthetic protein FlhB [Bacillus pumilus ATCC 7061]
          Length = 362

 Score =  326 bits (836), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 110/346 (31%), Positives = 181/346 (52%), Gaps = 1/346 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE  + KK +D+  +G    S + +   S L   +   F        + + +    +
Sbjct: 14  GEKTEKATPKKRQDSRKKGQVAKSTDVNTAISFLLIFLSFFFIGPFMKERIIALIERFYS 73

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
           +    K+   S+I  L   L      L++P L + M+ GI S  +Q   + +   +KP  
Sbjct: 74  TTMLMKVST-SNIHQLFVQLLQETGILLMPILGVGMLAGIISNYLQVGFLFSTEVIKPKL 132

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
           +++   +G KRIYSI  LV  +KS +KI L+G    I+L  ++  +L          L+ 
Sbjct: 133 EKLDPIKGFKRIYSIRALVELLKSILKIGLIGFATFIALWMHFDEILRLPLLTAEETLHF 192

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
                  + +     +  L  LD  +    +   L+MSKQ+IKDE K+S G+P+IK++ K
Sbjct: 193 VANMTLIMGLYAAGALMILAGLDYMYQKFDYEKNLRMSKQDIKDEYKKSEGDPLIKSKIK 252

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              R     +MM+   +A +IITNPTHYA+AL+Y + + DAP +VAKG +++A K+R IA
Sbjct: 253 QRQREMAMRRMMQEVPKADVIITNPTHYAIALKYDEEKMDAPFVVAKGTDILALKIRTIA 312

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            EH+I   E   LAR+L+ QV I+ A+P  ++KA+A+++  +Y  K
Sbjct: 313 KEHDIMTVENRPLARALYDQVDIDQAVPEEYFKAIAEILAYVYKTK 358


>gi|254519406|ref|ZP_05131462.1| flagellar biosynthetic protein FlhB [Clostridium sp. 7_2_43FAA]
 gi|226913155|gb|EEH98356.1| flagellar biosynthetic protein FlhB [Clostridium sp. 7_2_43FAA]
          Length = 614

 Score =  326 bits (836), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 94/347 (27%), Positives = 189/347 (54%), Gaps = 1/347 (0%)

Query: 6   APDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVL 65
             D KTE  + KK  D+  +G    S++  L  +++A ++ ++      + S+  ++   
Sbjct: 261 GADEKTEEATPKKKSDSRKKGQIARSKDVGLAITMIATVLVVVALSGFIVSSLKDNVVYF 320

Query: 66  LASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKP 125
           L      ++ + + I  + T +   A+ +++P +L  M+ G+ + L+Q   ++  + +KP
Sbjct: 321 LGDMGSMEVTE-NSIKGINTLIISKAAMVIMPVILPIMIAGVAASLVQSGFLVVKDAIKP 379

Query: 126 SFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSIL 185
           SF +++   G K ++S  +LV  +K+ + I +V  I    + +N+  ++   +    ++ 
Sbjct: 380 SFGKLNPINGFKNMFSKKSLVELIKNLILIAIVIFIAYSYIRDNFDKIMQIGNLYLPTLG 439

Query: 186 YHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNR 245
                 +  + + I + +  + ++D    Y  +   ++M+KQEIK+E KQ  G+P IK++
Sbjct: 440 IEVKSLIVGIFVKICILLVVIAIIDYVVQYMLFQKDIRMTKQEIKEEYKQMEGDPQIKSK 499

Query: 246 QKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRK 305
            K   R   + +MM++   AT++ITNPTH A+A++Y + + +AP +VAKG + IA K+++
Sbjct: 500 IKQRQREMSQRRMMQSVGDATVVITNPTHLAVAIKYEEGKTEAPKVVAKGADTIAIKIKE 559

Query: 306 IAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
            A E  +PI E   LAR +F+ V I+  IP   Y+AVA+++  +Y  
Sbjct: 560 KAIESKVPIIENKPLARMIFESVEIDKEIPQDMYQAVAEVLAMVYKL 606


>gi|222147560|ref|YP_002548517.1| flagellar biosynthesis protein FlhB [Agrobacterium vitis S4]
 gi|221734548|gb|ACM35511.1| flagellar biosynthetic protein [Agrobacterium vitis S4]
          Length = 361

 Score =  326 bits (836), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 158/350 (45%), Positives = 239/350 (68%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M++++  ++KTE+PS KK+ DA  +GN PISREA LF++ LA  IY +FF   G+ ++  
Sbjct: 1   MADDEDQESKTESPSEKKMRDAAEQGNLPISREAPLFATTLAFYIYFVFFMPQGVSTLYQ 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L  L+    Q  +   + ++ L  HL  S + ++ P LLLFM+FG+     Q +P   L
Sbjct: 61  TLRDLMEKPDQWIIGTGTDVISLFVHLGWSMAAMLGPALLLFMLFGLTQSFAQHLPSFVL 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + + P  +R+SL  GI R++S+   V F KS  KII+V  I+ +S+   YF  LD + ++
Sbjct: 121 DRITPKMERLSLIGGIGRMFSVMGFVEFGKSLFKIIVVAIIMFVSMRGQYFGTLDAMLSD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P  I       V+++LI++L     LTV+D+GW  + WY KL+M++QE+KDE KQS G+P
Sbjct: 181 PQIIFVKLSDIVQEMLIIVLFATGLLTVMDLGWQRYNWYQKLRMTRQEVKDEHKQSQGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           ++K RQ+S  R + R +MM    RAT+IITNPTH+A+ALRY++TE +AP+++AKGQ+LIA
Sbjct: 241 VVKARQRSAQRDQARRRMMNNVPRATMIITNPTHFAVALRYVRTEMEAPIVLAKGQDLIA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
            K+R+IA E+NIPIFE+P LARS+F QV ++S IPP+FYKAVA+++ ++Y
Sbjct: 301 LKIREIAEENNIPIFEDPPLARSMFAQVSVDSVIPPIFYKAVAEIVQRLY 350


>gi|77918767|ref|YP_356582.1| flagellar biosynthesis protein FlhB [Pelobacter carbinolicus DSM
           2380]
 gi|77544850|gb|ABA88412.1| flagellar biosynthetic protein FlhB [Pelobacter carbinolicus DSM
           2380]
          Length = 351

 Score =  326 bits (836), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 97/353 (27%), Positives = 183/353 (51%), Gaps = 4/353 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+  D+   +TE  + K+  D   +G    S+E    + +   L+   F+      +++ 
Sbjct: 1   MA--DSDQERTEQATGKRRADFRQKGQVAQSKEVHTAALMTGTLLLWTFYAPLFWRTLSD 58

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            LH L + A   ++  +S ++ LL  L    + L+ P +L  ++ GI S  +Q   +   
Sbjct: 59  MLHHLWSLAGDFEVTPVSAVM-LLGQLGQKIALLLAPIMLTTLVIGILSSYLQVGWLFTT 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F +++   G+ ++ S  + +  +KS +K+ LVG +    +   +   LD +  +
Sbjct: 118 KPLAPDFSKMNPVPGLAKLISKRSFIEVVKSLLKVFLVGVVAYKVILAEFGQALDLVDMD 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
            +  + +      ++L+     +  L +LD  +   +   K+KM+KQE K+E K+S G+P
Sbjct: 178 INDSVVYLARVAARILLRTCGVMILLALLDFLFVRWEMEQKMKMTKQEQKEEHKESEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R +S+     R +MM    +A ++ITNPTH ++AL Y ++   AP +VAKG + +A
Sbjct: 238 QIKARIRSMQMQAARRRMMAEVPKADVVITNPTHLSVALAYDRSRMSAPQIVAKGADAVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+IA EH +P+ E   +AR LFK V +   +P   ++AVA+++  +Y  K
Sbjct: 298 MRIREIAREHKVPLVENKPVARVLFK-VDLGKDVPEEMFQAVAEILAYVYGLK 349


