RPSBLAST alignment for GI: 254780690 and conserved domain: PRK12773

>gnl|CDD|183737 PRK12773, flhB, flagellar biosynthesis protein FlhB; Reviewed. Length = 646
 Score =  116 bits (291), Expect = 1e-26
 Identities = 86/353 (24%), Positives = 179/353 (50%), Gaps = 22/353 (6%)

Query: 8   DNKTEAPSSKKIEDALNEGNAPISREASLFSSILA--CLIYLL--FFFSPGIYSVTSDLH 63
           + +TE  S ++  +   +GN P S E      +LA   L+YL+  +FF    Y +   +H
Sbjct: 298 EGRTEPGSERRRREEREKGNVPKSPELPAAVVLLAGVILVYLMGEYFFMRTYYILRKYIH 357

Query: 64  V------LLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPV 117
                  + + +    L++ S  +F L    L    + + G ++  +  +G     R   
Sbjct: 358 GVGLRTDMSSESVTELLKNASTDLFTLLWPLLG---ITLVGAIIGNVAQVGFIFTPRALS 414

Query: 118 LNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFI 177
            N + ++P+FK+V        + +   L N  KS  K+ L+  +  I +++++F +L   
Sbjct: 415 FNFSRIRPNFKKV--------LPTRQTLFNLGKSLAKVGLIAWVSYIIISKDFFPILLSG 466

Query: 178 SANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSY 237
                  +     +  K+ +++ + +  ++++D  +  +++   LKM+  E K E K+S 
Sbjct: 467 EMGLEQAVALVMNSSFKIFLIVGIILLAISIVDYLYQRYEYEESLKMTPSEAKREAKESD 526

Query: 238 GNPIIKNRQKSIARSRI-RHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQ 296
           G+  ++ R++ +AR  + + KM+     A ++ITNPTH+A+AL Y    + AP+++AKG 
Sbjct: 527 GDRSLQARRRQLARDMMNKRKMLAKVPEADVVITNPTHFAVALEYKPGIHKAPIVIAKGV 586

Query: 297 NLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKI 349
           +  A  + +IA E+ +P  E+   AR L+++V + + +P  FY+A+A ++ ++
Sbjct: 587 DDFALLIIRIARENGVPTVEDRLQARGLYEEVELGAEVPQQFYRAIATILSRL 639