RPSBLAST alignment for GI: 254780690 and conserved domain: PRK12721

>gnl|CDD|183700 PRK12721, PRK12721, secretion system apparatus protein SsaU; Reviewed. Length = 349
 Score =  148 bits (375), Expect = 2e-36
 Identities = 82/347 (23%), Positives = 148/347 (42%), Gaps = 11/347 (3%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSE      KTE P+ KK+ DA  +G    S E +    + A L+Y L    P +     
Sbjct: 1   MSE------KTEKPTEKKLRDARKKGQVVKSVEITSGVQLAALLLYFLLE-GPSLVEAII 53

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFG-IGSYLIQRIPVLN 119
            L         +           +    L      +  L   ++   +G+ + Q  P+L 
Sbjct: 54  GLINSTIQLLNKPFLYALT---QILGAVLEVLLRFLLVLGAGLIVATVGTGIAQVGPLLA 110

Query: 120 LNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISA 179
              + P  ++++     K+I+S+ ++    KS +K++++  I    L     +       
Sbjct: 111 SKAIGPKAEKINPVSNAKQIFSLKSVFELCKSLLKVVILSLIFAYLLHYYAPSFAYLPYC 170

Query: 180 NPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGN 239
                L      +  +   +L       +LD  +  ++   +LKMSK ++K E K S G+
Sbjct: 171 GAACGLPVVSTLIFWLWGGLLACYLVFGILDYSFQRYKIMKQLKMSKDDVKQEYKDSEGD 230

Query: 240 PIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLI 299
           P IK +++ +        +     ++T ++ NPTH A+ L Y   E   P ++ KG++  
Sbjct: 231 PEIKQKRRELQSEIQSGSLANNVKKSTAVVRNPTHIAVCLYYHPGETPLPRVLEKGKDAQ 290

Query: 300 AKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLI 346
           A  + K+A  + IP+ E   LAR+LFK+V     IP   ++ VA L+
Sbjct: 291 ALHIVKLAERNGIPVVENIPLARALFKEVECGDYIPETLFEPVAALL 337