>gi|237755398|ref|ZP_04584025.1| flagellar biosynthetic protein FlhB [Sulfurihydrogenibium
           yellowstonense SS-5]
 gi|237692439|gb|EEP61420.1| flagellar biosynthetic protein FlhB [Sulfurihydrogenibium
           yellowstonense SS-5]
          Length = 350

 Score =  326 bits (836), Expect = 4e-87,   Method: Composition-based stats.
 Identities = 92/344 (26%), Positives = 174/344 (50%), Gaps = 3/344 (0%)

Query: 10  KTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLASA 69
           KTE  + K+ + A  EG    S + S+ +S+    I L+F+       +        ++ 
Sbjct: 7   KTEKATPKRKQKAREEGQVLKSMDVSISASLFVIFIVLIFYLPFAYKYLVGYFKYTFSNP 66

Query: 70  TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKR 129
                    +    +       + L +P +L+  + GI S +IQ   +  L  + P   +
Sbjct: 67  LYLI---PDNGSMFIWFTLKILAILTLPVILILFIVGIASNVIQFGFLFTLKPLTPKLDK 123

Query: 130 VSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAF 189
           +++  GIKRI+S+  L   +K+  K+ +   +    +       L +++ + ++ +Y   
Sbjct: 124 LNVISGIKRIFSLTVLFELIKNLAKLTVALFLSYFLVKYLLNDFLVYMTGSINNQIYVLS 183

Query: 190 FTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKSI 249
            T+  +++        + + D  +  +++   LKM+K E+K+E K   GNP++K   +  
Sbjct: 184 KTIIILVMSFAFLSVPIAIADFLYRRYEYEENLKMTKDEVKEERKSYEGNPLVKREIRKR 243

Query: 250 ARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYE 309
            R     +M+    +A ++ITNP HYA+AL+Y + +  AP ++AKGQ+LIA+K++++A E
Sbjct: 244 MRQLALKRMIAEVPKADVVITNPEHYAVALKYERGKMHAPKVIAKGQDLIAQKIKEVAKE 303

Query: 310 HNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           H I I E+P LAR+L+    I   IP   Y+AVA+++ +IY  K
Sbjct: 304 HGIKIVEDPPLARTLYSSCEIGDYIPENLYEAVAKILAEIYKAK 347


>gi|313905147|ref|ZP_07838516.1| flagellar biosynthetic protein FlhB [Eubacterium cellulosolvens 6]
 gi|313470050|gb|EFR65383.1| flagellar biosynthetic protein FlhB [Eubacterium cellulosolvens 6]
          Length = 354

 Score =  326 bits (836), Expect = 4e-87,   Method: Composition-based stats.
 Identities = 95/351 (27%), Positives = 169/351 (48%), Gaps = 6/351 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+ +D    KTE P+ K+  +A  EGN   S++    + +LA  + L    +    ++ S
Sbjct: 1   MANDD----KTEQPTEKRKREAREEGNVFHSKDIVTVAVLLAGTMILRLRITDIQTTIKS 56

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
               +L          +S    L+   +L A+   +P  L        +   Q       
Sbjct: 57  MFFEVLNLMKGSTQNMLSR--HLMVSFALDAAVCALPIGLAAAFIEFVAGGAQTRFNFAK 114

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +KP  KR++   G+KR++S+  +V  +K+  K +++   + + L ++   +   I   
Sbjct: 115 KALKPQAKRMNPLNGLKRMFSLKGVVEALKNIAKTVVLVVFVYLILKDDIVPIAKMIDEP 174

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
                   F  +  +++ I L  + +   D  +  HQ+   L M+KQE+KDE K + GNP
Sbjct: 175 ISQANSQLFSMMFNLVLRICLAFSVIAAFDFMFQKHQYKKSLMMTKQEVKDEYKNTEGNP 234

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK R K   R   + +M++    A +II NPTH A+A++Y     +APV++AKG + +A
Sbjct: 235 EIKGRIKKKQREIAQRRMIQQVPSADVIIRNPTHVAVAIKYDPERAEAPVVLAKGVDSVA 294

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            ++ ++  E+ +P  E   LAR+L+    +N  IP  +Y AVA+L+  IY 
Sbjct: 295 LRIIEVGEENGVPWIENKPLARALYGACELNDQIPSEYYGAVAELLVYIYK 345


>gi|254473324|ref|ZP_05086721.1| flagellar biosynthetic protein FlhB [Pseudovibrio sp. JE062]
 gi|211957440|gb|EEA92643.1| flagellar biosynthetic protein FlhB [Pseudovibrio sp. JE062]
          Length = 353

 Score =  326 bits (835), Expect = 4e-87,   Method: Composition-based stats.
 Identities = 121/353 (34%), Positives = 207/353 (58%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE+  PD+KT+ P+ KK+ DAL +GN P+S+EAS+ +S+L  L+ L F        +  
Sbjct: 1   MSEDQDPDSKTQEPTEKKVRDALEKGNIPVSKEASVLASMLGLLLILSFIAVDKAQGLVQ 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L +  +      +  + L++ ++      + P + L + FG+ S  +Q  P L L
Sbjct: 61  FLKWFLDNPGEISFVSAAEPLQLMSAVAFELVWFLGPIVALLIFFGLASSFMQNTPRLVL 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + ++P   ++SL++G  R++S+N  + F+KS  K++ V  +  + L       L  + ++
Sbjct: 121 DRIEPKLSKISLKKGFGRLFSVNGAMEFIKSLFKLVTVIVVAALVLKSQQAVALTSMYSD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P  +          +L  I +    L   D+  +  QW   L+MS QE+KDE KQ+ G+P
Sbjct: 181 PTQLPQLILSVAMTLLSGICVATIFLVGFDLVLARFQWRKNLRMSHQELKDEFKQAEGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           +IK R +S+AR R R +MM +   AT+++ NPTH+A+AL Y +  + AP +VAKGQ++IA
Sbjct: 241 LIKARLRSLARDRARKRMMSSVQDATVVVANPTHFAVALYYERDGDQAPRVVAKGQDIIA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K++++AY H++P+ E+  LARSL+  V I+ +IP  +Y+AVA++I  +Y K+
Sbjct: 301 LKIKELAYIHDVPVVEDRQLARSLYAAVEIDQSIPEEYYRAVAEIISYVYLKR 353


>gi|296135634|ref|YP_003642876.1| flagellar biosynthetic protein FlhB [Thiomonas intermedia K12]
 gi|295795756|gb|ADG30546.1| flagellar biosynthetic protein FlhB [Thiomonas intermedia K12]
          Length = 373

 Score =  326 bits (835), Expect = 4e-87,   Method: Composition-based stats.
 Identities = 96/353 (27%), Positives = 175/353 (49%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E D+   K    S K+ + A  +G    SR+ +  S +L  +  +++      Y +  
Sbjct: 1   MAE-DSAQEKELPASQKRKQQAREKGQVARSRDLTS-SLLLLGMAAVVYTAGGWFYDMGR 58

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           +L     + +    +D + ++     + +    ++ P L L  +      +     V + 
Sbjct: 59  ELLQTGLTVSASASQDPAAMLQAAGRVLVLGLIVLAPVLALTFLASAAGGVAMGGWVFST 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P F R+   +GI R++SI  L    K+ +K I++  I  I +      +L  +   
Sbjct: 119 EALAPDFSRLDPVKGIGRMFSITGLGELGKALLKAIVIAVIAGIVIWNERGALLGLLQVE 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P            +  + +      +  +D+ W   Q   KLKMS+Q+++DE+++S GNP
Sbjct: 179 PQLAQMQLGQITARAFLWMASGTLLVAAVDVPWQLFQMNKKLKMSRQDLQDEMRESEGNP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            IK + + + R R R +MM A  +A +++TNPTHYA+AL Y + +N APV++A G + +A
Sbjct: 239 QIKQKMRELQRERARKRMMAAVPKADVVVTNPTHYAVALAYKEGKNRAPVVLALGADRVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R++A EHN+P+ E P LAR+LF    +   IP   Y AVA L+  ++  +
Sbjct: 299 ARIREVAAEHNVPVIEAPPLARALFHHAELEQEIPVALYNAVALLLAYVFQLR 351


>gi|291558215|emb|CBL35332.1| flagellar biosynthetic protein FlhB [Eubacterium siraeum V10Sc8a]
          Length = 353

 Score =  325 bits (834), Expect = 5e-87,   Method: Composition-based stats.
 Identities = 96/351 (27%), Positives = 180/351 (51%), Gaps = 6/351 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+     + KTE  + KK +D   +G    S+E ++   ++    +L  F +     + +
Sbjct: 1   MA----GEEKTEKATPKKRKDTRKKGEVLQSKEVAVAVFVVGIFAFLAIFGNYMFQMLLN 56

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   ++S  +     +   + +   +++     V P L + ++  +   ++Q   + ++
Sbjct: 57  FMEQSMSSIDKTG-NTVEFAMSVFWKVAIICVCTVGPILAVGVVLSVLPVIVQTKGLFSM 115

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +KP F R++   GIKR++S+  LV  +K  ++II+V  I+   + +        I  +
Sbjct: 116 EAMKPKFSRLNPFTGIKRLFSMQALVGLVKGLIEIIVVVAILYFQVMDRINEFKKLIDTD 175

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
              I+ +   T   +++ I + +  +   D  + +  +  KLKMSKQE+KDE KQ  G+P
Sbjct: 176 VIKIVAYISETAMSLIVTIFVMLVFVAAADYVFQWWSFEKKLKMSKQEVKDEYKQLEGDP 235

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEN-DAPVLVAKGQNLI 299
            IK + K   +   + +MM+    A +++ NPTHYA+AL+Y +     APV+VAKG + +
Sbjct: 236 QIKGKIKRKQQEMAQQRMMQEVPSADVVVRNPTHYAVALKYDRKTAYRAPVVVAKGTDAL 295

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           A ++  +A EHN+ I E   LAR L++ V I   IP  FY AVA+++  +Y
Sbjct: 296 ALRIVAVAEEHNVYITENRPLARGLYEAVDIGQEIPREFYTAVAEVLAMVY 346


>gi|300697969|ref|YP_003748630.1| flagellar export pore protein [Ralstonia solanacearum CFBP2957]
 gi|299074693|emb|CBJ54250.1| flagellar export pore protein [Ralstonia solanacearum CFBP2957]
          Length = 387

 Score =  325 bits (834), Expect = 5e-87,   Method: Composition-based stats.
 Identities = 92/353 (26%), Positives = 173/353 (49%), Gaps = 3/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE  +   KTE  S++++E A  EG+ P SRE   F  +      L       + + ++
Sbjct: 1   MSEE-SDLEKTEPASARRLEQAREEGDVPQSRELVSFVLLAVSAGGLWVMGESIVRAASA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L     R     +   +            V+ GL+L ++    + L      ++L
Sbjct: 60  FLARCLE--FHRYDYTRAQDQWQYVGAQFGPLATVLAGLMLMLVLAALAPLALTRGAISL 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   R+    G+KR++S+  L+   +   K+ LVG +    +       ++    +
Sbjct: 118 KPLTPDITRLIGMHGLKRMFSVQGLLELPRLLAKLALVGGVGWWLILHYRDDFVELPRQD 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             + ++          + +   +  +  +D+  +  Q+  K +M+K+E++ E ++S G+P
Sbjct: 178 LAAGMHDTMHVAGVAFLCMAGVMLLVAAVDVPLALWQYARKHRMTKEEVRKEHRESEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +++ R   + +MM    +A +I+TNPTHYA+ALRY + E  AP ++AKG +++A
Sbjct: 238 QLKGRIRAMQRQAAQRRMMADVPKADVIVTNPTHYAVALRYSEQEGGAPRVLAKGADMVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++  EH IP+ E P LAR+L++   I   IP   Y AVA+++  +Y  +
Sbjct: 298 AKIRELGAEHKIPMLEAPPLARALYRHTEIGHQIPTALYAAVAEVLAYVYQLR 350


>gi|166712016|ref|ZP_02243223.1| flagellar biosynthesis protein FlhB [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 376

 Score =  325 bits (834), Expect = 6e-87,   Method: Composition-based stats.
 Identities = 92/353 (26%), Positives = 179/353 (50%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE++    +TE P+ K++ +A  +GN P SRE S  +   A +  L+          T+
Sbjct: 1   MSESEDGGERTELPTEKRLREAREQGNIPQSRELSTAAVFGAGVFALMALARGIGDGATA 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L S      E+   +     +L L    +++P + + +  G+   L+      + 
Sbjct: 61  WMKTAL-SPDPTMRENPMALFGHFGNLLLQLLWVMLPLIGICLAAGLAGPLLMSGLHFSG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   +++   G+KR++  N+L   +KS ++++ VG   +  ++++   +   +S  
Sbjct: 120 KAIMPDLTKLNPANGLKRMWGSNSLAELVKSVLRLLFVGLAASFCISKSLPGLRSLVSQP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + +     + +L      +  L  +D  +    W  KLKM+++EIK E+K+S G+P
Sbjct: 180 LEQAVGNGLDFTKSLLFYTAGALVLLAAIDAPYQKWNWMRKLKMTREEIKREMKESEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + +     + +MMEA  +A +++ NPTHYA+AL+Y   +  AP++VAKG + +A
Sbjct: 240 EVKGRIRQMQMQMSQRQMMEAVPKADVVLMNPTHYAVALKYEGGKMRAPIVVAKGVDEMA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+   +H + I   P LAR+L+++  I   IP   Y  VAQ++  +Y  +
Sbjct: 300 FRIREAGEQHRVAIVTAPPLARALYREAQIGKEIPVRLYSVVAQVLSYVYQLR 352


>gi|57168473|ref|ZP_00367607.1| flagellar biosynthetic protein FlhB [Campylobacter coli RM2228]
 gi|305432892|ref|ZP_07402050.1| flagellar biosynthetic protein FlhB [Campylobacter coli JV20]
 gi|57020281|gb|EAL56955.1| flagellar biosynthetic protein FlhB [Campylobacter coli RM2228]
 gi|304444046|gb|EFM36701.1| flagellar biosynthetic protein FlhB [Campylobacter coli JV20]
          Length = 362

 Score =  325 bits (834), Expect = 6e-87,   Method: Composition-based stats.
 Identities = 107/350 (30%), Positives = 186/350 (53%), Gaps = 4/350 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+  D    KTE P+SKKIEDA  EGN P S++A+   +++   +  LF        +T+
Sbjct: 1   MAGED--QEKTEEPTSKKIEDARKEGNVPKSQDAAAIVTLIVGFVITLFMMGFIGERITN 58

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
                 +        D+  I  ++         L+ P +L  M+ GI   ++Q   +   
Sbjct: 59  LYRYYQSFIGVE--FDLRIIQAIMIKSIFEVLILLAPIVLSIMIAGILGNVMQFGFIFTT 116

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P+  +++  +G+K ++S+  LV  +K  +K+ +V T+  I L +    +      N
Sbjct: 117 KPIMPNLGKINPLKGLKNLFSLKKLVESVKIVLKVGVVFTVAFIVLLKFMQELPLVERYN 176

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               L         +  ++++    + VLDI     Q++  L+MSKQEIKDE KQ  G+P
Sbjct: 177 IIGQLIWLRDRAIILAAIVIIAFLVIAVLDIFLVRFQYFKGLRMSKQEIKDEYKQMEGDP 236

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + +     R +M++  + A ++ITNPTHYA+A+RY  T+  AP +VAKG + +A
Sbjct: 237 QVKGRIRRLQMEAARRRMVQDVAGADVVITNPTHYAVAIRYDTTKEQAPRVVAKGVDFLA 296

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
            +++++AY++N+ ++E P LAR L+K   IN  IP   +KAVA+++  +Y
Sbjct: 297 LRIKQVAYDNNVVVYENPPLARELYKACDINDLIPREMFKAVAEVLGFVY 346


>gi|158422263|ref|YP_001523555.1| flagellar biosynthesis protein FlhB [Azorhizobium caulinodans ORS
           571]
 gi|158329152|dbj|BAF86637.1| flagellar biosynthetic protein [Azorhizobium caulinodans ORS 571]
          Length = 359

 Score =  325 bits (834), Expect = 6e-87,   Method: Composition-based stats.
 Identities = 121/351 (34%), Positives = 206/351 (58%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MS++   ++KTE  + +K+ DAL +GN P SRE +LF+S+L  L  L FF    +  +T 
Sbjct: 1   MSDDTDKESKTEEATERKVSDALEKGNVPYSRETALFASLLGILGVLTFFVVNPVRILTV 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           +L   L +     L      + L   + L   ++++P +LL    G+ + L Q  P L L
Sbjct: 61  ELTHFLDNPAGFTLAGSDDAIALAWGVLLLMGQVLLPAVLLLAAAGLAASLFQNTPRLVL 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           N ++P F R+   +G  RI+S +  + F KS  K+++V  I  + L      +++ + ++
Sbjct: 121 NRIQPQFSRIDPMKGWTRIFSRDGGIEFGKSAFKLVVVAVICGVLLMSERDKVMNAMYSD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P  +         +++  + +    L  LD+ WS   W ++L+M+KQE+K+E+KQ  G+P
Sbjct: 181 PLLMPSVILSLATRLISAVCVATIVLVALDLVWSRFHWRAELRMTKQEVKEEMKQQEGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           ++K R +S+A+ R R +MM +  +AT+++ NPTHYA+AL Y + +  AP +VAKG +LIA
Sbjct: 241 MVKARMRSLAQQRARQRMMSSVPKATLVVANPTHYAIALYYDRQKGGAPQVVAKGTDLIA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYH 351
            K+R+IA   +IP+ E+  LAR+++  V ++  IPP FYK VA+++Y IY 
Sbjct: 301 LKIREIAERCSIPVIEDKPLARAMYDAVEVDQWIPPEFYKPVAKILYFIYS 351


>gi|312126838|ref|YP_003991712.1| flagellar biosynthetic protein flhb [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311776857|gb|ADQ06343.1| flagellar biosynthetic protein FlhB [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 366

 Score =  325 bits (834), Expect = 6e-87,   Method: Composition-based stats.
 Identities = 102/344 (29%), Positives = 186/344 (54%), Gaps = 1/344 (0%)

Query: 10  KTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLASA 69
           KTE  + +K ++A   G    SRE +   ++L  +++L F +S  I  +        ++ 
Sbjct: 16  KTEKATPRKRQEARKRGMVAKSREVTSAFALLISVLFLKFGYSLIIEPLQQGSKYFFSNL 75

Query: 70  TQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKR 129
               LED+     LL+ +  ++ ++V+P  L  M         Q   ++    +K SF++
Sbjct: 76  -NYNLEDVRDASRLLSFIITTSLKMVLPFCLTIMFVATIVEWAQSSFLITAQSLKMSFQK 134

Query: 130 VSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAF 189
           ++  EG KRI+SIN++V  +KS +K++++G             +L+    N  +I+  +F
Sbjct: 135 INPIEGFKRIFSINSVVELIKSILKVLIIGYTGYSYTQSFAKKLLEMYEMNVLTIVKFSF 194

Query: 190 FTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKSI 249
            +   +++ + +    + V+D  +   Q+  KL M+K+E+K+E KQ+ GNP IK++ +  
Sbjct: 195 DSAINLILWMAVMFFGIAVIDFIFQRQQYEKKLMMTKEEVKEEFKQTEGNPQIKSKIRER 254

Query: 250 ARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYE 309
            R     +M +   +A ++ITNPTHYA+AL Y   + DAP ++AKG++ IA K+++ A +
Sbjct: 255 QRRISLQRMFQQLPKADVVITNPTHYAVALLYEPEKFDAPRVIAKGKDYIALKIKQEAIK 314

Query: 310 HNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           H I I E   LA++L+    I   IPP  Y+AVA+++  +Y  K
Sbjct: 315 HRIEIVENRELAKALYNMCEIGDFIPPELYQAVAEVLAYVYSLK 358


>gi|207725003|ref|YP_002255400.1| flagellar biosynthetic protein flhb [Ralstonia solanacearum MolK2]
 gi|206590230|emb|CAQ37191.1| flagellar biosynthetic protein flhb [Ralstonia solanacearum MolK2]
          Length = 387

 Score =  325 bits (834), Expect = 6e-87,   Method: Composition-based stats.
 Identities = 91/353 (25%), Positives = 173/353 (49%), Gaps = 3/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE  +   KTE  S++++E A  EG+ P SRE   F  +      L       + + ++
Sbjct: 1   MSEE-SDLEKTEPASARRLEQAREEGDVPQSRELVSFVLLTVSAGGLWVMGESIVRAASA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L     R     +   +            V+ GL+L ++    + L      ++ 
Sbjct: 60  FLARCLE--FHRYDYTRAQDQWQYVGAQFGPLATVLAGLMLMLVLAALAPLALTRGAISF 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   R+    G+KR++S+  L+   +   K++LVG +    +       ++    +
Sbjct: 118 KPLTPDITRLIGMHGLKRMFSVQGLLELPRLLAKLVLVGGVGWWLILHYRDDFVELPRQD 177

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
             + ++          + +   +  +  +D+  +  Q+  K +M+K+E++ E ++S G+P
Sbjct: 178 LVAGMHDTMHVAGVAFLCMAGVMLLVAAVDVPLALWQYARKHRMTKEEVRKEHRESEGDP 237

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +++ R   + +MM    +A +I+TNPTHYA+ALRY + E  AP ++AKG +++A
Sbjct: 238 QLKGRIRAMQRQAAQRRMMADVPKADVIVTNPTHYAVALRYSEQEGGAPRVLAKGADMVA 297

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R++  EH IP+ E P LAR+L++   I   IP   Y AVA+++  +Y  +
Sbjct: 298 AKIRELGAEHKIPMLEAPPLARALYRHTEIGHQIPTALYAAVAEVLAYVYQLR 350


>gi|289523553|ref|ZP_06440407.1| flagellar biosynthetic protein FlhB [Anaerobaculum hydrogeniformans
           ATCC BAA-1850]
 gi|289503245|gb|EFD24409.1| flagellar biosynthetic protein FlhB [Anaerobaculum hydrogeniformans
           ATCC BAA-1850]
          Length = 367

 Score =  325 bits (833), Expect = 7e-87,   Method: Composition-based stats.
 Identities = 86/346 (24%), Positives = 163/346 (47%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
           + KTE  + ++   A  EG    S +     +IL  ++ L         ++       L+
Sbjct: 16  EEKTEPATPRRRRKAREEGQVAKSMDLVSSVAILTGVLLLFAMGFFLFSTLKQFFVWELS 75

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
             +         I            +   P  +L  +  +     Q   ++    + P  
Sbjct: 76  HLSDDVNFRGQWIWRASARGLAVYLKTWFPLAILSALGVVLISFAQVGFLITPKPLVPKL 135

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
            R++   G+K++ S+ +LV  +K  +K  L+ +++   L ++  T+L  +       L  
Sbjct: 136 NRLNPVSGLKKVLSLRSLVELIKGLLKATLLASVLYFGLKKSLETLLLTMQMPLSGGLGI 195

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
              T+  + + + + +  + + D  +   ++   +KMS+QEIK+E KQ  G+P +K R +
Sbjct: 196 LSKTILNLSLKMAIALFAIAIFDYAYQKWEFERSIKMSRQEIKEEFKQLEGDPQLKRRIR 255

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              R   R +MM    +A ++ITNPT  A+A+ Y +   DAPV++AKG  ++A K+R+ A
Sbjct: 256 QRQRELARRRMMAEVKKADVVITNPTRIAVAILYDKKIMDAPVVIAKGLGVVAGKIREEA 315

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            +++IP+ + P LA +L+  V I   IP   YKAVA+++  +Y  K
Sbjct: 316 IKYDIPLVQRPPLAWTLYNNVEIGEKIPEELYKAVAEILVFVYRLK 361


>gi|167464149|ref|ZP_02329238.1| flagellar biosynthesis protein FlhB [Paenibacillus larvae subsp.
           larvae BRL-230010]
          Length = 363

 Score =  325 bits (833), Expect = 7e-87,   Method: Composition-based stats.
 Identities = 99/347 (28%), Positives = 179/347 (51%), Gaps = 1/347 (0%)

Query: 7   PDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLL 66
              KTE  + KK E+A  +G    S E      +    + LL F       +   +   L
Sbjct: 14  SGEKTEKATPKKREEAKKKGQVAKSMEIPASLILFFTFLGLLLFSGFMKDRLLGLVTYTL 73

Query: 67  ASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPS 126
                  +  ++++  +  HL   A  L+ P  ++ ++    +   Q   +     +K  
Sbjct: 74  EHDLVMNV-TLNNVQMMFLHLIGEAFLLLAPIFIISVVIAFFANYAQIGFLFTGEPLKMK 132

Query: 127 FKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILY 186
           F +++  EG KRI+S+  +++F+KS +K+I++  I+ +++      ++         +L 
Sbjct: 133 FNKINPIEGAKRIFSLRAIIDFLKSTIKMIVIAAIVWMTIWGEKDKLISLGHVPLQDMLP 192

Query: 187 HAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQ 246
           +      ++ + I   +  +  LD  +   ++   L+MSKQEIKDE K+S G+P+IK + 
Sbjct: 193 YIGSLTVQLGLKIGGVLIAIAALDYMYQKFEYEKSLRMSKQEIKDEFKKSEGDPLIKGKI 252

Query: 247 KSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKI 306
           +   R     +MM+   +A +IITNPTH+A+ALRY   E +AP ++AKG +LIA K++++
Sbjct: 253 RERQRRMAMQRMMQEVPKADVIITNPTHFAVALRYDAAEMEAPAVIAKGTDLIALKIKEV 312

Query: 307 AYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A E+ + I E   LAR+L+ QV I  AIP   ++AVA+++  +Y  K
Sbjct: 313 AKENGVTIMENKPLARALYAQVEIGQAIPADLFQAVAEVLAYVYKAK 359


>gi|292493584|ref|YP_003529023.1| flagellar biosynthetic protein FlhB [Nitrosococcus halophilus Nc4]
 gi|291582179|gb|ADE16636.1| flagellar biosynthetic protein FlhB [Nitrosococcus halophilus Nc4]
          Length = 377

 Score =  325 bits (833), Expect = 8e-87,   Method: Composition-based stats.
 Identities = 87/353 (24%), Positives = 174/353 (49%), Gaps = 2/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+ +   +TE P+ K+ ++A  +G  P SRE S    +L+  + LL      +  +  
Sbjct: 1   MAES-SAQERTEQPTPKRQQEAREKGQVPRSRELSTTVLLLSSALGLLLMGEFFLQGLAE 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L    + ++ + +  +         A + + P L L ++  + + L+      + 
Sbjct: 60  LMRQGLR-LERAQIFEPAAAILQFQQALWEALKTITPFLFLTLIAALAAPLLMGGWSFSF 118

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +   ++++   +G+KR++     +  +K+  K +L+G I  +        ++      
Sbjct: 119 QALGFKWEKLDPLKGMKRVFGPQGWMELLKALAKFLLLGGIACVLFWYLGPDLIALGRQG 178

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               LY     +    + +   +  +  +D  + +     +LKM+ QEIK+E K++ G+P
Sbjct: 179 LIPALYQLAHLMGWSFLGLSASLVLIAAIDAPFQHWHHTRQLKMTHQEIKEEHKETEGSP 238

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + + R     +MM A  +A +++TNPTHYA+AL Y Q +  AP +VAKG + +A
Sbjct: 239 ELKARVRRVQREIAGRRMMAAVPQANVVVTNPTHYAVALDYQQDKGGAPRVVAKGADQVA 298

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            K+R +A  +N+P+   PSL+R+L+    +N  IP   Y AVAQ++  ++  +
Sbjct: 299 LKIRAVAAANNVPVLSAPSLSRALYYNTELNQEIPAGLYVAVAQVLAYVFQLR 351


>gi|84624133|ref|YP_451505.1| flagellar biosynthesis protein FlhB [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|161898983|ref|YP_201256.2| flagellar biosynthesis protein FlhB [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|6969591|gb|AAF33828.1|AF226282_2 flagellar biosynthetic protein FlhB [Xanthomonas oryzae pv. oryzae]
 gi|84368073|dbj|BAE69231.1| flagellar biosynthetic protein FlhB [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
          Length = 376

 Score =  325 bits (833), Expect = 8e-87,   Method: Composition-based stats.
 Identities = 91/353 (25%), Positives = 178/353 (50%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE++    +TE P+ K++ +A  +GN P SRE S  +   A +  L+          T+
Sbjct: 1   MSESEDGGERTELPTEKRLREAREQGNIPQSRELSTAAVFGAGVFALMALARGIGDGATA 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L S      E+   +      L L    +++P + + +  G+   L+      + 
Sbjct: 61  WMKTAL-SPDPTMRENPMALFGHFGDLLLQLLWVMLPLIGICLAAGLAGPLLMSGLHFSG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   +++   G+KR++  N+L   +KS ++++ VG   +  ++++   +   +S  
Sbjct: 120 KAIMPDLTKLNPANGLKRMWGSNSLAELVKSVLRLLFVGLAASFCISKSLPGLRSLVSQP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + +     + +L      +  L  +D  +    W  KLKM+++EIK E+K+S G+P
Sbjct: 180 LEQAVGNGLDFTKSLLFYTAGALVLLAAIDAPYQKWNWMRKLKMTREEIKREMKESEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + +     + +MMEA  +A +++ NPTHYA+AL+Y   +  AP++VAKG + +A
Sbjct: 240 EVKGRIRQMQMQMSQRQMMEAVPKADVVLMNPTHYAVALKYEGGKMRAPIVVAKGVDEMA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+   +H + I   P LAR+L+++  +   IP   Y  VAQ++  +Y  +
Sbjct: 300 FRIREAGEQHRVAIVTAPPLARALYREAQVGKEIPVRLYSVVAQVLSYVYQLR 352


>gi|295399827|ref|ZP_06809808.1| flagellar biosynthetic protein FlhB [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|294978230|gb|EFG53827.1| flagellar biosynthetic protein FlhB [Geobacillus
           thermoglucosidasius C56-YS93]
          Length = 360

 Score =  325 bits (833), Expect = 8e-87,   Method: Composition-based stats.
 Identities = 94/346 (27%), Positives = 173/346 (50%), Gaps = 1/346 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE  + +K ++   +G    S + +    +L   + L F  +     +   +H    
Sbjct: 13  GEKTEKATPRKRQEVRQKGQVAKSADINTALVMLVVFLVLSFSGTRHKELLLRLMHQSFE 72

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
                 L  I  +  +   L  + + +V P  L  +     +  +Q   +     +K ++
Sbjct: 73  QYALMDL-TIGAVHHIFLALLKNVATIVAPIFLAAVAAACLANFLQVGFLFTTEPLKINW 131

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
            R+   +G+KRI S+  LV  +KS +KI +VG +    L      +L   + +  + L  
Sbjct: 132 SRLDPIQGVKRIISLRALVELLKSLLKISVVGLVTFALLWVQLDHILSLTTKSLEATLSS 191

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
                 K+ +     +  L + D  +   ++   ++MSKQ+IKDE K++ G+P+IK+R K
Sbjct: 192 LASLTVKMGLYASFALLFLAIFDYLYQRFEFEKNIRMSKQDIKDEYKKTEGDPLIKSRIK 251

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              R     +MM+   +A ++ITNPTHYA+AL+Y   + DAP++VAKG + +A K++++A
Sbjct: 252 QKQREMAMRRMMQEVPKADVVITNPTHYAVALKYEDGKMDAPIVVAKGVDYVALKIKQLA 311

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            EH++   E   LA++L++Q  +   IP  F+KAVA+++  +Y  K
Sbjct: 312 KEHDVVTVENRPLAQALYRQTEVGDMIPEEFFKAVAEILAYVYRLK 357


>gi|188576802|ref|YP_001913731.1| flagellar biosynthesis protein FlhB [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188576995|ref|YP_001913924.1| flagellar biosynthesis protein FlhB [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188521254|gb|ACD59199.1| flagellar biosynthetic protein FlhB [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188521447|gb|ACD59392.1| flagellar biosynthetic protein FlhB [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 376

 Score =  324 bits (832), Expect = 9e-87,   Method: Composition-based stats.
 Identities = 91/353 (25%), Positives = 178/353 (50%), Gaps = 1/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE++    +TE P+ K++ +A  +GN P SRE S  +   A +  L+          T+
Sbjct: 1   MSESEDGGERTELPTEKRLREAREQGNIPQSRELSTAAVFGAGVFALMALARGIGDGATA 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   L S      E+   +      L L    +++P + + +  G+   L+      + 
Sbjct: 61  WMETAL-SPDPTMRENPMALFGHFGDLLLQLLWVMLPLIGICLAAGLAGPLLMSGLHFSG 119

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   +++   G+KR++  N+L   +KS ++++ VG   +  ++++   +   +S  
Sbjct: 120 KAIMPDLTKLNPANGLKRMWGSNSLAELVKSVLRLLFVGLAASFCISKSLPGLRSLVSQP 179

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
               + +     + +L      +  L  +D  +    W  KLKM+++EIK E+K+S G+P
Sbjct: 180 LEQAVGNGLDFTKSLLFYTAGALVLLAAIDAPYQKWNWMRKLKMTREEIKREMKESEGSP 239

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R + +     + +MMEA  +A +++ NPTHYA+AL+Y   +  AP++VAKG + +A
Sbjct: 240 EVKGRIRQMQMQMSQRQMMEAVPKADVVLMNPTHYAVALKYEGGKMRAPIVVAKGVDEMA 299

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            ++R+   +H + I   P LAR+L+++  +   IP   Y  VAQ++  +Y  +
Sbjct: 300 FRIREAGEQHRVAIVTAPPLARALYREAQVGKEIPVRLYSVVAQVLSYVYQLR 352


>gi|302384124|ref|YP_003819947.1| flagellar biosynthetic protein FlhB [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302194752|gb|ADL02324.1| flagellar biosynthetic protein FlhB [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 362

 Score =  324 bits (832), Expect = 9e-87,   Method: Composition-based stats.
 Identities = 105/354 (29%), Positives = 190/354 (53%), Gaps = 2/354 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E+  P++KTE  S +K+E+A  +G+   S + +   S+L     L+        ++  
Sbjct: 1   MAEDADPESKTEEASPQKLEEARKKGDVAKSADVAPALSLLCVTGVLIMGGGYFATNMAQ 60

Query: 61  DLHVLLASATQRKL-EDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLN 119
                +A+        +    V +   +    +  +   +L  ++ G+G  + Q   V++
Sbjct: 61  GFLPFIAAPHAMLGGLEAGGGVEIGARVLWVVAPFLGAVMLAAILGGVGGNVAQSGLVIS 120

Query: 120 LNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISA 179
              +KP + +VS   G KRI+  + L+ F ++ +K++ VG I  + L  +        + 
Sbjct: 121 AEKMKPKWSKVSPMAGFKRIFGPDGLMQFAQTLLKLVAVGVICWMVLKPHARQFETMAAM 180

Query: 180 NPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
           +P +IL  A   +  ++   L+F+A     D  W   ++  +++MSK+E+K+E KQS G+
Sbjct: 181 SPLTILPLARDLMIALMSSALVFLALTAGGDFVWQKMRFAKRMRMSKEELKEEYKQSEGD 240

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLI 299
           P IK + K I   R R +MM+   +AT+I+TNPTHY++ALRY    + APV VAKG + +
Sbjct: 241 PHIKAKLKQIRMQRSRQRMMQNVPKATVIVTNPTHYSVALRYEAG-DAAPVCVAKGVDAV 299

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           A ++R++A EH++PI E   LAR+L+  V I+  IP   ++A A++I  +  K+
Sbjct: 300 AMRIREVAREHDVPIVENVPLARALYAAVDIDETIPREHFEAAARVIGFVMKKR 353


>gi|255321961|ref|ZP_05363111.1| flagellar biosynthetic protein FlhB [Campylobacter showae RM3277]
 gi|255301065|gb|EET80332.1| flagellar biosynthetic protein FlhB [Campylobacter showae RM3277]
          Length = 358

 Score =  324 bits (832), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 101/353 (28%), Positives = 192/353 (54%), Gaps = 10/353 (2%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILAC---LIYLLFFFSPGIYS 57
           M+  D    KTE P+SKKIEDA  +GN P S++ + F ++      ++ LL F     ++
Sbjct: 1   MAGED--QEKTEEPTSKKIEDARKDGNVPKSQDLAGFVTLAVAIFVVVALLGFIGDQFFT 58

Query: 58  VTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPV 117
           + +    L+     RKL     +  +          +++P  +   + G+ + L+Q   +
Sbjct: 59  LYNYYQSLIGQEFTRKL-----LFSVAITTIFRTLLIILPIAVCIAIAGVVANLMQFGFI 113

Query: 118 LNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFI 177
                ++P+  +++  +G+K ++S+  L++ +K  +K+  V T+  +        +   +
Sbjct: 114 FTTKPLEPNLNKINPIKGLKNLFSLKKLIDGIKMVLKVTAVFTVGFLMFLSFIKELPHTL 173

Query: 178 SANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSY 237
             +  + L      +  +  ++L+ +  + +LD+     Q++  L+MSKQEIKDE KQ  
Sbjct: 174 FFSMAAQLAWLKEKMLILAAVMLIVMFIIGLLDVLIVRFQYFRDLRMSKQEIKDEYKQME 233

Query: 238 GNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQN 297
           G+P +K R + +     R++MM+   +A +IITNPTHYA+ALRY +T+  APV++AKG +
Sbjct: 234 GDPQVKGRIRQLQMRAARNRMMQNIPQADVIITNPTHYAVALRYDKTKEKAPVILAKGVD 293

Query: 298 LIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
            +A ++++I  ++N+ I E P LAR L+K   +N  IP   ++AVA+++  +Y
Sbjct: 294 FLALRIKQIGVQNNVKIVENPPLARELYKMCEVNDMIPAELFRAVAEVLSFVY 346


>gi|172057870|ref|YP_001814330.1| flagellar biosynthesis protein FlhB [Exiguobacterium sibiricum
           255-15]
 gi|171990391|gb|ACB61313.1| flagellar biosynthetic protein FlhB [Exiguobacterium sibiricum
           255-15]
          Length = 363

 Score =  324 bits (832), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 98/346 (28%), Positives = 169/346 (48%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE  S +K +D+  +G    S + +    +    + L FF           L   L+
Sbjct: 15  GEKTEKASPRKRDDSRKKGQVAKSADLTSSLMLFGMFLILFFFGPFLGKRFVMVLENGLS 74

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
           + T     +   I  ++  + +    LV P  +  ++ GI    +Q   +L+   ++P  
Sbjct: 75  AQTVLVAVEEGRIQEVMIEMLVQMGILVAPFFVTAVVIGILGNFVQIGALLSTESIQPKL 134

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
            R++  +GIKRI S+  L+ F+KS  K++++G      L  N   +    S      L  
Sbjct: 135 DRINPLQGIKRIVSMKALIEFLKSVFKLLVIGATSGTVLWNNKVEISRLTSEPIGDALAI 194

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
                  + I + + +  L VLD  +    +   ++MSKQ++KDE K + G+P IK + K
Sbjct: 195 IGHLTFLLGISVSIALIVLAVLDFAYQKFDFEKSIRMSKQDLKDEHKNTEGDPQIKGKIK 254

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              R     +MM+    A ++ITNPTHYA+A++Y   ++ AP++VAKG + +A ++R+ A
Sbjct: 255 QQQREMAMRRMMQEIPNADVVITNPTHYAVAIQYDDGKHAAPIVVAKGVDAVAFRIREKA 314

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
               IPI E   LAR+LF +  I  A+   FY+A+A+ +  +Y  K
Sbjct: 315 TAAEIPIIENRPLARALFAKSEIGMAVDESFYQALAETLAFVYQMK 360


>gi|167750709|ref|ZP_02422836.1| hypothetical protein EUBSIR_01687 [Eubacterium siraeum DSM 15702]
 gi|167656388|gb|EDS00518.1| hypothetical protein EUBSIR_01687 [Eubacterium siraeum DSM 15702]
          Length = 353

 Score =  324 bits (832), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 96/351 (27%), Positives = 180/351 (51%), Gaps = 6/351 (1%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+     + KTE  + KK +D   +G    S+E ++   ++    +L  F +     + +
Sbjct: 1   MA----GEEKTEKATPKKRKDTRKKGEVLQSKEVAVAVFVVGIFAFLAIFGNYMFQMLLN 56

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            +   ++S  +     +   + +   +++     V P L + ++  +   ++Q   + ++
Sbjct: 57  FMEQSMSSIDKTG-NTVEFAMSVFWKVAIICICTVGPILAVGVVLSVLPVIVQTKGLFSM 115

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             +KP F R++   GIKR++S+  LV  +K  ++II+V  I+   + +        I  +
Sbjct: 116 EAMKPKFSRLNPFTGIKRLFSMQALVGLVKGLIEIIVVVAILYFQVMDRINEFKKLIDTD 175

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
              I+ +   T   +++ I + +  +   D  + +  +  KLKMSKQE+KDE KQ  G+P
Sbjct: 176 VIKIVAYISETAMSLIVTIFVMLVFVAAADYVFQWWSFEKKLKMSKQEVKDEYKQLEGDP 235

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTEN-DAPVLVAKGQNLI 299
            IK + K   +   + +MM+    A +++ NPTHYA+AL+Y +     APV+VAKG + +
Sbjct: 236 QIKGKIKRKQQEMAQQRMMQEVPSADVVVRNPTHYAVALKYDRKTAYRAPVVVAKGTDAL 295

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
           A ++  +A EHN+ I E   LAR L++ V I   IP  FY AVA+++  +Y
Sbjct: 296 ALRIVAVAQEHNVYITENRPLARGLYEAVDIGQEIPREFYTAVAEVLAMVY 346


>gi|312111661|ref|YP_003989977.1| flagellar biosynthetic protein FlhB [Geobacillus sp. Y4.1MC1]
 gi|311216762|gb|ADP75366.1| flagellar biosynthetic protein FlhB [Geobacillus sp. Y4.1MC1]
          Length = 360

 Score =  324 bits (832), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 94/346 (27%), Positives = 173/346 (50%), Gaps = 1/346 (0%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLA 67
             KTE  + +K ++   +G    S + +    +L   + L F  +     +   +H    
Sbjct: 13  GEKTEKATPRKRQEVRQKGQVAKSADINTALVMLVVFLVLSFSGTRHKELLLRLMHQSFE 72

Query: 68  SATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSF 127
                 L  I  +  +   L  + + +V P  L  +     +  +Q   +     +K ++
Sbjct: 73  QYALMDL-TIDAVHHIFLALLKNVATIVAPIFLAAVAAACLANFLQVGFLFTTEPLKINW 131

Query: 128 KRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYH 187
            R+   +G+KRI S+  LV  +KS +KI +VG +    L      +L   + +  + L  
Sbjct: 132 SRLDPIQGVKRIISLRALVELLKSLLKISVVGLVTFALLWVQLDHILSLTTKSLEATLSS 191

Query: 188 AFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQK 247
                 K+ +     +  L + D  +   ++   ++MSKQ+IKDE K++ G+P+IK+R K
Sbjct: 192 LASLTVKMGLYASFALLFLAIFDYLYQRFEFEKNIRMSKQDIKDEYKKTEGDPLIKSRIK 251

Query: 248 SIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIA 307
              R     +MM+   +A ++ITNPTHYA+AL+Y   + DAP++VAKG + +A K++++A
Sbjct: 252 QKQREMAMRRMMQEVPKADVVITNPTHYAVALKYEDGKMDAPIVVAKGVDYVALKIKQLA 311

Query: 308 YEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
            EH++   E   LA++L++Q  +   IP  F+KAVA+++  +Y  K
Sbjct: 312 KEHDVVTVENRPLAQALYRQTEVGDMIPEEFFKAVAEILAYVYRLK 357


>gi|188579884|ref|YP_001923329.1| flagellar biosynthesis protein FlhB [Methylobacterium populi BJ001]
 gi|179343382|gb|ACB78794.1| flagellar biosynthetic protein FlhB [Methylobacterium populi BJ001]
          Length = 354

 Score =  324 bits (832), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 119/350 (34%), Positives = 205/350 (58%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           M+E    ++KTEA + +++ +A+ +G+ P SREA +F+S L  LI L  F       +  
Sbjct: 1   MAEETDHESKTEAATERRVREAIEKGDIPFSREAPVFASTLGLLIALALFARGQASQLAR 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           D   LL       LE     + LL+ ++L+A R ++P LL+  +  + + L+Q +P   L
Sbjct: 61  DFAPLLDDPRGFALETGGDAMLLLSRVALAAGRFLLPILLILAVCSLTASLLQNLPRFVL 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           + ++P + RVS   G+ RI+  +  V F+KS VK + V  +  + L       ++ +  +
Sbjct: 121 DRIQPKWSRVSPMAGLSRIFGTSGQVEFLKSLVKFLSVSVVALLLLRSERTRAVNAMFVD 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P  +         +++  + +    +   D+ W+  +W   L+MS+Q+IKDE KQ+ G+P
Sbjct: 181 PSQLPELILTVSIRLVSAVAIATIVIVAGDLVWARLRWQRSLRMSRQDIKDEHKQTEGDP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
            +K R +S+A+ R R++M+    RAT++I NPTH+A+ALRY  +EN AP+++AKGQ+LIA
Sbjct: 241 SVKARLRSLAQDRARNRMLANVDRATVVIANPTHFAVALRYEPSENPAPLVLAKGQDLIA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIY 350
            ++R IA E  I + E+  LARSL+  V ++  IP  FY+AVAQ+++ ++
Sbjct: 301 LRIRAIAEEKGIAVIEDKPLARSLYDAVQVDQTIPAEFYRAVAQILFFLF 350


>gi|260438787|ref|ZP_05792603.1| flagellar biosynthetic protein FlhB [Butyrivibrio crossotus DSM
           2876]
 gi|292808776|gb|EFF67981.1| flagellar biosynthetic protein FlhB [Butyrivibrio crossotus DSM
           2876]
          Length = 370

 Score =  324 bits (831), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 99/358 (27%), Positives = 182/358 (50%), Gaps = 6/358 (1%)

Query: 2   SENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSD 61
           +++     +TE  ++KK++DA  +G    SR+ +   S+L   I L  +         ++
Sbjct: 10  AKDGPGGQRTEPATAKKLKDARKKGQVAKSRDLTSSVSLLVFFIILKIYVGTMGTKFINE 69

Query: 62  LHVLL-----ASATQRKLEDISHIV-FLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRI 115
             V+       +AT  +L  +S      ++   L    +++P +   ++      L+Q  
Sbjct: 70  FKVIYKKMGEVNATSLELNSLSRFFKNYMSDAILDMLVILLPIMAAAVLVAFVGDLVQVK 129

Query: 116 PVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLD 175
                  +KP   + +   GIKRI+S+  LV  +KS   + +   +    L +    + +
Sbjct: 130 WKPTAEPMKPKADKFNPVNGIKRIFSVKTLVQLLKSIAIVAICMLVTYNKLKKEIGLLYN 189

Query: 176 FISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQ 235
           F + +  + +      +  V I I +    + + D  + Y ++ + +KMSKQE+KDE K 
Sbjct: 190 FYNISLEAAIIRMGDVLLDVGITISVIYLIVGIADFIFEYVKFKNDMKMSKQELKDEWKD 249

Query: 236 SYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKG 295
           + GNP +KN+QK       R +MM+A   A ++ITNPTH+A+AL+Y Q    APV+VAKG
Sbjct: 250 TEGNPEVKNQQKRRMNEASRRRMMQAVPEADVVITNPTHFAVALKYEQNSGKAPVVVAKG 309

Query: 296 QNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK 353
           ++ +A+K+++ A ++ + I E   LAR L+  V + S IP   Y+AVA+++  ++  K
Sbjct: 310 EDYLAQKIKETARKNQVEIVENKPLARMLYYNVDLGSEIPQELYQAVAEVLAFVWKVK 367


>gi|83749403|ref|ZP_00946397.1| Probable transmembrane flagellar biosynthetic protein (flhB)
           [Ralstonia solanacearum UW551]
 gi|207738850|ref|YP_002257243.1| flagellar biosynthetic protein flhb [Ralstonia solanacearum
           IPO1609]
 gi|83723930|gb|EAP71114.1| Probable transmembrane flagellar biosynthetic protein (flhB)
           [Ralstonia solanacearum UW551]
 gi|206592220|emb|CAQ59126.1| flagellar biosynthetic protein flhb [Ralstonia solanacearum
           IPO1609]
          Length = 387

 Score =  324 bits (831), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 91/353 (25%), Positives = 172/353 (48%), Gaps = 3/353 (0%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE  +   KTE  S++++E A  EG+ P SRE   F  +      L       + + ++
Sbjct: 1   MSEE-SDLEKTEPASARRLEQAREEGDVPQSRELVSFVLLTVSAGGLWVMGESIVRAASA 59

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
            L   L     R     +   +            V+ GL+L +     + L      ++ 
Sbjct: 60  FLARCLE--FHRYDYTRAQDQWQYVGAQFGPLATVLAGLMLMLALAALAPLALTRGAISF 117

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
             + P   R+    G+KR++S+  L+   +   K++LVG +    +       ++    +
Sbjct: 118 KPLTPDITRLIGMHGLKRMFSVQGLLELPRLLAKLVLVGGVGWWLILHYRDDFVEL